Based on 966 opinions finded in 4 websites
Based on 966 opinions finded in 4 websites
Opinions
Very very tasty halal noodle restaurant., freshly cooked and good size portions. So good we went back the next day. Nothing like this where we are from Keep up the good work Jon and Jackie From Gloucester
Jon Bee . 2024-08-18
MORE AT Google
Ordered oodles through Uber eats, food arrived in decent time however food was poor. Sweet and sour chicken was very vibrant coloured however was tasteless. Firecracker chicken was soggy and overly hot considering it only had 1 chilli on the menu. Would not use this business again.
Ben Smith . 2024-08-15
MORE AT Google
This is good authentic Jamaican food and huge portion which can easily serve 2 people will be ordering again thank you!
Leonardo . 2024-08-13
MORE AT Just Eat
One of the best in a Cowley road (y)
farhan tanveer . 2024-08-05
MORE AT Google
I recently opted to use a food delivery platform to order a meal. Overall, the food was satisfactory, although the chips arrived somewhat soggy, which was a slight disappointment. Despite this minor issue, the meal was enjoyable enough, and it's hard to go wrong with the offerings from this place. I have experienced dining at other locations from this same chain before, and I've found that the quality of their food is reliably good across different branches.
Akber Ali . 2024-07-25
MORE AT Google
Ok for fast food. I would go again.
Halima Brewer . 2024-07-18
MORE AT Google
My order was missing parts, the delivery wasn’t exactly the best as the bag wasn’t sealed and the food container was burst open.
Dan . 2024-07-14
MORE AT Just Eat
They gave me the wrong order I called and they said they couldn’t do anything as the wrong driver took the food
madi . 2024-07-07
MORE AT Just Eat
A great go to restaurant for a lovely cost effective meal Served up within minutes and super tasty with a fair variety of mix and match options. My favourite is vegetable noodles with vegetable rice along with sweet and sour chicken and shezuen beef stir fry...get it in large and it'll go longer. Highly recommended.
Munir Shafi . 2024-06-23
MORE AT Google
Always great food! Quick delivery too.
Rachel . 2024-06-23
MORE AT Just Eat
Great tasting indo Chinese. Portion size good.
Nidhi Kapadia . 2024-06-22
MORE AT Google
Awful taste of the beef stir fry, the staff were not welcoming either. There was hardly any beef in the beef stir fry.
Waleed Azam . 2024-06-20
MORE AT Google
taste of the dragon chicken was quite nice but not evenly distributed so really flavour some on the first bit of noodles and then just plain noodles, chips were stale although nice spicy sauce on them. delivery time kept changing
Maryam . 2024-06-16
MORE AT Just Eat
Great food! Super tasty. Fast delivery as well.
Rachel . 2024-06-07
MORE AT Just Eat
God a delivery from here. Very tasty food spring rolls a bit small but also very delish. Have ordered since :)
Emily Jane . 2024-06-05
MORE AT Google
Food was OK, for the amount is overpriced
Mirfat . 2024-06-01
MORE AT Just Eat
I don’t understand why they say it will be delivered by 6.15 when it didn’t get delivered till nearly 7 that’s why I was very annoyed
Matt . 2024-05-21
MORE AT Just Eat
You'll be massively disappointed by the portions for the price you pay. Won't be eating here ever again and I'd advise you not to. Should of gone to a regular Chinese.
DARRYN DAVIES . 2024-05-20
MORE AT Google
Perfect noodles. However, be careful as you can get stomach problems the next day
Majidu Rahman . 2024-05-04
MORE AT Google
This was my first order but not last for sure. Food was cooked well and very tasty. Delivered on time.
Andzelika . 2024-05-01
MORE AT Just Eat
Actully this is nice restaurant, but the food just nice and plenty
Nazrul Akram Mohd Nasir . 2024-04-16
MORE AT Google
Shame order a sweet sour chicken and they send literally 10 bits and I order a large portion. Not bad not good acceptable as I’m at the hospital.better than hospital food.
Nelson . 2024-04-04
MORE AT Just Eat
Order a Large sweet and sour chicken, literally arrived only 10 small bits I counted, umbelievable!!!! Tons of noodles to fill the box, still waiting the protein!! I’m at the hospital so diferente than the food I’ve here but very low quality, I can make much better at home. Springs roll are good, need tbh! Won’t buy anything ever again!!!! Don’t waste your money or time Oxford Cowley, Road RUN AWAY Shame! Shame! Shame!
Nelson Machado . 2024-04-04
MORE AT Google
Amazing food with great service, their crispy chicken and beef is to die for. They also have delicious side dishes such as tempura prawn and king roll. They do have vegetarian options therefore accommodating both veg and non veg customers. Definitely will visit them again.
bashaar s . 2024-03-27
MORE AT TripAdvisor
delivery was delayed and the food was definitely not worth the wait. small portion and taste was okish.
Prameen . 2024-03-22
MORE AT Just Eat
Good value spicy Chinese food delivered hot and nice driver
Rosy . 2024-03-19
MORE AT Just Eat
basic, well prepared, tasty food, can't complain, well worth it, value for money
Paul . 2024-03-06
MORE AT Just Eat
Wouldn’t order again, prawns very greasy but ice cream was lovely
Tara . 2024-03-03
MORE AT Just Eat
I would recommend this place highly. My son has allergies and they helped me very sincerely and I was so gratefull. I will be coming back with my friends and families.
Dil Ali . 2024-02-25
MORE AT Google
Dined in, food and decor very good recommend
Khalid . 2024-02-23
MORE AT Google
Very polite driver. I wasn’t able to eat the meal as it was a bit spicy but that’s my fault for not checking what fire cracker chicken was. If I hadn’t added that then I would have eaten it all.
Nia . 2024-02-22
MORE AT Just Eat
Great food as always. The order was perfect and hot.
Paul . 2024-02-16
MORE AT Just Eat
Hardly any topping. Mainly noddles and rice
Charlotte . 2024-02-07
MORE AT Just Eat
Again quality and portion size not exactly worth value for what you actually get
Andrew . 2024-01-27
MORE AT Just Eat
Great chicken and portion sizes, egg fried rice clearly wasn’t fried and was plain with barely any egg. Chicken was great though
Tyler . 2024-01-21
MORE AT Just Eat
Friendly staff, talked me through the options and gave me their personal recommendations. Food is fresh, ingredients are fresh. From payment to food coming to the table took about 7 minutes which is perfect if you're in a hurry.
E. S. . 2024-01-19
MORE AT Google
cost versus portion size was poor.
Jaime . 2024-01-13
MORE AT Just Eat
This noodle restaurant is a treasure trove for noodle lovers! The wide array of noodle dishes they offer is truly impressive. Each dish is a culinary masterpiece, showcasing a perfect blend of flavors and textures. From the classic stir-fried noodles to the specialty hand-pulled ones, every bite is a delight. The ambiance adds an extra touch of charm to the dining experience. The cozy yet vibrant atmosphere, coupled with friendly and attentive service, creates an inviting space that feels like a home away from home. Whether you’re a solo diner or sharing a meal with friends, this restaurant’s dedication to exceptional noodles and a welcoming ambiance makes it a go-to spot for a memorable dining affair
Amalesh N Ram . 2024-01-07
MORE AT Google
Not authentic chinese taste. Boiled rice and tasted like frozen food. Use to be great when they opened but not happy at all with todays takeaway
Hussain . 2023-12-29
MORE AT Just Eat
the chilli garlic chicken was meant to be a milder option but it's so spicy I can't taste anything and actually hurts to eat, disappointed 😔
Jessica . 2023-12-28
MORE AT Just Eat
Amazing service from oodles and the driver I’ll be back thank you
Milan . 2023-12-24
MORE AT Just Eat
Completely unfair. 1. I was waiting in and the guy in front left me unattended. 2. He took different customers order who came after me. 3. Was doing rush service. 4. quality was poor, i am.leicester and this store taste doesn't match any other branches like leicester, blackburn 5. Less portion and chicken was dry and egg fried rice was taste less literally only egg and rice no spices or salt. 6. Overall satisfaction was awful and service was awful. If you can check on cameras I visited on 8 December around 2pm
saitejreddy bollapally . 2023-12-14
MORE AT Google
Stone cold, incorrect items, veg noodles (which are just plain unseasoned noodles with frozen supermarket veg thrown on top!) instead of rice, missing bbq chicken, won’t use again. All went in bin.
Serena . 2023-11-26
MORE AT Just Eat
It was really tasty great flavours & fresh 👍
Tara . 2023-11-22
MORE AT Just Eat
The large box was missing Chicken Katsumi.
Shakeel . 2023-11-10
MORE AT Just Eat
My first time and the food was amazing!!!! Nice portion and spicy! The service was prompt as well!
Aatif Khan . 2023-10-29
MORE AT Google
Fried rice no flavour, noodles too soft
travis . 2023-10-23
MORE AT Just Eat
Oodles Oxford deserves a second review. After almost a year I didn't visit it, I must say I was super impressed with their improvement. The egg-fried rice was so delicious, and the chicken tastes so Asian! My kids and I finish the food til the very last bite. Well done Oodles!
Nurshuhada Zainon . 2023-10-22
MORE AT Google
Friendly staff and amazing food. The spicy chips are the best thing.
Owen Clarke . 2023-10-20
MORE AT Google
Not as good as ones in Bristol
Andrew . 2023-10-06
MORE AT Just Eat
Caramel chicken and Manchurian chicken were nicely done. The chips were still crispy👍 However, the udon was too soggy! The rice could be ok on its own, but I couldn't really tell when the udon was mixed together with the rice. Please don't offer rice with udon as an option. Asian don't mix rice with noodles 😭😭😭
ハイジ . 2023-10-04
MORE AT Google
Plain rice instead of egg fried, plain noodles instead of veg noodles. Delivery driver didn't come to door, rang and expected me to go out to him!
Rosa . 2023-09-27
MORE AT Just Eat
Been here since opening really great place
sahad murtaza . 2023-09-09
MORE AT Google
Food was lovely don’t get me wrong but the spicy chips were too spicy. I like heat but considered it was a compact meal, it was just a bit much. Other than that, food was lovely, tasty. Will order again!
Oliver . 2023-09-04
MORE AT Just Eat
The food took way too long to be delivered the delivery time was getting later and later when I originally called the restaurant they said they would come and drop it themselves, 15 minutes later still waiting, once the driver eventually arrives he is rude and refuses to take any responsibility. He wouldn’t give me his name or anything I am truly unhappy with my service and will not be using Just eat again
Cye . 2023-08-22
MORE AT Just Eat
Good noodles. The noodles are quite filling and a great meal, you don’t really need any sides with it. Okay price. Would I get it again? Possibly. My main concern is the transparency of the spiciness. Although I’m not sensitive to spice, my family member is and the crispy prawns do have abit of spice and it wasn’t shown on the menu. If you’re sensitive to spice I’d avoid eating here. But if you enjoy spice, noodles and sauces this is the right place! The service was fast, like fast food level too.
Enyo Onuh . 2023-08-21
MORE AT Google
Always fresh, piping hot and filling!
Mallo . 2023-08-15
MORE AT Google
Only did this to receive the free spring rolls. Even though I bought 2 reg. and 1 large tango ice blasts which came over the £10 min. spend they said I still had to buy a large box?! Kmt dusty guys. I don’t even care about the spring rolls. Just did it to be petty.
Tahmid Hasan . 2023-08-11
MORE AT Google
It's Halal chines restaurant. The food was delicious. I will definitely come back to try some more dishes 😋. Service was good only problem is to find parking on cowley road.
Faisal Ghafoor . 2023-07-30
MORE AT Google
AVOID. Just paid £20 for a box of stodgy rice and soggy chips which weren't kept separate, as well as two types of chicken dishes which I had to look for in the rice, very, very poor. Only pigs have food mixed up in one box, it's called a trough. Utterly no respect for their customers by shoving everything into one box which was 80% rice (see photo, and that's after I'd eaten some rice and the paltry bits of chicken, that's how much rice was left after I'd got tired of the volume of tasteless rubbish. Just read the other one star reviews and it looks like they've been doing the same for ages. To echo another disgruntled customer you'd be better off with a pot noodle. Total ripoff.
Mrs. P. . 2023-07-25
MORE AT Google
Amazing food and service, staff is very friendly and the food is scrumptious. Will definitely visit again soon
bashaar sohail . 2023-07-25
MORE AT Google
Small portion and very spicy although nothing spicy was ordered
Kim . 2023-07-24
MORE AT Just Eat
I ordered a large but the portion size was way smaller than advertised on their website.
Mohammed . 2023-07-16
MORE AT Just Eat
Disappointed with the size and quality
Linda . 2023-07-03
MORE AT Just Eat
The food wasn’t fresh and chicken taste was off
Arifa . 2023-06-20
MORE AT Just Eat
Had a great meal here. Chilli prawns were delicious and the vegetable noodles and crispy chicken were excellent. Stag were friendly and welcoming. My go to Indo-Chinese and Oxford didn’t disappoint!
Simon Robinson . 2023-06-11
MORE AT Google
Horrible customer service that is . Never again!
Ellie . 2023-06-07
MORE AT Just Eat
Expensive sloppy mess. Unpleasant taste. Won’t order again.
Luke . 2023-06-07
MORE AT Just Eat
Not the right place for you if you do not like hot and spicy food. On the menu does not appear that is hot, however, when we tried our box, food was hot, no even mild.
Alex Ferre . 2023-05-27
MORE AT Google
Really good place to try halal Chinese style dishes. We had the large box for £9 you get two bases, chicken with sauce and crispy chicken with variety of sauces to choose from. Owner was friendly and very helpful, place was clean, Restroom was extremely clean, Price was affordable.
Dr. Ray . 2023-05-23
MORE AT Google
Best place for noodles in oxford
Teddy . 2023-05-21
MORE AT Google
Amazing and friendly staff, brilliant food. Love it!
srushti rekha . 2023-05-18
MORE AT Google
Giving one star coz doesn’t have option of negative.. total worthless n tasteless food.. for 8£ they give such small portion n that too just plain white rice ??? I mean at least add something to lil salt at least.. I have never experienced such blunt flavourless egg fried rice in my entire life. I order regular box with noodles rice n chicken. The chicken n noodles were just ok but the rice can’t even say …..
kushal desai . 2023-05-12
MORE AT Google
Received the wrong order, when called the restaurant, was spoken to rudely.
Mehmoona . 2023-05-06
MORE AT Just Eat
Just small portions and quite dry even though you pick a sauce. If there was more sauce would’ve been nice
Mya . 2023-05-01
MORE AT Just Eat
very nice foo, good quality 5 stars
Ghulam . 2023-04-28
MORE AT Just Eat
Good food, think I will get a large instead of a regular next time!
Dario . 2023-04-25
MORE AT Just Eat
Quick and easy. Food tastes OK. Could do with more actual meat or fish in the dishes.
Mohammed Ali . 2023-04-16
MORE AT Google
Oodles is always nice but this branch is so stingy with the chicken, disappointing
Aqsa . 2023-04-06
MORE AT Google
Amazing food and service, staff are extremely friendly and welcoming. Will definitely be returning.
Faiz mohammed . 2023-04-03
MORE AT Google
Food was all spilled on the bag and told them take it back
Shabaz . 2023-03-31
MORE AT Just Eat
Food was great and the food came on time, everything was as ordered and compiled nicely would definitely recommend
Mohammed . 2023-03-21
MORE AT Just Eat
Amazing food, top quality service, very friendly staff, clean. Will definitely be visiting again soon Its a 5 star from a very satisfied customer
Ali Mahmood . 2023-03-16
MORE AT Google
The food used to be generous on the portion but everything has changed now, no more fish dishes to choose, ordered a medium and being charged £1.5 more for prawn dishes(£8.45 in total) is totally fine to charge more for seafood but excuse me? Only 3 small prawns and a few small pieces of chicken £8.45, is this a joke? you can have a full pot of prawn for that price in any Chinese restaurant opposite to oodles
Ngai Chu . 2023-03-04
MORE AT Google
Rice was so soggy and not nice. The noodles weren’t nice aswell. Defo not worth the money they charge.
sharvine . 2023-02-20
MORE AT Just Eat
Been visiting this noodle joint for a few months, the food has always been spot on along with the friendly customer service. Highly Recommended
Kash Munaf . 2023-02-19
MORE AT Google
Driver called but didn’t say anything
Finlay . 2023-02-16
MORE AT Just Eat
Restaurant is always good. Food is always well cooked and hot
Finlay . 2023-02-16
MORE AT Just Eat
I have come here several time customer service is great the food i good quality especially for the price I was recommended by a friend and know I’m eating free springs rolls #oddles on cowley road
Joy Bamgbola . 2023-02-05
MORE AT Google
Bland noodles and rice as they were cooked with no sauces/seasonings and had no vegetables despite being listed as ‘vegetable noodles’. The chicken was good but the sauce of the sweet and sour dyed the rice pink which was off-putting. The spring rolls were very good though.
Lucianna . 2023-02-04
MORE AT Just Eat
hair in food ------------------------ 3 hours after meal: suffering from running stomach now 10 pounds + extra time capital on toilet and reorder another meal = 50 pounds
Ibuki Sei . 2023-01-30
MORE AT Google
The staff are really nice and the food was made fastv
Aminata Sall . 2023-01-27
MORE AT Google
I can’t even explain it but don’t waste your money!
Shona . 2023-01-17
MORE AT Just Eat
Tried it for the first and last time, chilli chips are just re heated chips covered in chilli sauce, orders a large box which had 5-6 small pieces of chicken with few noodles and rice. No real taste just drowned in sauce. Prawn tempura looks like frozen ones which had then been cooked in store. Large Box, Prawn tempura and chips at £17.50 Way over priced, had high hopes as have heard of the brand but won’t be going back.
A Was . 2023-01-17
MORE AT Google
Ordered a large. The rice took up the entire box and the 2 types of chicken didn't even cover the rice combined. Disappointed tbh
Opey . 2023-01-17
MORE AT Just Eat
Most reliable fast food place I’ve been to. Fast service, delicious food - I always make sure to visit if I’m passing by!
Colby Mounter . 2023-01-02
MORE AT Google
I had a very wonderful experience at Oodles.
Thousand Words . 2022-12-28
MORE AT Google
The service and food was out of this world verry clean
Ilyas Memon . 2022-12-24
MORE AT Google
Was great, tastes luscious and divine.
Muhammed Yasin Khan . 2022-12-24
MORE AT Google
Freshly made and can customise as you want.Cost Friendly and good location
Keshvi Gandhi . 2022-12-23
MORE AT Google
These schedules may not be completely accurate on special days. Please always confirm with the restaurant
Similary restaurants in South East
23 Opinions
Firstly, the fastest I've EVER been served food in any restaurant I've ever been to (perhaps 4 minutes maximum for about 10 dishes!! On google we interpreted this eaterie opened at 730pm however it C
noodlesprawnscookedchickenchilliricespicyprawnfried