GastroRanking-logo
whatsappWhatsapp
phoneCall
desktopWebsite
menuMenu
bookingBooking
3.5

Based on 1.136 opinions finded in 1 websites

site_photo3

Nº 679 in 901 in Swansea

Nº 130 of 152 British in Swansea

CUSTOMERS TALK ABOUT DISHES WITH..cookedbassmustduckfilletpotatopaygarlicchickenoldmeatprawnspepperfishsteaksaladmushroomssteakslamb
Score

comment_iconOpinions

Absolutely terrible night and spoiled a birthday celebration. Took 2 hours for half the starters and further starters came after prompting. Food was terrible chicken breast cold in centre and swimming in melted butter couldn't taste garlic! Sent it back for it to be returned absolutely cremated and inedible. Queues for drinks. Staff just going around in circles no specific waiter although head waiter nominated different staff member to settle out bill no apology or offer to reduce bill that came to £289! Wine very overpriced and seems request for wine responded to very quickly shame the food wasn't the same. Arrived at 7pm with half starters served at 9pm!! I whenever return unless management and chefs change it was really disappointing.

site_logo

Meg D . 2024-12-22

MORE AT TripAdvisor

Approx 20 of us booked, pre-ordered and paid a deposit, for a late lunch on Friday the 13th (was that a sign?) We waited ages to get our starters, stuffed mushrooms were quite slimy, but just edible. I had pre-ordered grilled chicken and jacket potato for main. What can go wrong? Mine was the last to arrive on the table, most people had finished their protein, then about 15 mins later their chips arrived, with my chicken. I could have soled my shoe with it, the steak knife had a difficult job! It was black, hard and dry, the jacket potato arrived about 10 mins later, that was cold and hard. Now I know why the lighting is so dim upstairs, so you can’t identify what you’re eating? Because no way you could have by taste or texture. One of our party had to go home after the meal, really ill. A few felt really dodgy for the rest of the night, but stayed out. 4 stuffed mushrooms, dry, burnt chicken breast and a cold, hard jacket was £21. Not a pea or lettuce leaf to be found! I didn’t have a drink, I didn’t fancy queuing for 30 minutes to get one. Well, that’s my first and last experience of ‘the Bras’, pity, as I’ve been told it used to be lovely.

site_logo

Amanda G . 2024-12-15

MORE AT TripAdvisor

Gran comida del menú establecido. Visitamos este restaurante al menos una vez al mes. Pablo y el personal son serviciales y amables. Gran elección en el menú del almuerzo y el pescado siempre se cocina a la perfección. El vino tiene un precio razonable. Me encanta el ambiente relajado allí y lo recomendaría encarecidamente.

site_logo

Serees55 . 2024-12-15

MORE AT TripAdvisor

Where to begin. Yes it’s Christmas time and yes it’s going to be busy, but why overstretch when you don’t have the staff to ensure paying customers are looked after? Queues at the bar…took about 30 mins each time to get served. Food…? We were a party of 20 and yes our meat/fish dishes all came out roughly the same time. But…why oh why put steak on a hot plate that continues to cook it? So many had to be returned because the steaks were cremated! Then the size portion…7oz steak, more like 3 oz! So the meat/fish dishes are on front of us all, now where are the chips/ jackets? Well they followed 15 minutes later! So we had two choices, sit and stare at the food, let it go cold and then eventually eat them with the potatoes, or eat the meat/fish and enjoy the potatoes in 15 minutes! What a complete farce. To top it all, the chips were greasy and the jackets were cold and rock hard. No apology and a whooping bill for substandard food and awful service. First time back here since before Covid and it wasn’t good then…reminded me never to return. Such a shame as this place used to be outstanding and a regular of mine back 15/20 years ago…never again. Spend your money somewhere that does delicious food and has staff that actually give a toss!

site_logo

mea1979 . 2024-12-14

MORE AT TripAdvisor

Dreadful service food took ages to arrive even though it was preordered. Starters edible more shells than mussels.... mains eventually came out the sides came out eventually when all meals were already eaten . Overpriced underwhelming will never return.. long queues for drinks ... save your money and go elsewhere

site_logo

Angela J . 2024-12-13

MORE AT TripAdvisor

My go to place to spend time with family or friends, lovely cosy atmosphere and great attentive staff, lovely food always! Great for birthdays and special occasions.

site_logo

Cheryl l . 2024-08-28

MORE AT TripAdvisor

The service was helpful and friendly- Georgia was very kind. The atmosphere was buzzy and we enjoyed our lunch. The set lunch menu is good value. We all had deep fried hake which was excellent as were the chips and jacket potatoes. I was very pleased that the salad bar has returned and the potato salad was as lovely as I remembered it . You can have salad as the starter on the lunch menu. A lively lunch

site_logo

SJ118 . 2024-08-11

MORE AT TripAdvisor

Haven’t been for a while but was pleasantly surprised to find the service had improved so much. The food was excellent and as always a nice restaurant vibe . Will definitely be returning

site_logo

Andrea P . 2024-08-09

MORE AT TripAdvisor

A bit of a mixed bag. Service and ambience were top notch. Food was OK -a little on the dry side. Ordering at the bar,in a restaurant,just seems weird to me. Plenty of wait staff buzzing around! I don’t get it.

site_logo

Scott K . 2024-08-04

MORE AT TripAdvisor

Dreadful experience on Fathers Day from start to finish, very disappointing as had been a gift from our daughter. Once we had negotiated the stairs which we had not been expecting (as had previously been seated downstairs and I have mobility issues) with staff members weaving around us carry plates of hot food we then had to ask someone where we were supposed to sit. Once there we were served with drinks. After this we didn’t have any communication with staff until we eventually stopped someone and were then told that there were no menus and we had to go over to the fish and meat counter and look up at chalk boards with dishes on. We were told about a set menu for Father’s Day but this didn’t interest. As a result we ended up with no starters just a main meal order. We waited absolutely ages for the meal and were starving by the time it arrived so just tucked in, mine was ok but my husband’s lemon sole was not cooked properly so he ate the vegetables and chips as by then we just wanted to get the experience over. Needless to say we didn’t have dessert and after having to stop and summon any of the many servers each time we needed anything even to pay our bill. Not the best experience but luckily our hotel Morgan’s was not far away and so we went back there where the service etc is impeccable.

site_logo

SisterF . 2024-06-17

MORE AT TripAdvisor

My friends and I visited on a Saturday night in November and were so disappointed unfortunately. We arrived ten mins before our table was booked, and were told we’d have to wait as it wasn’t quite ready (which we were very happy to do). After...

site_logo

tHeBeAcH_yTrAeTh . 2023-12-27

MORE AT TripAdvisor

Service was shocking, except for a young man taking the food order. The Brie starter was still solid in the middle and cold! The steak my husband had was good, but as for the other meals, we were not impressed. 5 starters, 6 mains, one...

site_logo

Amandaglanville . 2023-12-27

MORE AT TripAdvisor

Been coming here for 20+ years. Especially on Xmas eve. Absolutely horrendous today. The service was appalling, staff were rude, inexperienced and didn't care. Starters didn't arrive, garlic bread wasn't ordered. Staff had an aggressive attitude towards us accusing us of not ordering stuff and...

site_logo

Brogan T . 2023-12-24

MORE AT TripAdvisor

Worst service I’ve seen in a long time! Well, I say service … What should have been a lovely relaxing celebratory family meal was a complete shambles, all due to a couldn’t-care-less attitude by staff. No welcome, no information about how to order (how were...

site_logo

Alana D . 2023-12-17

MORE AT TripAdvisor

Awful service. Had to ask for everything including how do we order food, can we have a drink, is there a sauce with that etc. Ordering food was like pulling teeth, really ignorant staff: they don’t tell us that sauces were extra for example. Then...

site_logo

Travel52880280288 . 2023-12-17

MORE AT TripAdvisor

Around 20 of us were booked for out teams Xmas party. Prebooked for 2.30pm, prepaid beforehand and all pre orders given. Starters took 2 hours to come out. My starter was deep fried brie, it had collapsed in comparison to the others and was cold....

site_logo

sherrytrifle26 . 2023-12-11

MORE AT TripAdvisor

How this place has gone continually downwards over the years is a huge disappointment. The lunchtime menu was always of a good standard and reasonably priced. Now it is over priced and of a very poor standard. If you wanted 4, measly lamb chops it...

site_logo

P3423YTdavidr . 2023-12-10

MORE AT TripAdvisor

Group of 12. Table booked for 5pm. Arrived at 5. First drinks arrived 5.30. Ordered at counter. Usual selection. Chips or baked pot inc in price, everything else extra. Some starters pretty decent. Most about £8,not cheap. Mine was stuffed mushrooms. 4tiny mushrooms with garlic...

site_logo

pue92 . 2023-12-09

MORE AT TripAdvisor

First visit and very impressed, food was lovely, service was good though food coming out was quite slow even though wasn’t that busy, worth a visit

site_logo

bulldog19 . 2023-11-09

MORE AT TripAdvisor

Our usual (since opened by Manwell) table downstairs was closed we were firmly directed upstairs. Unsure but by the end of the evening , Surprise! Happy busy warm buzzy atmosphere on top floor was really good. Young Staff in kitchen, bar and tables were faultless...

site_logo

Claudia Anne J . 2023-11-04

MORE AT TripAdvisor

The outside doesn’t look very nice, they need to mend the sign and a bit of paint wouldn’t go amiss. If we hadn’t booked I would have gone elsewhere. Inside though it was very pleasant and I loved the decor. There are no menus, so...

site_logo

Passenger24766800980 . 2023-10-26

MORE AT TripAdvisor

Really disappointed. Booked here for my partners 30th , wanted something special as heard nice things but sadly was a let down . When we arrived it seemed we weren't even booked in. No fizzy drinks available . No menus so had to order at...

site_logo

sineadt8305 . 2023-10-18

MORE AT TripAdvisor

I took my husband here for a birthday treat, when we arrived we were told our table wasn't ready but that the customers were just finishing their meal, our table was booked for 8.30 but it was nearly 9 by the time we sat down....

site_logo

KarenFairweather . 2023-10-16

MORE AT TripAdvisor

Tried our luck for a last minute walk in on a Saturday night and was pleased to be told there was plenty of space as there was just one table in. Took 25 minutes for our drinks to be served and we were never told...

site_logo

Emma L . 2023-10-15

MORE AT TripAdvisor

The most ridiculous ordering process ever. It’s a formal, fairly expensive restaurant but you have to queue for about half an hour to place your order. The idea is that you get to choose your piece of meat or fish from a display. In reality,...

site_logo

909carmela . 2023-10-14

MORE AT TripAdvisor

Very average now. Food okay but disappointing as it seems to not be like it use to be. Service was okay. Won’t rush back. Set menu price is getting more and more expensive other places are better priced and portions don’t suffer.

site_logo

Volksru . 2023-09-30

MORE AT TripAdvisor

After spending years passing the place, we finally decided to go here for a dinner for a special occasion. The menu online looked interesting and the prices sensible enough, if the food was good. Immediately, we noticed a few odd things. There is no menu...

site_logo

profskii . 2023-09-11

MORE AT TripAdvisor

Found as good as always but unfortunately we were left without drinks and had to flag a waiter down a couple of times then they ran out of some desserts and we were the first table in

site_logo

debdavies2017 . 2023-08-22

MORE AT TripAdvisor

Visited Monday evening busy for 7 pm Service excellent Food well flavoured and good portions Ate between 3 of us Meat balls sardines monkfish Lamb skewer chicken princess and suckling pig all washed down with an excellent Albariño wine Value for money 5* Food quality...

site_logo

threecliffsgold . 2023-08-15

MORE AT TripAdvisor

Really disappointed. We had booked a table for 7.30. Turned up and no table, told we could have a table outside. Said no we had booked a table for4 inside, lots of weird communication and eventually got a table. Unfortunately it was clearly a table...

site_logo

carolinef316919 . 2023-08-11

MORE AT TripAdvisor

.service slow , won’t be rushing back , daughter ill all night , very disappointed and always over charged on bill

site_logo

J H . 2023-08-05

MORE AT TripAdvisor

Ordered avocado and prawns as a starter, which was literally microwaved prawns on an avocado cut in half, no seasoning. Ordered chicken skewers as a main and they were so over cooked, my friend also ordered chicken skewers and didn’t get a side salad like...

site_logo

412cazj . 2023-08-04

MORE AT TripAdvisor

Really cool interior with rustic themes and good music. I had the stuffed aubergine which tasted amazing, but had very poor presentation compared to my friend who ordered the same thing. A similar thing happened with two other friends who both ordered chicken skewers but...

site_logo

Emily D . 2023-08-03

MORE AT TripAdvisor

Seen a few bad reviews on here recently but my experience was excellent. Food was lovely & staff were very friendly. We were running very late for our booked table, phoned and staff were very accommodating. When we got there, the 2 waiters we had;...

site_logo

thomaslY5855YK . 2023-07-27

MORE AT TripAdvisor

Shocking! Food is nothing special. Staff are miserable. Asked for water i don't know how many times. No disabled toilet to change a baby.

site_logo

Daydream49177821363 . 2023-07-26

MORE AT TripAdvisor

Booked a table for 7.15.Ordered our food 7.30.ordered dover sole filleted,my husband ordered rib eye steak medium to well. Had to ask for our food 8.30.when it eventually arrived,Dover sole was on the bone and steak was well done over cooked burnt,plus did not come...

site_logo

Julie S . 2023-07-08

MORE AT TripAdvisor

Unfortunately my partner and I were extremely disappointed with our meal when visiting this evening. My partner had the mussels to start which were in a quite bland sauce not the tomato sauce they used to serve. I had the avocado and prawns which was...

site_logo

70samanthal . 2023-07-08

MORE AT TripAdvisor

I visited the Braseria on a Friday lunchtime with my partner. We were ushered upstairs and there were a lot of people, there being a large party of diners celebrating. We were quickly shown to our table and given a wine menu. We have been...

site_logo

SwanseaPaulT . 2023-07-01

MORE AT TripAdvisor

First in resturant and shown to our table, we had to ask for a drinks menu but not really a big deal. After ordering our drinks we went up to display case and ordered our starters and mains. Starters came out and were great, dinners...

site_logo

Nickgroves2001 . 2023-06-27

MORE AT TripAdvisor

Arrived and was asked to wait in the garden as they were not ready. No offer to purchase pre dinner drinks. But when we went outside others had drinks. 20 minutes later shown to an unlaid table and no menu, still no-one to take drinks...

site_logo

Kim H . 2023-06-25

MORE AT TripAdvisor

Been coming to the bras for years lovely beautiful meal parents had the Sunday lunch they thoroughly enjoyed I had the special set menu always a beautiful meal staff always friendly always a nice vibe to the restaurant beautiful mothers day lunch had by all...

site_logo

Haylz39 . 2022-03-27

MORE AT TripAdvisor

I LOVE this dining concept. The fresh produce displayed n a chiller cabinet so you can choose what looks appetising and have it cooked in a way you choose. Beautiful, varied selection of dishes to choose from and a lively, bustling atmosphere. Love it!

site_logo

Foodiequeenie . 2022-03-22

MORE AT TripAdvisor

Nice background music some staff and good along with the manager, and the food lovely but what I haven’t appreciate is the fact that they served the meal that’s it no question asked if there’s anything else you need I needed like tartar sauce for...

site_logo

danielfC7290PV . 2022-03-13

MORE AT TripAdvisor

After more than 500 visits to this restaurant over the last 20 years, with deep regret this will be my last. Its really hard and saddens me to write this review as I have many great experience and memories of this restaurant when it was...

site_logo

H2347TOjond . 2022-02-25

MORE AT TripAdvisor

We finally managd to hold our staff Xmas party all be it a pandemic then a storm causing delays. Table for 10 of our staff. 1st Floor along side another party. We all ate from the main menu. Starters and Mains. Mix of Chicken, fish...

site_logo

jordandE6746IG . 2022-02-19

MORE AT TripAdvisor

Used to love this place , going back 25 years you knew what you were going to get: twice in the past year had a bad experience won’t be going back. Service terrible , slow And bit of an attitude to be honest. Steak tasteless....

site_logo

SamanthaW628 . 2022-02-16

MORE AT TripAdvisor

Came here for an evening valentines day meal as I’ve always wanted to try the food after hearing great things when they first opened years ago I had the prawns in garlic starter prawns had a weird texture but the sauce was nice so I...

site_logo

jjM4364QL . 2022-02-15

MORE AT TripAdvisor

Been going to the bras for so 17 years and always had excellent service and food and always enjoyed good food but to be honest the last yea it has gone down regarding the efficiency of some staff and many dishes not available but still...

site_logo

Traceywillias . 2022-02-15

MORE AT TripAdvisor

Went to the Braz for my husbands birthday, took friends from the media who had ever been there before. Chose this restaurant as we’ve always enjoyed the food and service, this was our first time out eating since the pandemic, so we were really looking...

site_logo

SianeeTee11 . 2022-02-13

MORE AT TripAdvisor

GIVEN A RATING OF 1 THE SAME AS THEIR HYGIENE RATING. WONT BE GOING HERE AGAIN. 🤢 Shame on them. To receive such a low rating means their health and safety standards are disgusting.

site_logo

Tulip1989 . 2022-02-11

MORE AT TripAdvisor

Staying at the Morgan’s who recommended La Braseria, ordering a bit strange but Ok in current climate but ordered Avocado and prawns for starter and some of the prawns arrived still iced which spoiled the dish, told the waitress who said sorry but that was...

site_logo

Muvvawelshy . 2022-02-07

MORE AT TripAdvisor

After hearing good things about this restaurant I decided to give it a go with a friend. We made a booking about a week in advance for a Thursday at 7:30 (normal dinner time). We arrive and are told to scan for menus. For a...

site_logo

saviix . 2022-02-06

MORE AT TripAdvisor

Have been coming here quite regularly for a few years now. Tonight was a birthday meal. Usually go to a French restaurant not too far from here for birthday meals but decid ed to go here as it is one of our favourite places to...

site_logo

ClareT1501 . 2022-01-15

MORE AT TripAdvisor

The food was good, but unfortunately the service/their system for ordering food was terrible. They had just 1 person taking food orders for an entire floor, we were standing for nearly 40 minutes waiting to order (while there were about 4 people supposedly serving drinks...

site_logo

SianR7426 . 2022-01-14

MORE AT TripAdvisor

Arrived to have to wait a little while for someone to seat us all the staff were just looking and walking around with out saying anything to us. When seated no one said we had to go upto the counter to order they just said...

site_logo

Tourist637114 . 2022-01-08

MORE AT TripAdvisor

Dined here with a few friends, it's done downhill what a shame. I haven't visited this place for almost a year. A few friends have said negative comments recently but I thought I will be the judge of that. Upon entry, waiter told me to...

site_logo

donna1232020 . 2021-12-30

MORE AT TripAdvisor

I have been going to 'the brass' for years and it is one of my fav places to eat and I always come away with a feeling of fullness and satisfaction. Unfortunately my recent visit fell a little short. My starter of prawns in garlic...

site_logo

857fionae . 2021-12-27

MORE AT TripAdvisor

Fantastic time. Food very good. Service excellent. Thank you for a great Christmas Eve late lunch. We all thoroughly enjoyed it.

site_logo

Claire R . 2021-12-24

MORE AT TripAdvisor

Went last night as a group of 6, thoroughly enjoyed it, non of our group had any issues, staff were fantastic, under Xmas pressure too, only down side is I thought I'd maybe get a tester of the 4k bottle of wine 🤣, hats off...

site_logo

stevenmC2521TY . 2021-12-23

MORE AT TripAdvisor

Having been a regular visitor to Swansea for the past 15 years, La Bras has been one of my regular places to go & eat with friends who are local to the area. The old staff were great and nothing was ever too much trouble,...

site_logo

Rob S . 2021-12-21

MORE AT TripAdvisor

Group of 10 visited here, the waiters need to learn manners. Extremely rude!!! Ordered a steak, the outside of the steak was burnt to a crisp, no taste and I wouldn’t feed it to my dog. Told the waiter and she did not even apologise...

site_logo

amywA3060EV . 2021-12-17

MORE AT TripAdvisor

I was overcharged by £20 for my lunchtime meal last week and instead of an apology I have received nothing but arrogance and questioning, despite my polite manner (having worked in hospitality for many years). I understand this was probably an accident for over charging.....

site_logo

223lydiaw . 2021-12-12

MORE AT TripAdvisor

Great food and service. Good size portion and steak cooked well. Only negative point is that the place is not organised at all chaos. No proper ordering area.

site_logo

Volksru . 2021-12-12

MORE AT TripAdvisor

So went here on the weekend. I have been before and didnt like the way you have to queue for your food, I want to be waited on when I go for a nice meal. Well seeing as there is COVID-19 now I thought they...

site_logo

LColl72 . 2021-12-11

MORE AT TripAdvisor

We had our Christmas meal booked here, table booked for 14:00, when we arrived we were told we are table 9. So off we went looking for our table only to notice a large people still eating mains, after asking the staff what is happening...

site_logo

Lloyders . 2021-12-10

MORE AT TripAdvisor

I’m surprised by some of the reviews on here as that wasn’t the experience my group had at all. Service was excellent, staff friendly and helpful and food was Superb. Some ordered from the lunchtime set menu, others from the main menu. Starters were lovely...

site_logo

Jonesy2211 . 2021-12-06

MORE AT TripAdvisor

Cannot review the food as we did not get a chance to even take our coats off. After waiting for 5 mins we advised that a table will be ready shortly as there were a few due to finish. After 45 minutes and having to...

site_logo

J7567XGchristopherm . 2021-12-03

MORE AT TripAdvisor

We visited the bras for a big family birthday celebration, having not been since pre-covid. It was a special occasion which was completely ruined by our experience. We waited 30 mins before anyone came behind the counter for us to order our meals and were...

site_logo

scF2880VP . 2021-11-27

MORE AT TripAdvisor

Great dinner at La Braseria. Meat and fish are on display, difficult choices, so many nice, fresh things. We took garlic prawns for starters and a mix of beef, lamb and sole as main course. All delicious! My fillet served on a sizzling plate was...

site_logo

W8398LIalessandrab . 2021-11-26

MORE AT TripAdvisor

Restaurant where the moment you get in you travel to a typycal spanish tavern. Nice athmosphere and decoration and very good idea the open kitchen so you can enjoy the chef cooking while you're waiting for your meal. We order basically seafood and fish and...

site_logo

Tittyshev . 2021-11-25

MORE AT TripAdvisor

My wife and I visited la braseria last night and we were very much impressed with the food, service and the surroundings, would definitely recommend and will be certainly returning in the future 👍

site_logo

meirionj521 . 2021-11-21

MORE AT TripAdvisor

Wasn’t sure about booking here for a large, group get-together based on some not very good TripAdvisor reviews But I needn’t have worried. Yes, prices have risen to the best part of £18 for their two course lunch but it was worth it. Service was...

site_logo

Peters521 . 2021-11-13

MORE AT TripAdvisor

Visited the Braz in early October for the first time since just before lockdown, and, although the lunchtime set menu price had increased to 15.95, the meal was enjoyable and the ambiance as welcoming as ever. With an imminent move from Kidwelly to Cowbridge we...

site_logo

Drsfrom4Roads . 2021-11-12

MORE AT TripAdvisor

Our group of "ladies that lunch" usually ring the changes as to where we have our monthly get - togethers. It was discussed that we had not been to the 'Bras' since before Covid so that was unanimously our choice for today. Big mistake! How...

site_logo

Leslie3544 . 2021-10-27

MORE AT TripAdvisor

Having read reviews before going to la bras tonight was a little apprehensive, needn't have worried, food was delicious, and generous servings, staff really helpful and polite, we even changed our seating area without any bother, would definitely recommend, and will be revisiting. Thoroughly enjoyed.

site_logo

sandralY9385RS . 2021-10-21

MORE AT TripAdvisor

I arrived on a Monday night 7pm having been going there for years . NO information on any media we needed to of booked. Fair enough TGINGS CHANE BUT i was spoken to like a child. Terribly disappsointing as been coming for many many years.

site_logo

W2379OAwandah . 2021-10-12

MORE AT TripAdvisor

Nobody explained the procedure. There are no menus and you have to scan a bar code with your phone. Difficult when you don't have a smart phone. You then go to the counter to order. It was 25 minutes before we had a drink. You...

site_logo

K4987QWanitad . 2021-09-28

MORE AT TripAdvisor

I was so excited to return this evening to "the bras" after not being out in Swansea for nearly 2 years. Unfortunately the reality was disappointing. There were 7 of us looking forward to the excellent normal standard evening meal, but each of us had...

site_logo

Angiecook65 . 2021-09-25

MORE AT TripAdvisor

Another lovely meal at La Bras! Food was delicious, had a lovely relaxed afternoon with wine and good food! What more can a girl ask for! I visit this restaurant regularly and it never fails to impress! I rarely write reviews, but felt this time...

site_logo

Claire O . 2021-09-24

MORE AT TripAdvisor

I have been eating at La Braseria off and on for over 30 years and to be honest the food has always been consistently good and today was no exception. Well done chef Joey and crew. Ok the service is a bit slow at the...

site_logo

adriankC4122PR . 2021-09-23

MORE AT TripAdvisor

Was really looking forward to this this but oh dear.. service wasn't great..manager seemed annoyed..no-one told us how the restaurant worked so sat for ages waiting for a menu which never came.. only to be told when asked that u order at the bar ??...

site_logo

Carolyn2507 . 2021-09-20

MORE AT TripAdvisor

I visit the Brass numerous times per month abs have done fir a number of years. I must say the food abs wine is always great. My partner and I visited yesterday for lunch. We both ordered off the lunchtime menu £14.95 per couple. I...

site_logo

rhodrid44 . 2021-09-15

MORE AT TripAdvisor

Went as a works night out as this place, pre covid was rock solid. Safe bet then post covid? No!! Only 1 beer in stock- peroni- nothing on tap, no beer, ale, Guinness even in a bottle. My T bone steak, although cooked perfectly, was...

site_logo

TriesteNo1 . 2021-09-12

MORE AT TripAdvisor

Friendly greeting . Very prompt attentive service and excellent food . Fillet steaks cooked to perfection ! Would recommend this restaurant .

site_logo

Paradise39596910432 . 2021-09-10

MORE AT TripAdvisor

We thought we would visit this restaurant as there was not many other fancy looking eateries in the area. I must admit I wished we walked more towards the waterfront. We walked in to be greeted by what we thought looked like the manager,who had...

site_logo

B4917PRdorism . 2021-09-09

MORE AT TripAdvisor

Never one time write reviews or ever moan about food, our experience there was horrendous. The service was atrocious, we sat for 20 mins before asking if we want a drink, only until my partner asked we was served. When ordering food the waiter was...

site_logo

robynbp . 2021-09-05

MORE AT TripAdvisor

We stayed in Swansea for 4 nights and came upon this restaurant. I am amazed at the 1 star reviews and yes, its quirky, you go up to a counter to choose your meat or fish and the board needs you to bend your neck...

site_logo

limatoo3 . 2021-08-30

MORE AT TripAdvisor

Had been a month previously and food and service was pretty good. Went again on a Sunday for a 90th birthday lunch for dad s a party of 5 so intended to be a pretty special occasion. Staff inexperienced (or maybe just incompetent) but drinks...

site_logo

andrewsO3384AG . 2021-08-24

MORE AT TripAdvisor

I went to the 'Bras' for a works function. Simply dreadful service from staff that could barely look any of the guests in the eye when they spoke to us or brought the food. The waiter got frustrated with us, when he got the order...

site_logo

chriswT8750YT . 2021-08-15

MORE AT TripAdvisor

We love a visit to la brass , we haven’t been for a while but it was definitely worth the wait the food and service was amazing the filet steak was melt in the mouth can’t wait to come again Xx

site_logo

Tracy s . 2021-08-14

MORE AT TripAdvisor

Service was appalling and food was ok when it eventually all arrived. Steak was cold by the time the pepper sauce came, salmon didn’t arrive at all. Asked 4 times for a jug of water for the table, had to go up to the bar...

site_logo

Lisalews . 2021-08-14

MORE AT TripAdvisor

Service non existant. They were seriously understaffed with young inexperienced waiters. Had to ask for cutlery only to be questioned how many did we want !!! Dont know if its a new covid rule that you have to share to save on washing up... Garlic...

site_logo

Taffythetraveller . 2021-08-12

MORE AT TripAdvisor

Had a meal here tonight, can't fault the service or the meal. Drinks are a little expensive but that's my only negative comment. Thank you to all, we will return.

site_logo

Pam R . 2021-07-18

MORE AT TripAdvisor

We used to frequent La Braseria regularly but have moved away so this was a return visit after 8 years. Contrary to some negative reviews we were so delighted it was unchanged despite Covid restrictions which they are managing really well. Greeting by Darren and...

site_logo

pamhT1903ZT . 2021-07-03

MORE AT TripAdvisor

Visited La Bras for lunch. Very hot inside & not much distancing. Still had to que for food which I found strange. We ordered 2 garlic bread only one was brought. I ordered plain chicken, the brought garlic chicken. Garlic chicken was full of water....

site_logo

heleneWales1 . 2021-06-20

MORE AT TripAdvisor

Ate on a Saturday night 7pm sit down meal. Extremely busy but staff were excellent given the challenges currently with COVID. Very impressed.

site_logo

michelineddie . 2021-06-20

MORE AT TripAdvisor

We visited on 15th June 2021 for a family birthday meal. Having visited La Braseria on many previous occasions, I was very much looking forward to dining at this restaurant. When we arrived, we were met with a small queue outside the restaurant (which is...

site_logo

James M . 2021-06-16

MORE AT TripAdvisor

I am surprised that there are recent negative reviews here, which I suppose suggests inconsistency. We had a very enjoyable evening here. We shared oysters (probably the best and largest we have ever eaten) and a very generous seafood platter, which we struggled to finish!...

site_logo

SarahC0805 . 2021-06-12

MORE AT TripAdvisor

The whole evening lacked any care or passion, it was a long awaited 21st birthday treat, how disappointing the whole experience was, poor customer service, only 2 available vegetarian options that were inedible, side orders felt as if they were reheated from the day menu....

site_logo

fireturk . 2021-06-03

MORE AT TripAdvisor

I ate lunch here with my partner on 27/5/21. We both had garlic mushrooms, steak medallions in peppercorn sauce and chips, and white chocolate profiteroles in cream, plus a few glasses of Siglo Sacco Rioja helped wash the meal down. If I was picky, I...

site_logo

SwanseaPaulT . 2021-05-30

MORE AT TripAdvisor

Similary restaurants in South Wales

restaurant_img
3.5

3 Opinions

location-icon11 Capel Road
British
outdoor_seating_202002takeaway_202002delivery_202002

Ordered a meal at this kebab house at 8.13pm Called 1.5 hours later only to be fed lots of lies about delivery driver delivered food to the wrong house Eventually had food delivered more than 2 hours after order was placed They gave me a bottle of orange for my trouble Bit of a joke really if they think that would keep me happy Food looked like it had been thrown into the box in one big rush salad didn't seem very crunchy My only advise to anyone ordering from this place is READ THE BAD REVIEWS FIRST before you order to avoid the pending disappointment Even if the food tasted good which unfortunately it didn't It came way too late to enjoy it Shop owner didn't seem to care as he already had my money I WILL NOT dare order from this place again I may as well just throw my money at a big bag of sweets and waste my money in a delicious way

restaurant_img
3.5

111 Opinions

location-iconUnit 4 Heron Way
British
outdoor_seating_102421takeaway_102421delivery_102421

Fish was ok but no bigger than the other ones in the heater unit, soggy chips were ok. This is the most expensive fish/chips/curry sauce /battered sausage I’ve ever had. Friendly staff but £26.40 was not worth the cost.

restaurant_img
3.5

40 Opinions

location-iconKingsway
British
outdoor_seating_102993takeaway_102993delivery_102993

We called in for a drink one afternoon. The place was almost empty, as indeed it seems to be the majority of the time. The place is well furnished and roomy but lacks atmosphere. Not for me.

restaurant_img
3.5

1793 Opinions

location-iconFendrod Way
British
outdoor_seating_102958takeaway_102958delivery_102958

Staff were really friendly and welcoming. The atmosphere was really relaxed, and the Christmas decorations were really pretty. Food and drinks were lovely. Thank you for a lovely evening. We'll be back soon.

restaurant_img
3.6

2506 Opinions

location-iconUpper Fforest Way
British
outdoor_seating_205478takeaway_205478delivery_205478

Good service , prompt food just a little Cold in the restaurant. I should have worn a jumper .