Based on 1.173 opinions finded in 3 websites
Based on 1.173 opinions finded in 3 websites
Opinions
Disgusting, most of it ended up in the bin. Noodles undercooked, virtually raw. Crispy King prawns in salt and chilli pepper were covered in a soggy barely cooked 'batter'. The chicken in chicken satay was just squares and spongy texture, didn't taste like chicken. To add insult to injury when we got it home we worked out they had overcharged us by £2. Have seen this mentioned in other reviews, feeling generous this could just have been a mistake, but if not and done on a regular basis bit of an earner! Avoid this place at all costs.
Angela Thomas . 2024-08-23
MORE AT Google
Was positively awful, we ordered 2 crispy chicken dishes, both were slimy and inedible. Sadly it was a total waste of money. We definitely wouldn’t go back.
Laurence T . 2024-08-21
MORE AT TripAdvisor
My favourite go to takeaway in the north east
Chi Wai Wong . 2024-07-24
MORE AT Google
Salt and pepper chicken was awesome but the curry had a burnt taste to it.
Claire . 2024-03-25
MORE AT Just Eat
Quality of food always fantastic. Quick delivery and piping hot.
Mark . 2024-03-17
MORE AT Just Eat
Salt and Chilli Mega Box is fantastic. Food piping hot on delivery. Definitely recommend.
Mark . 2024-03-06
MORE AT Just Eat
Not sure why this place has so many decent reviews. The worst Chinese I’ve had in years . Chow mein has hardly any chow mein and just lumps of flavourless meat.
adam . 2024-02-24
MORE AT Just Eat
Went after a day out with mates, great spring rolls and chips, love the curry sauce too. Overall good food and will be coming again
Ungrell A . 2024-01-23
MORE AT TripAdvisor
Missing an item, which spoiled the meal somewhat, but rest of food was lovely
amanda . 2024-01-19
MORE AT Just Eat
Lovely meal . Quality excellent and delivery bang on time.
Robert . 2024-01-18
MORE AT Just Eat
Best tasting Singapore chow mein I've had in a long time
Mark . 2024-01-06
MORE AT Just Eat
fantastic food. Salt and chilli chicken is really tasty
Mark . 2024-01-06
MORE AT Just Eat
Lovely food, fast delivery. Recommended.
Judith . 2023-12-29
MORE AT Just Eat
1st time ordering Can’t fault anything & will be ordering from here again 👍
Derek . 2023-12-27
MORE AT Just Eat
Great delivery but food was tasteless, flavours bland
linda . 2023-12-20
MORE AT Just Eat
First time but won't be our last.
James . 2023-12-07
MORE AT Just Eat
Small portions, curry nice but chips & prawn crackers not great
Nicola . 2023-12-02
MORE AT Just Eat
Rang order in easy process.Great food. Nice and friendly staff. All round good experience
John Bell . 2023-11-26
MORE AT Google
I visit Tang Wah every week for curried chicken and chips they just get better, and I think I'll get it for Xmas dinner, i do add prawns and bits to it to make it extra luscious.
alexander j . 2023-11-18
MORE AT TripAdvisor
Absolutely delicious food and really hot. Would definitely order again.
Chica . 2023-11-18
MORE AT Just Eat
Food was delicious and very hot. Would recommend. Thank you
Pamela . 2023-10-22
MORE AT Just Eat
Chilli mega box is fantastic. Love the taste of the salt and chilli chicken. Food is always top quality and hot when delivered.
Mark . 2023-10-07
MORE AT Just Eat
food is discussing chicken is mushy and my tooth nearly came out because there was something what felt like a stone in my chicken don’t go here it’s vile
Dan Hartnupp . 2023-09-02
MORE AT Google
Good food delivered on time piping hot. Will definitely use again.
Don . 2023-07-31
MORE AT Just Eat
Thank you for the food. I used this because I needed to go to the bank.
Philip . 2023-07-27
MORE AT Just Eat
Food was awful, crispy beef was soggy, sauce had no taste and they forgot the chips. When I rang she said she could not get chips to us. Won't be ordering from here again.
Lisa S . 2023-07-06
MORE AT TripAdvisor
Food was delivered on time by a friendly driver but both the curry sauce and the sweet and sour sauce tasted as if they were off. The battered chicken balls tasted like mush. Will not order from here again
Julie . 2023-06-30
MORE AT Just Eat
Was really nice house curry unreal brilliant
Darren . 2023-06-18
MORE AT Just Eat
Beef quality was disgusting, very fatty so will not be returning based on that experience. Spent just short of £20 to end up eating rice & a few vegetables. Very disappointed. Would've returned it but too tired after a hard week!
Marie Royce . 2023-05-26
MORE AT Google
THE best house special curry. Unbeatable. Well done.
Jon . 2023-05-14
MORE AT Just Eat
1st time used Just Eat, and impressed
john . 2023-04-29
MORE AT Just Eat
Worst takeaway ever meat is vile pork is chewy chicken was mushy only nice part of the meal was the chips yet to see a king prawn just awful sweet and sour was full of tomatoes and meat was inedible. Beef was tough all I can imagine is what chewing an a leather slipper would taste like safe to say worst £45 pound ever spent.
Annelise . 2023-04-26
MORE AT Just Eat
Best Chinese I’ve had in long time.
ciara . 2023-04-01
MORE AT Just Eat
Hi, this is the first time I’ve tried from New Tun Wah and our food was absolutely terrible. The bed wasn’t cooked properly and the chicken fried rice was lush mush, the chips were freezing. I would like a refund of possible. Thanks
Matty . 2023-03-19
MORE AT Just Eat
Best tasting curry, hot and spicy
Andrew Richardson . 2023-03-01
MORE AT Google
Beautiful food Lovely and hot as always
samantha . 2023-02-25
MORE AT Just Eat
Fantastic food yet again. The best Singapore chow mein I've had. Great service and the delivery driver was spot on aswell. Definitely recommend.
Mark . 2023-02-18
MORE AT Just Eat
Tasty food, good potion sizes, speedy preparation time and great value for money. Very satisfied, will be coming back.
Rosie . 2023-02-14
MORE AT Just Eat
Food was so lovely jubley, so tasty
Sarah . 2023-02-11
MORE AT Just Eat
Think you need thicker bags & wrap, all stuck to my containers.
Amanda . 2022-12-28
MORE AT Just Eat
Spot on 👍🏼 Lovely women at the counter :)
Jack . 2022-12-24
MORE AT Just Eat
Been using it for years. Great food, nice people but it's getting expensive. But on the other hand, what isn't.
malcolm sutherland . 2022-12-23
MORE AT Google
why the frock was my chow mein cooked in water and hoyed in a carton with mank chicken
Mccodie Handyside . 2022-12-15
MORE AT Google
Lovely food, service & early delivery! 😀
Amanda . 2022-12-09
MORE AT Just Eat
Delicious! Definitely go back soon!
Lisa . 2022-11-11
MORE AT Just Eat
First time ordering.. really disappointing.. all went in bin as cold, chips were so greasy the bag and paper were ripped.. waste of £20
Chelsi . 2022-10-30
MORE AT Just Eat
Food lovely and hot as always. Would definitely order again
Catherine . 2022-10-22
MORE AT Just Eat
Came early which I was hoping for! Was piping hot and delicious as usual I said on my first order and will say again, definitely my new favorite place!
Heather . 2022-10-16
MORE AT Just Eat
Quality meat curry and curry sauce is first class.
Barry . 2022-10-16
MORE AT Just Eat
Delicious! My new favorite place Came right on time, hot and very very tasty! Delivery man was polite and said he was happy to nip up the stairs in my block to deliver straight to my door & save me coming down. Nice big portions of food that’s incredibly tasty. I’ll be back for sure!
Heather . 2022-10-11
MORE AT Just Eat
The food was just a carton of mess that looked liked the scrappings of a plate. The meats were disgusting and the sauces were bland with a dreadful aftertaste. I have no idea how a food business can create food this bad. All out food went in the bin after a few attempts. Absolutely hideous.
Stephen Martin . 2022-09-20
MORE AT Google
Chow mien was flavourless but curry was great, huge portions
Suzy . 2022-08-17
MORE AT Just Eat
There wasn’t anything really bad about it… there just wasn’t anything particularly good about it. Garlic was burnt like me sunbathing without factor 50 on. The salt and chilli chips didn’t taste like salt and chilli chips… they just tasted like chips with a bit of salt on. The ribs were as tough as as old boots, and the salt and chilli chicken tasted the same as the chips. I’m sure they do tasty food, I just didn’t get any this time. Please sir, can aye av sum more?
Michael . 2022-08-17
MORE AT Just Eat
Perfect food and service thank you
Richard . 2022-07-30
MORE AT Just Eat
The food was absolutely delicious. Freshly prepared and generous portion sizes.
Angela . 2022-07-30
MORE AT Just Eat
Great tasting food and lots of it, great value struggled to get through it may have put to much on my plate but still ate it will be back there tonight to do it all again
Ian . 2022-07-27
MORE AT Just Eat
Food was absolutely delicious.
Angela . 2022-07-15
MORE AT Just Eat
Very good portions, good quality food and quick delivery.
Beth . 2022-07-05
MORE AT Just Eat
I’m sorry but we won’t be ordering again. The food was very bland and just not the same quality as we have had with other takeaways. The food was just old, reheated and lifeless. On the plus side our order arrived in good time and with no issues.
Claire . 2022-06-22
MORE AT Just Eat
Absolutely rotten, chips were burnt and flavourless. My chicken looked still alive and my noodles were dripping in oil. DONT GO HERE WAY TO EXPENSIVE FOR THE QUALITY
Lily Amelia Lee . 2022-06-10
MORE AT Google
Wondefful food waa delicious faat delivery too and driver was very polite and happy.
Rick . 2022-05-28
MORE AT Just Eat
Food was early. Red hot and tasted lovely. Me and hubby enjoyed a great deal. Will be back for more. Only downside with this Chinese is the curry sauce is too hot. Can't fault it otherwise.
Ashley . 2022-05-18
MORE AT Just Eat
The food is amazing and the delivery was soo fast I 100% recommend this food
Zion . 2022-05-17
MORE AT Just Eat
Every single dish tasted like charcoal. The seaweed was over cooked it was pretty bad. Had everydish not had this weird burnt charcoal taste it would have been nice!
Stacey . 2022-05-11
MORE AT Just Eat
Food far spicer than usual actually off putting, looks tasty a burnt taste to something we couldn’t put our finger in what! So sad usually love it from here
Chelsea . 2022-04-30
MORE AT Just Eat
Unfortunately, not a great order. The salt and chilli chips were spicy to the point of being inedible and were hard/not cooked through. Curry sauce was good and the delivery time was good with a friendly driver. Shame.
Laura . 2022-04-16
MORE AT Just Eat
Absolutely delicious Chips were nice and crispy Thank you
David . 2022-04-15
MORE AT Just Eat
Horrible , prawn crackers were what you buy at supermarket. Won’t be ordering again !!!
Joanne . 2022-04-10
MORE AT Just Eat
Lovely food and came hot. Thank you really enjoyed it 😊
Joanne . 2022-03-31
MORE AT Just Eat
I think they must have had an accident in the kitchen tonight. Half the dishes (hot n spicy chips, chilli pork, chow mein) were all covered in a black residue and tasted burned. An acrid bitter taste.
David . 2022-03-26
MORE AT Just Eat
Originally I got the time of 20:15. So I organised myself around this timing. The before eight, I received a text telling my order was ready. By time I got there and back the food had cooled and was not as hot as I would have liked. Not sure what a service charge is and why I was charged it ? Then 10p for a bag, what is that all about ? Previously it was not like this. Next time I will ring direct.
Bob . 2022-03-13
MORE AT Just Eat
Great food, really really nice. It was late but they did inform me and it was peak time on a Saturday, will definitely order again
scott . 2022-02-27
MORE AT Just Eat
Great taste. Good sized portions
Andrew . 2022-02-25
MORE AT Just Eat
We've never had a disappointing meal from this Chinese,
MRS Glynis Jobe . 2022-02-24
MORE AT Google
Lovely food and great delivery time
John . 2022-02-15
MORE AT Just Eat
The food was lovely However the soup I think it’s off it doesn’t taste good I’ve kept it to contact you It doesn’t smell right I think it’s off The taste was disgusting I am not happy
samantha . 2022-02-08
MORE AT Just Eat
Probably the best Char Sui I’ve ever had, absolutely bangin. Would beg for the recipe if I thought it would do me any good! Everything was really good too
Gareth . 2022-01-26
MORE AT Just Eat
Beautiful food Lovely and hot Thank you for fast delivery Five star takeaway
samantha . 2022-01-17
MORE AT Just Eat
food came late and was a poor standard (cold)
Megan . 2022-01-11
MORE AT Just Eat
Food was luke warm, we ordered 3 dishes, the salt and chilli squid, duck in black bean sauce and the szechuan beef all of which had an identical, tasteless sauce with a strong chemical smell.
Sam . 2022-01-09
MORE AT Just Eat
Nice delivery man and fast Food however was cold and batter very sorry
Jack . 2022-01-05
MORE AT Just Eat
Tasty and hot. We will be back x
Pamela . 2021-12-31
MORE AT Just Eat
Food was quite bland and greasy. The prawn crackers weren’t good so that says a lot.
Sam . 2021-12-22
MORE AT Just Eat
Have been ordering from this takeway for a few years now but the last few meals have really been disappointing. Sadly won't be ordering from here again as it's just went really downhill. Chips were dry and pretty difficult to chew. Onions in the curry were just inedible, couldn't chew them they were like plastic. Sweet and sour chicken just wasn't pleasant to eat at all. Sauce was fine but the chicken in batter had an unusual taste. Overall it's just a shame the food has been so bad as this used to be a very nice takeaway! Delivery was quick however and the food was hot probably the only positives from this.
Sophy . 2021-12-12
MORE AT Just Eat
The food was late unlike this takeaway The prawns where not hot Slightly disappointed ☹️
samantha . 2021-12-05
MORE AT Just Eat
Not satisfied with order tonight borderline average, the chips were completely stale and cold and noodles were underdone and rubbery the food or curry was that spicy it was basically inedible and i usually love spice but that was another level. Far to pricey for the quality of food you receive. Sadly we won’t be back
Lauren . 2021-12-04
MORE AT Just Eat
Amazing food as always, my favourite local Chinese after a LOT of searching!!
Kirstin . 2021-12-02
MORE AT Just Eat
Absolutely terrible food and service
mark . 2021-11-27
MORE AT Just Eat
We won't be using Just eats again this is the 2nd time we ve had to wait and wait for our food . When we use the takeaways own delivery we never have to wait longer than an hour . Just eats service takes far too long we are very disappointed.
Susie . 2021-11-20
MORE AT Just Eat
Food was so good, delivery on time and everyone loved it
Karen . 2021-10-27
MORE AT Just Eat
Food is always lovely from here. Been my go to chinese for a long time now.
Emma . 2021-10-22
MORE AT Just Eat
Amazing, as usual. Thanks. PS: do you guys sell cans of pop? I couldn't find on menu.
keith . 2021-10-03
MORE AT Just Eat
Everything was great, thanks 😊
Kerri . 2021-08-07
MORE AT Just Eat
Food was very tasty Received free bag of prawn crackers which was a nice surprise. Only small issue was the food was not hot but will definitely order again.
Gloria . 2021-08-01
MORE AT Just Eat
Food good…. Kids dissapointed as no prawn crackers
lynda . 2021-07-23
MORE AT Just Eat
Best takeaway for a considerable time. Thank you
Brian . 2021-07-23
MORE AT Just Eat
Great food nice and friendly staff highly recommend
Connor . 2021-07-09
MORE AT Just Eat
Lovely food, really enjoyed it 😀
Michelle . 2021-06-30
MORE AT Just Eat
Tryed new dishes, food was amazing and cooked perfect
Lauren . 2021-06-03
MORE AT Just Eat
First time I have ordered from here, the ribs were over cooked and tasted burnt, also the salt and chillie chips were black and tasted burnt, unacceptable , would not order from here again
Jason . 2021-05-06
MORE AT Just Eat
These schedules may not be completely accurate on special days. Please always confirm with the restaurant
Similary restaurants in North East
172 Opinions
Food is horrible’ we got the sweet and sour chicken and rice the chicken was very slimy definitely not the best balls were greasy and I don’t know if this came in the rice but there was a small beetle
chickenricemeatpepperspicyprawnbeanbeautifulribscookedprawns