GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
3.7

Based on 1.174 opinions finded in 3 websites

site_photo4

Nº 503 in 670 in North Tyneside

Nº 19 of 30 Chinese in North Tyneside

CUSTOMERS TALK ABOUT DISHES WITH..chillimeatnoodlesbeanchickenfriedprawnsspicypepperprawnbeautifulribscurryriceduckcooked

comment_iconOpinions

Curry sauce was runny, Szechuan mixed meats was spicy but vegetable wise full of onion and leek, no peppers.

site_logo

Susan . 2024-12-20

MORE AT Just Eat

Chop Suey Rolls are EXCELLENT - freshly cooked and crunchy, not in loads of grease in bag like some. All other food delicious and fresh. Only tiny issue is the pre-prepared Prawn crackers, excellent portion but soft and chewy not crunchy today and very translucent, but overall the food was spot on and delivery quick. Thank You .

site_logo

Rick . 2024-12-17

MORE AT Just Eat

the lemon chicken had very thick soggy batter and the lemon sauce had little to no flavour. the salt and pepper chicken and chips was alright

site_logo

Richard . 2024-11-30

MORE AT Just Eat

worst experience here ever ,always say they are best but tonight was horrible wrong chow mein far tooooo spicy chips cold ,went in bin as tasted horrible ,didnt call as after long shift just wanted to sleep sorry

site_logo

Claire . 2024-11-23

MORE AT Just Eat

Food was cold, food spilling out the boxes, chips tasted like they were cooked two days ago. Not good

site_logo

Lauren . 2024-11-22

MORE AT Just Eat

Ordered a box meal . Very dry chicken that was difficult to chew and swallow , and the ribs were similar. 1st and last time I’ll order

site_logo

warren . 2024-11-22

MORE AT Just Eat

The food was excellent, shame about late delivery.

site_logo

stan . 2024-10-16

MORE AT Just Eat

excellent service and good quality food.

site_logo

stan . 2024-10-15

MORE AT Just Eat

Love the Chop Suey Rolls, and the beef is soft and edible not like other where its like old boots and grisle. wonderful quality food, keep it up. Thank You.

site_logo

Rick . 2024-10-02

MORE AT Just Eat

excellent as always..... main course meals very generous in portion size and content. (small error in forgetting to put the chicken in my chicken and mushroom omelette... Still delicious though). definitely my go to takeaway.

site_logo

Jon . 2024-09-29

MORE AT Just Eat

fresh food as always ,hot as always ,everything so tasty as always cant fault this place best ever in area, good quility and portions are amazing

site_logo

Claire . 2024-09-14

MORE AT Just Eat

love this place, always piping hot quality food.

site_logo

Mark . 2024-09-14

MORE AT Just Eat

Will not order again. Chicken was terrible quality and ribs were so tough and chewy. So disappointing. Had a bad order here before but thought I’d give it another go as it’s been a while but seems the quality of food has completely gone down hill.

site_logo

Jennifer . 2024-09-03

MORE AT Just Eat

always hot and very fresh on arrival cannot fault this place, since 1st order in may have not ever been unhappy ,delivery drivers are also always very polite and curtious

site_logo

Claire . 2024-08-31

MORE AT Just Eat

Disgusting, most of it ended up in the bin. Noodles undercooked, virtually raw. Crispy King prawns in salt and chilli pepper were covered in a soggy barely cooked 'batter'. The chicken in chicken satay was just squares and spongy texture, didn't taste like chicken. To add insult to injury when we got it home we worked out they had overcharged us by £2. Have seen this mentioned in other reviews, feeling generous this could just have been a mistake, but if not and done on a regular basis bit of an earner! Avoid this place at all costs.

site_logo

Angela Thomas . 2024-08-23

MORE AT Google

Fue positivamente horrible, pedimos 2 platos de pollo crujiente, ambos eran viscosos y no comestibles. Tristemente fue un desperdicio total de dinero. Definitivamente no volveríamos.

site_logo

Laurence T . 2024-08-21

MORE AT TripAdvisor

Singapore fried rice was spot on.

site_logo

Mark . 2024-08-13

MORE AT Just Eat

lovely fresh food and always really hot and very tasty,highly recomend

site_logo

Claire . 2024-08-03

MORE AT Just Eat

My favourite go to takeaway in the north east

site_logo

Chi Wai Wong . 2024-07-24

MORE AT Google

lovely fresh food always and always very hot on arrival

site_logo

Claire . 2024-07-14

MORE AT Just Eat

Food was inedible. Sweet and sour sauce tasted like vinegar and the meat in the fried rice was rubbery and tasteless. Went in the bin!

site_logo

Jill . 2024-07-11

MORE AT Just Eat

Everything was just far to salty

site_logo

lauren . 2024-06-28

MORE AT Just Eat

Delicious. At last a takeaway that does not skimp on King Prawns in their main dishes, also a Curry Sauce that tastes like it should, a little kick and not just a gravy. Had House Special Curry ... excellent value. Cantonese ribs starter had loads of soft, fall off the bone meat, and King Prawn Chow Mein was superb. Will be making this my regular from now on..... 10/10.

site_logo

Jon . 2024-05-12

MORE AT Just Eat

Salt and Chilli ribs were spot on

site_logo

Mark . 2024-05-05

MORE AT Just Eat

1st time trying here,lovely taste , very hot food and fresh ,will be 100% back

site_logo

Claire . 2024-05-03

MORE AT Just Eat

Salt and pepper chicken was awesome but the curry had a burnt taste to it.

site_logo

Claire . 2024-03-25

MORE AT Just Eat

Quality of food always fantastic. Quick delivery and piping hot.

site_logo

Mark . 2024-03-17

MORE AT Just Eat

Salt and Chilli Mega Box is fantastic. Food piping hot on delivery. Definitely recommend.

site_logo

Mark . 2024-03-06

MORE AT Just Eat

Not sure why this place has so many decent reviews. The worst Chinese I’ve had in years . Chow mein has hardly any chow mein and just lumps of flavourless meat.

site_logo

adam . 2024-02-24

MORE AT Just Eat

Went after a day out with mates, great spring rolls and chips, love the curry sauce too. Overall good food and will be coming again

site_logo

Ungrell A . 2024-01-23

MORE AT TripAdvisor

Missing an item, which spoiled the meal somewhat, but rest of food was lovely

site_logo

amanda . 2024-01-19

MORE AT Just Eat

Lovely meal . Quality excellent and delivery bang on time.

site_logo

Robert . 2024-01-18

MORE AT Just Eat

Best tasting Singapore chow mein I've had in a long time

site_logo

Mark . 2024-01-06

MORE AT Just Eat

fantastic food. Salt and chilli chicken is really tasty

site_logo

Mark . 2024-01-06

MORE AT Just Eat

Lovely food, fast delivery. Recommended.

site_logo

Judith . 2023-12-29

MORE AT Just Eat

1st time ordering Can’t fault anything & will be ordering from here again 👍

site_logo

Derek . 2023-12-27

MORE AT Just Eat

Great delivery but food was tasteless, flavours bland

site_logo

linda . 2023-12-20

MORE AT Just Eat

First time but won't be our last.

site_logo

James . 2023-12-07

MORE AT Just Eat

Small portions, curry nice but chips & prawn crackers not great

site_logo

Nicola . 2023-12-02

MORE AT Just Eat

Rang order in easy process.Great food. Nice and friendly staff. All round good experience

site_logo

John Bell . 2023-11-26

MORE AT Google

I visit Tang Wah every week for curried chicken and chips they just get better, and I think I'll get it for Xmas dinner, i do add prawns and bits to it to make it extra luscious.

site_logo

alexander j . 2023-11-18

MORE AT TripAdvisor

Absolutely delicious food and really hot. Would definitely order again.

site_logo

Chica . 2023-11-18

MORE AT Just Eat

Food was delicious and very hot. Would recommend. Thank you

site_logo

Pamela . 2023-10-22

MORE AT Just Eat

Chilli mega box is fantastic. Love the taste of the salt and chilli chicken. Food is always top quality and hot when delivered.

site_logo

Mark . 2023-10-07

MORE AT Just Eat

food is discussing chicken is mushy and my tooth nearly came out because there was something what felt like a stone in my chicken don’t go here it’s vile

site_logo

Dan Hartnupp . 2023-09-02

MORE AT Google

Good food delivered on time piping hot. Will definitely use again.

site_logo

Don . 2023-07-31

MORE AT Just Eat

Thank you for the food. I used this because I needed to go to the bank.

site_logo

Philip . 2023-07-27

MORE AT Just Eat

Food was awful, crispy beef was soggy, sauce had no taste and they forgot the chips. When I rang she said she could not get chips to us. Won't be ordering from here again.

site_logo

Lisa S . 2023-07-06

MORE AT TripAdvisor

Food was delivered on time by a friendly driver but both the curry sauce and the sweet and sour sauce tasted as if they were off. The battered chicken balls tasted like mush. Will not order from here again

site_logo

Julie . 2023-06-30

MORE AT Just Eat

Was really nice house curry unreal brilliant

site_logo

Darren . 2023-06-18

MORE AT Just Eat

Beef quality was disgusting, very fatty so will not be returning based on that experience. Spent just short of £20 to end up eating rice & a few vegetables. Very disappointed. Would've returned it but too tired after a hard week!

site_logo

Marie Royce . 2023-05-26

MORE AT Google

THE best house special curry. Unbeatable. Well done.

site_logo

Jon . 2023-05-14

MORE AT Just Eat

1st time used Just Eat, and impressed

site_logo

john . 2023-04-29

MORE AT Just Eat

Worst takeaway ever meat is vile pork is chewy chicken was mushy only nice part of the meal was the chips yet to see a king prawn just awful sweet and sour was full of tomatoes and meat was inedible. Beef was tough all I can imagine is what chewing an a leather slipper would taste like safe to say worst £45 pound ever spent.

site_logo

Annelise . 2023-04-26

MORE AT Just Eat

Best Chinese I’ve had in long time.

site_logo

ciara . 2023-04-01

MORE AT Just Eat

Hi, this is the first time I’ve tried from New Tun Wah and our food was absolutely terrible. The bed wasn’t cooked properly and the chicken fried rice was lush mush, the chips were freezing. I would like a refund of possible. Thanks

site_logo

Matty . 2023-03-19

MORE AT Just Eat

Best tasting curry, hot and spicy

site_logo

Andrew Richardson . 2023-03-01

MORE AT Google

Beautiful food Lovely and hot as always

site_logo

samantha . 2023-02-25

MORE AT Just Eat

Fantastic food yet again. The best Singapore chow mein I've had. Great service and the delivery driver was spot on aswell. Definitely recommend.

site_logo

Mark . 2023-02-18

MORE AT Just Eat

Tasty food, good potion sizes, speedy preparation time and great value for money. Very satisfied, will be coming back.

site_logo

Rosie . 2023-02-14

MORE AT Just Eat

Food was so lovely jubley, so tasty

site_logo

Sarah . 2023-02-11

MORE AT Just Eat

Think you need thicker bags & wrap, all stuck to my containers.

site_logo

Amanda . 2022-12-28

MORE AT Just Eat

Spot on 👍🏼 Lovely women at the counter :)

site_logo

Jack . 2022-12-24

MORE AT Just Eat

Been using it for years. Great food, nice people but it's getting expensive. But on the other hand, what isn't.

site_logo

malcolm sutherland . 2022-12-23

MORE AT Google

why the frock was my chow mein cooked in water and hoyed in a carton with mank chicken

site_logo

Mccodie Handyside . 2022-12-15

MORE AT Google

Lovely food, service & early delivery! 😀

site_logo

Amanda . 2022-12-09

MORE AT Just Eat

Delicious! Definitely go back soon!

site_logo

Lisa . 2022-11-11

MORE AT Just Eat

First time ordering.. really disappointing.. all went in bin as cold, chips were so greasy the bag and paper were ripped.. waste of £20

site_logo

Chelsi . 2022-10-30

MORE AT Just Eat

Food lovely and hot as always. Would definitely order again

site_logo

Catherine . 2022-10-22

MORE AT Just Eat

Came early which I was hoping for! Was piping hot and delicious as usual I said on my first order and will say again, definitely my new favorite place!

site_logo

Heather . 2022-10-16

MORE AT Just Eat

Quality meat curry and curry sauce is first class.

site_logo

Barry . 2022-10-16

MORE AT Just Eat

Delicious! My new favorite place Came right on time, hot and very very tasty! Delivery man was polite and said he was happy to nip up the stairs in my block to deliver straight to my door & save me coming down. Nice big portions of food that’s incredibly tasty. I’ll be back for sure!

site_logo

Heather . 2022-10-11

MORE AT Just Eat

The food was just a carton of mess that looked liked the scrappings of a plate. The meats were disgusting and the sauces were bland with a dreadful aftertaste. I have no idea how a food business can create food this bad. All out food went in the bin after a few attempts. Absolutely hideous.

site_logo

Stephen Martin . 2022-09-20

MORE AT Google

Chow mien was flavourless but curry was great, huge portions

site_logo

Suzy . 2022-08-17

MORE AT Just Eat

There wasn’t anything really bad about it… there just wasn’t anything particularly good about it. Garlic was burnt like me sunbathing without factor 50 on. The salt and chilli chips didn’t taste like salt and chilli chips… they just tasted like chips with a bit of salt on. The ribs were as tough as as old boots, and the salt and chilli chicken tasted the same as the chips. I’m sure they do tasty food, I just didn’t get any this time. Please sir, can aye av sum more?

site_logo

Michael . 2022-08-17

MORE AT Just Eat

Perfect food and service thank you

site_logo

Richard . 2022-07-30

MORE AT Just Eat

The food was absolutely delicious. Freshly prepared and generous portion sizes.

site_logo

Angela . 2022-07-30

MORE AT Just Eat

Great tasting food and lots of it, great value struggled to get through it may have put to much on my plate but still ate it will be back there tonight to do it all again

site_logo

Ian . 2022-07-27

MORE AT Just Eat

Food was absolutely delicious.

site_logo

Angela . 2022-07-15

MORE AT Just Eat

Very good portions, good quality food and quick delivery.

site_logo

Beth . 2022-07-05

MORE AT Just Eat

I’m sorry but we won’t be ordering again. The food was very bland and just not the same quality as we have had with other takeaways. The food was just old, reheated and lifeless. On the plus side our order arrived in good time and with no issues.

site_logo

Claire . 2022-06-22

MORE AT Just Eat

Absolutely rotten, chips were burnt and flavourless. My chicken looked still alive and my noodles were dripping in oil. DONT GO HERE WAY TO EXPENSIVE FOR THE QUALITY

site_logo

Lily Amelia Lee . 2022-06-10

MORE AT Google

Wondefful food waa delicious faat delivery too and driver was very polite and happy.

site_logo

Rick . 2022-05-28

MORE AT Just Eat

Food was early. Red hot and tasted lovely. Me and hubby enjoyed a great deal. Will be back for more. Only downside with this Chinese is the curry sauce is too hot. Can't fault it otherwise.

site_logo

Ashley . 2022-05-18

MORE AT Just Eat

The food is amazing and the delivery was soo fast I 100% recommend this food

site_logo

Zion . 2022-05-17

MORE AT Just Eat

Every single dish tasted like charcoal. The seaweed was over cooked it was pretty bad. Had everydish not had this weird burnt charcoal taste it would have been nice!

site_logo

Stacey . 2022-05-11

MORE AT Just Eat

Food far spicer than usual actually off putting, looks tasty a burnt taste to something we couldn’t put our finger in what! So sad usually love it from here

site_logo

Chelsea . 2022-04-30

MORE AT Just Eat

Unfortunately, not a great order. The salt and chilli chips were spicy to the point of being inedible and were hard/not cooked through. Curry sauce was good and the delivery time was good with a friendly driver. Shame.

site_logo

Laura . 2022-04-16

MORE AT Just Eat

Absolutely delicious Chips were nice and crispy Thank you

site_logo

David . 2022-04-15

MORE AT Just Eat

Horrible , prawn crackers were what you buy at supermarket. Won’t be ordering again !!!

site_logo

Joanne . 2022-04-10

MORE AT Just Eat

Lovely food and came hot. Thank you really enjoyed it 😊

site_logo

Joanne . 2022-03-31

MORE AT Just Eat

I think they must have had an accident in the kitchen tonight. Half the dishes (hot n spicy chips, chilli pork, chow mein) were all covered in a black residue and tasted burned. An acrid bitter taste.

site_logo

David . 2022-03-26

MORE AT Just Eat

Originally I got the time of 20:15. So I organised myself around this timing. The before eight, I received a text telling my order was ready. By time I got there and back the food had cooled and was not as hot as I would have liked. Not sure what a service charge is and why I was charged it ? Then 10p for a bag, what is that all about ? Previously it was not like this. Next time I will ring direct.

site_logo

Bob . 2022-03-13

MORE AT Just Eat

Great food, really really nice. It was late but they did inform me and it was peak time on a Saturday, will definitely order again

site_logo

scott . 2022-02-27

MORE AT Just Eat

Great taste. Good sized portions

site_logo

Andrew . 2022-02-25

MORE AT Just Eat

We've never had a disappointing meal from this Chinese,

site_logo

MRS Glynis Jobe . 2022-02-24

MORE AT Google

Lovely food and great delivery time

site_logo

John . 2022-02-15

MORE AT Just Eat

The food was lovely However the soup I think it’s off it doesn’t taste good I’ve kept it to contact you It doesn’t smell right I think it’s off The taste was disgusting I am not happy

site_logo

samantha . 2022-02-08

MORE AT Just Eat

Probably the best Char Sui I’ve ever had, absolutely bangin. Would beg for the recipe if I thought it would do me any good! Everything was really good too

site_logo

Gareth . 2022-01-26

MORE AT Just Eat

Beautiful food Lovely and hot Thank you for fast delivery Five star takeaway

site_logo

samantha . 2022-01-17

MORE AT Just Eat

Similary restaurants in North East

restaurant_img
3.8

189 Opinions

location-icon3-5 Cleveland Gardens
Chinese
outdoor_seating_134976takeaway_134976delivery_134976

Always amazing food, don’t even live in the area but always a highlight of going to visit family!

restaurant_img
3.9

86 Opinions

location-icon237 Bridge Road South
Chinese
outdoor_seating_233164takeaway_233164delivery_233164

New owners took over absolutely disgusting rang up to complain because I never rang last night they can't do nothing about it paid £30 and everything no taste gravy thick and wet over noodles special fried rice which they said was like photo in menu nothing at all like it it was brown not white prawn toast was quarter bits of bread .egg fo Yung was a brownie colour .so it just says new owners .well I don't think that will work well if they don't do something about there food I give them no stars

restaurant_img
3.5

340 Opinions

location-icon84 Station Road
Chinese
outdoor_seating_86646takeaway_86646delivery_86646

order was delivered 15-2o minutes after I pressed order on my keypad, super efficient supply and distribution

restaurant_img
4.0

176 Opinions

location-icon36 Spence Terrace
Chinese
outdoor_seating_225681takeaway_225681delivery_225681

Sweet and sour chicken balls were practically burnt. Chicken in fried rice was like rubber. Accidentally ordered a wrong option so I called thinking it was a wrong item, I understood as soon as she explained but she just kept repeating herself whilst talking to someone in the background, she was so RUDE!!! Completely overpriced too. What a shame with this being one of our usual favourites. Definitely won't be returning. Ruined our new years eve meal.

restaurant_img
4.0

122 Opinions

location-icon34-36 St. Georges Crescent
Chinese
outdoor_seating_111491takeaway_111491delivery_111491

buiseness was good loved the scran if you like food and sustinance and nourishment then you are in the right postcode have never eaten such good noodle and woul love to come again. in short yummy