GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4,40

Based on 966 opinions finded in 4 websites

site_photo4

Nº 247 in 736 in Oxford

Nº 10 of 31 Chinese in Oxford

CUSTOMERS TALK ABOUT DISHES WITH..noodlesprawnscookedchickenchilliricespicyprawnfried

comment_iconOpinions

Very very tasty halal noodle restaurant., freshly cooked and good size portions. So good we went back the next day. Nothing like this where we are from Keep up the good work Jon and Jackie From Gloucester

site_logo

Jon Bee . 2024-08-18

MORE AT Google

Ordered oodles through Uber eats, food arrived in decent time however food was poor. Sweet and sour chicken was very vibrant coloured however was tasteless. Firecracker chicken was soggy and overly hot considering it only had 1 chilli on the menu. Would not use this business again.

site_logo

Ben Smith . 2024-08-15

MORE AT Google

This is good authentic Jamaican food and huge portion which can easily serve 2 people will be ordering again thank you!

site_logo

Leonardo . 2024-08-13

MORE AT Just Eat

One of the best in a Cowley road (y)

site_logo

farhan tanveer . 2024-08-05

MORE AT Google

I recently opted to use a food delivery platform to order a meal. Overall, the food was satisfactory, although the chips arrived somewhat soggy, which was a slight disappointment. Despite this minor issue, the meal was enjoyable enough, and it's hard to go wrong with the offerings from this place. I have experienced dining at other locations from this same chain before, and I've found that the quality of their food is reliably good across different branches.

site_logo

Akber Ali . 2024-07-25

MORE AT Google

Ok for fast food. I would go again.

site_logo

Halima Brewer . 2024-07-18

MORE AT Google

My order was missing parts, the delivery wasn’t exactly the best as the bag wasn’t sealed and the food container was burst open.

site_logo

Dan . 2024-07-14

MORE AT Just Eat

They gave me the wrong order I called and they said they couldn’t do anything as the wrong driver took the food

site_logo

madi . 2024-07-07

MORE AT Just Eat

A great go to restaurant for a lovely cost effective meal Served up within minutes and super tasty with a fair variety of mix and match options. My favourite is vegetable noodles with vegetable rice along with sweet and sour chicken and shezuen beef stir fry...get it in large and it'll go longer. Highly recommended.

site_logo

Munir Shafi . 2024-06-23

MORE AT Google

Always great food! Quick delivery too.

site_logo

Rachel . 2024-06-23

MORE AT Just Eat

Great tasting indo Chinese. Portion size good.

site_logo

Nidhi Kapadia . 2024-06-22

MORE AT Google

Awful taste of the beef stir fry, the staff were not welcoming either. There was hardly any beef in the beef stir fry.

site_logo

Waleed Azam . 2024-06-20

MORE AT Google

taste of the dragon chicken was quite nice but not evenly distributed so really flavour some on the first bit of noodles and then just plain noodles, chips were stale although nice spicy sauce on them. delivery time kept changing

site_logo

Maryam . 2024-06-16

MORE AT Just Eat

Great food! Super tasty. Fast delivery as well.

site_logo

Rachel . 2024-06-07

MORE AT Just Eat

God a delivery from here. Very tasty food spring rolls a bit small but also very delish. Have ordered since :)

site_logo

Emily Jane . 2024-06-05

MORE AT Google

Food was OK, for the amount is overpriced

site_logo

Mirfat . 2024-06-01

MORE AT Just Eat

I don’t understand why they say it will be delivered by 6.15 when it didn’t get delivered till nearly 7 that’s why I was very annoyed

site_logo

Matt . 2024-05-21

MORE AT Just Eat

You'll be massively disappointed by the portions for the price you pay. Won't be eating here ever again and I'd advise you not to. Should of gone to a regular Chinese.

site_logo

DARRYN DAVIES . 2024-05-20

MORE AT Google

Perfect noodles. However, be careful as you can get stomach problems the next day

site_logo

Majidu Rahman . 2024-05-04

MORE AT Google

This was my first order but not last for sure. Food was cooked well and very tasty. Delivered on time.

site_logo

Andzelika . 2024-05-01

MORE AT Just Eat

Actully this is nice restaurant, but the food just nice and plenty

site_logo

Nazrul Akram Mohd Nasir . 2024-04-16

MORE AT Google

Shame order a sweet sour chicken and they send literally 10 bits and I order a large portion. Not bad not good acceptable as I’m at the hospital.better than hospital food.

site_logo

Nelson . 2024-04-04

MORE AT Just Eat

Order a Large sweet and sour chicken, literally arrived only 10 small bits I counted, umbelievable!!!! Tons of noodles to fill the box, still waiting the protein!! I’m at the hospital so diferente than the food I’ve here but very low quality, I can make much better at home. Springs roll are good, need tbh! Won’t buy anything ever again!!!! Don’t waste your money or time Oxford Cowley, Road RUN AWAY Shame! Shame! Shame!

site_logo

Nelson Machado . 2024-04-04

MORE AT Google

Amazing food with great service, their crispy chicken and beef is to die for. They also have delicious side dishes such as tempura prawn and king roll. They do have vegetarian options therefore accommodating both veg and non veg customers. Definitely will visit them again.

site_logo

bashaar s . 2024-03-27

MORE AT TripAdvisor

delivery was delayed and the food was definitely not worth the wait. small portion and taste was okish.

site_logo

Prameen . 2024-03-22

MORE AT Just Eat

Good value spicy Chinese food delivered hot and nice driver

site_logo

Rosy . 2024-03-19

MORE AT Just Eat

basic, well prepared, tasty food, can't complain, well worth it, value for money

site_logo

Paul . 2024-03-06

MORE AT Just Eat

Wouldn’t order again, prawns very greasy but ice cream was lovely

site_logo

Tara . 2024-03-03

MORE AT Just Eat

I would recommend this place highly. My son has allergies and they helped me very sincerely and I was so gratefull. I will be coming back with my friends and families.

site_logo

Dil Ali . 2024-02-25

MORE AT Google

Dined in, food and decor very good recommend

site_logo

Khalid . 2024-02-23

MORE AT Google

Very polite driver. I wasn’t able to eat the meal as it was a bit spicy but that’s my fault for not checking what fire cracker chicken was. If I hadn’t added that then I would have eaten it all.

site_logo

Nia . 2024-02-22

MORE AT Just Eat

Great food as always. The order was perfect and hot.

site_logo

Paul . 2024-02-16

MORE AT Just Eat

Hardly any topping. Mainly noddles and rice

site_logo

Charlotte . 2024-02-07

MORE AT Just Eat

Again quality and portion size not exactly worth value for what you actually get

site_logo

Andrew . 2024-01-27

MORE AT Just Eat

Great chicken and portion sizes, egg fried rice clearly wasn’t fried and was plain with barely any egg. Chicken was great though

site_logo

Tyler . 2024-01-21

MORE AT Just Eat

Friendly staff, talked me through the options and gave me their personal recommendations. Food is fresh, ingredients are fresh. From payment to food coming to the table took about 7 minutes which is perfect if you're in a hurry.

site_logo

E. S. . 2024-01-19

MORE AT Google

cost versus portion size was poor.

site_logo

Jaime . 2024-01-13

MORE AT Just Eat

This noodle restaurant is a treasure trove for noodle lovers! The wide array of noodle dishes they offer is truly impressive. Each dish is a culinary masterpiece, showcasing a perfect blend of flavors and textures. From the classic stir-fried noodles to the specialty hand-pulled ones, every bite is a delight. The ambiance adds an extra touch of charm to the dining experience. The cozy yet vibrant atmosphere, coupled with friendly and attentive service, creates an inviting space that feels like a home away from home. Whether you’re a solo diner or sharing a meal with friends, this restaurant’s dedication to exceptional noodles and a welcoming ambiance makes it a go-to spot for a memorable dining affair

site_logo

Amalesh N Ram . 2024-01-07

MORE AT Google

Not authentic chinese taste. Boiled rice and tasted like frozen food. Use to be great when they opened but not happy at all with todays takeaway

site_logo

Hussain . 2023-12-29

MORE AT Just Eat

the chilli garlic chicken was meant to be a milder option but it's so spicy I can't taste anything and actually hurts to eat, disappointed 😔

site_logo

Jessica . 2023-12-28

MORE AT Just Eat

Amazing service from oodles and the driver I’ll be back thank you

site_logo

Milan . 2023-12-24

MORE AT Just Eat

Completely unfair. 1. I was waiting in and the guy in front left me unattended. 2. He took different customers order who came after me. 3. Was doing rush service. 4. quality was poor, i am.leicester and this store taste doesn't match any other branches like leicester, blackburn 5. Less portion and chicken was dry and egg fried rice was taste less literally only egg and rice no spices or salt. 6. Overall satisfaction was awful and service was awful. If you can check on cameras I visited on 8 December around 2pm

site_logo

saitejreddy bollapally . 2023-12-14

MORE AT Google

Stone cold, incorrect items, veg noodles (which are just plain unseasoned noodles with frozen supermarket veg thrown on top!) instead of rice, missing bbq chicken, won’t use again. All went in bin.

site_logo

Serena . 2023-11-26

MORE AT Just Eat

It was really tasty great flavours & fresh 👍

site_logo

Tara . 2023-11-22

MORE AT Just Eat

The large box was missing Chicken Katsumi.

site_logo

Shakeel . 2023-11-10

MORE AT Just Eat

My first time and the food was amazing!!!! Nice portion and spicy! The service was prompt as well!

site_logo

Aatif Khan . 2023-10-29

MORE AT Google

Fried rice no flavour, noodles too soft

site_logo

travis . 2023-10-23

MORE AT Just Eat

Oodles Oxford deserves a second review. After almost a year I didn't visit it, I must say I was super impressed with their improvement. The egg-fried rice was so delicious, and the chicken tastes so Asian! My kids and I finish the food til the very last bite. Well done Oodles!

site_logo

Nurshuhada Zainon . 2023-10-22

MORE AT Google

Friendly staff and amazing food. The spicy chips are the best thing.

site_logo

Owen Clarke . 2023-10-20

MORE AT Google

Not as good as ones in Bristol

site_logo

Andrew . 2023-10-06

MORE AT Just Eat

Caramel chicken and Manchurian chicken were nicely done. The chips were still crispy👍 However, the udon was too soggy! The rice could be ok on its own, but I couldn't really tell when the udon was mixed together with the rice. Please don't offer rice with udon as an option. Asian don't mix rice with noodles 😭😭😭

site_logo

ハイジ . 2023-10-04

MORE AT Google

Plain rice instead of egg fried, plain noodles instead of veg noodles. Delivery driver didn't come to door, rang and expected me to go out to him!

site_logo

Rosa . 2023-09-27

MORE AT Just Eat

Been here since opening really great place

site_logo

sahad murtaza . 2023-09-09

MORE AT Google

Food was lovely don’t get me wrong but the spicy chips were too spicy. I like heat but considered it was a compact meal, it was just a bit much. Other than that, food was lovely, tasty. Will order again!

site_logo

Oliver . 2023-09-04

MORE AT Just Eat

The food took way too long to be delivered the delivery time was getting later and later when I originally called the restaurant they said they would come and drop it themselves, 15 minutes later still waiting, once the driver eventually arrives he is rude and refuses to take any responsibility. He wouldn’t give me his name or anything I am truly unhappy with my service and will not be using Just eat again

site_logo

Cye . 2023-08-22

MORE AT Just Eat

Good noodles. The noodles are quite filling and a great meal, you don’t really need any sides with it. Okay price. Would I get it again? Possibly. My main concern is the transparency of the spiciness. Although I’m not sensitive to spice, my family member is and the crispy prawns do have abit of spice and it wasn’t shown on the menu. If you’re sensitive to spice I’d avoid eating here. But if you enjoy spice, noodles and sauces this is the right place! The service was fast, like fast food level too.

site_logo

Enyo Onuh . 2023-08-21

MORE AT Google

Always fresh, piping hot and filling!

site_logo

Mallo . 2023-08-15

MORE AT Google

Only did this to receive the free spring rolls. Even though I bought 2 reg. and 1 large tango ice blasts which came over the £10 min. spend they said I still had to buy a large box?! Kmt dusty guys. I don’t even care about the spring rolls. Just did it to be petty.

site_logo

Tahmid Hasan . 2023-08-11

MORE AT Google

It's Halal chines restaurant. The food was delicious. I will definitely come back to try some more dishes 😋. Service was good only problem is to find parking on cowley road.

site_logo

Faisal Ghafoor . 2023-07-30

MORE AT Google

AVOID. Just paid £20 for a box of stodgy rice and soggy chips which weren't kept separate, as well as two types of chicken dishes which I had to look for in the rice, very, very poor. Only pigs have food mixed up in one box, it's called a trough. Utterly no respect for their customers by shoving everything into one box which was 80% rice (see photo, and that's after I'd eaten some rice and the paltry bits of chicken, that's how much rice was left after I'd got tired of the volume of tasteless rubbish. Just read the other one star reviews and it looks like they've been doing the same for ages. To echo another disgruntled customer you'd be better off with a pot noodle. Total ripoff.

site_logo

Mrs. P. . 2023-07-25

MORE AT Google

Amazing food and service, staff is very friendly and the food is scrumptious. Will definitely visit again soon

site_logo

bashaar sohail . 2023-07-25

MORE AT Google

Small portion and very spicy although nothing spicy was ordered

site_logo

Kim . 2023-07-24

MORE AT Just Eat

I ordered a large but the portion size was way smaller than advertised on their website.

site_logo

Mohammed . 2023-07-16

MORE AT Just Eat

Disappointed with the size and quality

site_logo

Linda . 2023-07-03

MORE AT Just Eat

The food wasn’t fresh and chicken taste was off

site_logo

Arifa . 2023-06-20

MORE AT Just Eat

Had a great meal here. Chilli prawns were delicious and the vegetable noodles and crispy chicken were excellent. Stag were friendly and welcoming. My go to Indo-Chinese and Oxford didn’t disappoint!

site_logo

Simon Robinson . 2023-06-11

MORE AT Google

Horrible customer service that is . Never again!

site_logo

Ellie . 2023-06-07

MORE AT Just Eat

Expensive sloppy mess. Unpleasant taste. Won’t order again.

site_logo

Luke . 2023-06-07

MORE AT Just Eat

Not the right place for you if you do not like hot and spicy food. On the menu does not appear that is hot, however, when we tried our box, food was hot, no even mild.

site_logo

Alex Ferre . 2023-05-27

MORE AT Google

Really good place to try halal Chinese style dishes. We had the large box for £9 you get two bases, chicken with sauce and crispy chicken with variety of sauces to choose from. Owner was friendly and very helpful, place was clean, Restroom was extremely clean, Price was affordable.

site_logo

Dr. Ray . 2023-05-23

MORE AT Google

Best place for noodles in oxford

site_logo

Teddy . 2023-05-21

MORE AT Google

Amazing and friendly staff, brilliant food. Love it!

site_logo

srushti rekha . 2023-05-18

MORE AT Google

Giving one star coz doesn’t have option of negative.. total worthless n tasteless food.. for 8£ they give such small portion n that too just plain white rice ??? I mean at least add something to lil salt at least.. I have never experienced such blunt flavourless egg fried rice in my entire life. I order regular box with noodles rice n chicken. The chicken n noodles were just ok but the rice can’t even say …..

site_logo

kushal desai . 2023-05-12

MORE AT Google

Received the wrong order, when called the restaurant, was spoken to rudely.

site_logo

Mehmoona . 2023-05-06

MORE AT Just Eat

Just small portions and quite dry even though you pick a sauce. If there was more sauce would’ve been nice

site_logo

Mya . 2023-05-01

MORE AT Just Eat

very nice foo, good quality 5 stars

site_logo

Ghulam . 2023-04-28

MORE AT Just Eat

Good food, think I will get a large instead of a regular next time!

site_logo

Dario . 2023-04-25

MORE AT Just Eat

Quick and easy. Food tastes OK. Could do with more actual meat or fish in the dishes.

site_logo

Mohammed Ali . 2023-04-16

MORE AT Google

Oodles is always nice but this branch is so stingy with the chicken, disappointing

site_logo

Aqsa . 2023-04-06

MORE AT Google

Amazing food and service, staff are extremely friendly and welcoming. Will definitely be returning.

site_logo

Faiz mohammed . 2023-04-03

MORE AT Google

Food was all spilled on the bag and told them take it back

site_logo

Shabaz . 2023-03-31

MORE AT Just Eat

Food was great and the food came on time, everything was as ordered and compiled nicely would definitely recommend

site_logo

Mohammed . 2023-03-21

MORE AT Just Eat

Amazing food, top quality service, very friendly staff, clean. Will definitely be visiting again soon Its a 5 star from a very satisfied customer

site_logo

Ali Mahmood . 2023-03-16

MORE AT Google

The food used to be generous on the portion but everything has changed now, no more fish dishes to choose, ordered a medium and being charged £1.5 more for prawn dishes(£8.45 in total) is totally fine to charge more for seafood but excuse me? Only 3 small prawns and a few small pieces of chicken £8.45, is this a joke? you can have a full pot of prawn for that price in any Chinese restaurant opposite to oodles

site_logo

Ngai Chu . 2023-03-04

MORE AT Google

Rice was so soggy and not nice. The noodles weren’t nice aswell. Defo not worth the money they charge.

site_logo

sharvine . 2023-02-20

MORE AT Just Eat

Been visiting this noodle joint for a few months, the food has always been spot on along with the friendly customer service. Highly Recommended

site_logo

Kash Munaf . 2023-02-19

MORE AT Google

Driver called but didn’t say anything

site_logo

Finlay . 2023-02-16

MORE AT Just Eat

Restaurant is always good. Food is always well cooked and hot

site_logo

Finlay . 2023-02-16

MORE AT Just Eat

I have come here several time customer service is great the food i good quality especially for the price I was recommended by a friend and know I’m eating free springs rolls #oddles on cowley road

site_logo

Joy Bamgbola . 2023-02-05

MORE AT Google

Bland noodles and rice as they were cooked with no sauces/seasonings and had no vegetables despite being listed as ‘vegetable noodles’. The chicken was good but the sauce of the sweet and sour dyed the rice pink which was off-putting. The spring rolls were very good though.

site_logo

Lucianna . 2023-02-04

MORE AT Just Eat

hair in food ------------------------ 3 hours after meal: suffering from running stomach now 10 pounds + extra time capital on toilet and reorder another meal = 50 pounds

site_logo

Ibuki Sei . 2023-01-30

MORE AT Google

The staff are really nice and the food was made fastv

site_logo

Aminata Sall . 2023-01-27

MORE AT Google

I can’t even explain it but don’t waste your money!

site_logo

Shona . 2023-01-17

MORE AT Just Eat

Tried it for the first and last time, chilli chips are just re heated chips covered in chilli sauce, orders a large box which had 5-6 small pieces of chicken with few noodles and rice. No real taste just drowned in sauce. Prawn tempura looks like frozen ones which had then been cooked in store. Large Box, Prawn tempura and chips at £17.50 Way over priced, had high hopes as have heard of the brand but won’t be going back.

site_logo

A Was . 2023-01-17

MORE AT Google

Ordered a large. The rice took up the entire box and the 2 types of chicken didn't even cover the rice combined. Disappointed tbh

site_logo

Opey . 2023-01-17

MORE AT Just Eat

Most reliable fast food place I’ve been to. Fast service, delicious food - I always make sure to visit if I’m passing by!

site_logo

Colby Mounter . 2023-01-02

MORE AT Google

I had a very wonderful experience at Oodles.

site_logo

Thousand Words . 2022-12-28

MORE AT Google

The service and food was out of this world verry clean

site_logo

Ilyas Memon . 2022-12-24

MORE AT Google

Was great, tastes luscious and divine.

site_logo

Muhammed Yasin Khan . 2022-12-24

MORE AT Google

Freshly made and can customise as you want.Cost Friendly and good location

site_logo

Keshvi Gandhi . 2022-12-23

MORE AT Google

Similary restaurants in South East

restaurant_img
4,5

23 Opinions

location-icon38-39 The Covered Markets, Oxford OX1 3DX England
Chinese

Firstly, the fastest I've EVER been served food in any restaurant I've ever been to (perhaps 4 minutes maximum for about 10 dishes!! On google we interpreted this eaterie opened at 730pm however it C

noodlesprawnscookedchickenchilliricespicyprawnfried