GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.6

Based on 349 opinions finded in 2 websites

site_photo4

Nº 426 in 2148 in Bristol, City of

Nº 20 of 89 Indian in Bristol, City of

CUSTOMERS TALK ABOUT DISHES WITH..mangoricechillispicymeatfriedchickenporkprawnlambcurrymust

comment_iconOpinions

Food was really good and tasty. Fast service and good drinks.

site_logo

Joseph Vazquez . 2025-02-17

MORE AT Google

The dosa itself didn't taste as authentic.probaby weather related batter fermentation difficulties. Chicken dosa filling was very tasty.paneer fry was spicy hot and well made.lemonade was good.we ordered ginger beer.it was not good with dosa.should have gone with their suggestion and ordered the chai.atmosphere was ok but we felt a tad bit claustrophobic in the corner seat behind a wall.will need another visit and sit upfront near the windows.good prompt service,nice people.

site_logo

Susan E . 2025-02-16

MORE AT Google

Absolutely delicious! I highly recommend a visit.

site_logo

Greg Hatfield . 2025-02-10

MORE AT Google

Undoubtedly my most favourite biriyani in the whole of England. Especially coming from somewhere close to Dindigul.

site_logo

Raghavendran C . 2025-02-04

MORE AT Google

This is one our go-to place, whenever we want to have an authentic South Indian food. Some of our favourites there are chicken biriyani, kodi vepudu (chicken 65's equivalent), prawn thokku, and now our recent favourite is their lunch thali - loved it! I can certainly say you can't get a better south Indian biriyani than you get it here!

site_logo

Diwa . 2025-01-26

MORE AT Google

AMAZING FOOD!! i live right next door so im honestly sorted for life, absolutely love it!!! i couldn’t recommend it enough!!

site_logo

Sebastian Goodchild . 2025-01-23

MORE AT Google

We had 3 starters, one dosa and 2 pints between the 2 of us. The amount of food you get for the price is great and the quality is insane! The flavour from each meal and the presentation really exceeded my expectations. Really great service too. Friendly staff and the food arrived in good time. Can't wait to come back again.

site_logo

Nate Wick . 2025-01-19

MORE AT Google

Good food with Authentic taste.

site_logo

Ramya Kesav . 2025-01-01

MORE AT Google

Authentic South Indian food which is rare to find in Bristol and very welcoming staff I will definitely go there again 🙏

site_logo

Manoj Murikinati . 2024-12-28

MORE AT Google

Kal Dosa is a must-try spot for any Indian food fan! Please get a dosa, they are amazing!!

site_logo

Ryan Adams . 2024-12-16

MORE AT Google

Came out for Sunday brunch but ended up here! And was delighted. We had the fish fry, southern fried chicken and a masala dosa to share, with mango lassis. All of it absolutely banging and highly recommended.

site_logo

oliver edwards . 2024-12-15

MORE AT Google

Very nice and professional service. Cosy atmosphere. Not to mention the delicious food, which even convinced my friend who doesn't like Indian food. I love South Indian food. Dosa is a dish that will satisfy the most demanding palates. In addition, when I wanted to give them a tip for this wonderful experience, they flatly refused, saying that my words of appreciation meant so much to them that they didn't want any money. Heartwarming ❤️

site_logo

Scigniejew . 2024-12-15

MORE AT Google

The staff was super accommodating, food was delicious!

site_logo

Eya Beldi . 2024-12-12

MORE AT Google

Met a friend here for dinner, and I have to say, it was a great choice! I’m vegan, he’s not, we both thoroughly enjoyed our meals and the dosa was particularly lovely! I would give the mysore dosa 10/10! I wish I had got another instead of my main, the flavor profile was amazing and of course the texture of the crispy dosa with the spicy aloo is just perfect! Really lovely place, clean and tidy. Lovely atmosphere and friendly staff who were attentive but not intrusive. I’ll definitely come back if I’m in the area!

site_logo

Joey Anderson . 2024-12-11

MORE AT Google

I had a great dosa! It was a late booking and it's a popular place so there were only window seats available. But that was perfect for a meal for two. The service was really friendly and super fast. The dosa was really tasty but could have been a tiny bit thinner.

site_logo

Si Parker . 2024-11-28

MORE AT Google

We had our Christmas work meal here tonight (I know we're early but it was the most convenient time for all of us). Most of my team went with the Thali and seemed very happy with it, I had a chilli cheese dosa and red dal. Outstanding food and flavour, and reslly good portions, I felt full but not like I'd overeaten. The staff couldn't do enough for us and were incredibly accomodating with my coriander 'intolerance' (I have the coriander soap gene so have to request no coriander where possible). I will definitely be coming back.

site_logo

Ben Tedds . 2024-11-28

MORE AT Google

Fantastic food and service in a great setting. One of my favourite restaurants in the city

site_logo

Jason . 2024-11-25

MORE AT Google

What a gem of a place! Really glad we booked - it was a midweek evening but full! Lovely vibe, friendly people and scrumptious Dosa. The fish starter was melt in the mouth spicy bliss 😊

site_logo

Trisha Lewis . 2024-11-22

MORE AT Google

Loved it! Great genuine food. Simple menu but great choices for everyone. Will return on my next visit to Bristol!

site_logo

Tina Walton . 2024-11-15

MORE AT Google

Very nice food, highly recommend

site_logo

Samuel Davis . 2024-11-15

MORE AT Google

Had a great menu, different from usual indian menus, great choices for vegetarian, amazing cocktails, service was great, lovely interior, only fault is the toilets could have been cleaner

site_logo

Christa Walton . 2024-11-15

MORE AT Google

Tasty food. Really friendly staff. 👌

site_logo

jonny m . 2024-11-14

MORE AT Google

We visit here regularly - one of the very very few places in Bristol where you can get authentic South Indian food. Staff are always very kind and courteous. Has become our go to restaurant these days!

site_logo

Hemalatha P . 2024-11-12

MORE AT Google

I have now been here twice. Once for lunch and the second was for a large group dinner. The food is fantastic and the service has been amazing! You have to try the paneer. The only gripe I had was making the dinner booking. If they can just make it a little easier.

site_logo

Matt Sikora . 2024-11-03

MORE AT Google

Being from Birmingham, I can be quite picky with Indian food, but Kal Dosa is absolutely fantastic. Delicious traditional South Indian food which is made all the better by the lovely staff. Highly recommend giving it a visit!

site_logo

Daniel Simmons . 2024-11-02

MORE AT Google

Food was amazing! It was all so tasty and fresh. The staff are also so friendly and it’s a really nice atmosphere in the evening

site_logo

Charlotte Dilger . 2024-11-02

MORE AT Google

When eating-in, the food was amazing. Properly spicy but not outrageous mouth killing. Really diverse dishes, the dosas are a must but the veggie sides are also good. Takeaway was much less impressive though - merely good. Hopefully just a one off.

site_logo

Alan . 2024-10-30

MORE AT Google

Super tasty, very good music (massive plus for us), and good service. We asked for the day menu, which is a tasting menu with small plates, small beer and small dessert. Super recomendable!

site_logo

B M . 2024-10-26

MORE AT Google

Food unbelievable. Had the thali and each dish was better than the last. Staff were lovely and even the music was perfect. Highly recommend

site_logo

Fernando Cervantes . 2024-10-26

MORE AT Google

One the best meals I've had in a looooong time, we had the thali, 100% recommended

site_logo

Pablo . 2024-10-26

MORE AT Google

Overall good food with prices on the higher side. Recommended by a colleague and hence, went there to eat the meat thali. The meat thali for 25 GBP seems a bit high for me as the rice and paratha quantity is such that meat thali can't be shared with one person unless the person wants to eat only protein items. The chettinad chicken quantity in chicken dosa is great and chutney's associated with dosa are good but quantity can be questioned based on 13 gbp cost. Food tasted good and there are not many nonveg south Indian places in england. So, a worth try place.

site_logo

Anupam Ghosh . 2024-10-17

MORE AT Google

Food was great, not too heavy and really tasty. I had the prawn and scallop curry for main and the Italian red wine was delish. Manager Amelia and all staff were super friendly, thanks guys.

site_logo

Tom Webster . 2024-10-12

MORE AT Google

Another fantastic meal. Everything is excellent. Would 100% recommend.

site_logo

Duncan Middleton . 2024-09-29

MORE AT Google

Great food, great prices and really attentive service. I highly recommend this restaurant.

site_logo

Chris . 2024-09-29

MORE AT Google

Always had a great experience here. Table service is fantastic and the prices are reasonable enough to stop here for lunch or dinner. The dosas are incredible. They also offer takeaway.

site_logo

Connor Andrews . 2024-09-28

MORE AT Google

Loved it. Friendly service, nice (but quiet) atmosphere and brilliant, delicious food. The dosas are enormous and delicious. The Thali was great, lots of interesting things and we all walked out very full. Will be back again soon.

site_logo

Ian Mitchell . 2024-09-28

MORE AT Google

Love the food and the staff are always so lovely, can’t wait to go back

site_logo

Jes . 2024-09-24

MORE AT Google

We recently dined at Kal Dosa and had a fantastic experience. We ordered the Thali, and every dish was bursting with flavor and perfectly prepared. The staff were attentive and helpful, adding to the overall excellent service. With such a delightful meal and great service, Kal Dosa certainly deserves 5 stars. I’m looking forward to returning soon.

site_logo

Hpone Theinkha Lin . 2024-09-15

MORE AT Google

I recently visited Kal Dosa, an Indian restaurant that exceeded my expectations in every way. We ordered the Thali, and each component was thoughtfully crafted, providing a true taste of authentic Indian cuisine. The highlight of the meal was the Rasam Soup, which was simply brilliant. The staff at Kal Dosa were exceptionally friendly. I highly recommend Kal Dosa for anyone looking to enjoy flavorful Indian dishes. It's a place I’ll definitely be returning to!

site_logo

Su Wint Hlaing . 2024-09-15

MORE AT Google

We just had a drink and snack outside, but both delicious and service excellent. Looking forward to returning for a full meal one day,

site_logo

Tim Barrett . 2024-09-14

MORE AT Google

I booked a table for 15:30 for three people. When I arrived, I requested a thali. I was informed that this finished at 15:00 however, the chef was happy to cook this for us anyway, which was fantastic. Lovely South Indian food. I would definitely recommend this place! Loved our food!! Thank you 😊

site_logo

Tessa Stork . 2024-09-01

MORE AT Google

Stunning food Best iv eaten in England Gorgeous Loved it So happy Yummy

site_logo

Fern Dors . 2024-09-01

MORE AT Google

What a find! Delicious South Indian food and good value with a lively atmosphere.

site_logo

Nicola Shelley . 2024-08-30

MORE AT Google

We found ourselves at Kal Dosa quite late in the evening after our originally booked restaurant couldn't accommodate a celiac-friendly meal. From the moment we walked in, the staff at Kal Dosa went above and beyond to make us feel welcome and safe. They assured us they would take every precaution to avoid cross-contamination, which immediately put us at ease. As we waited for a table to free up, they thoughtfully accommodated us outside with drinks, and promptly called us in when our table was ready. The menu, though relatively small, is packed with fantastic flavors that made it hard to choose just a few dishes. Every bite was delicious, though we may have overestimated our tolerance for spiciness! But no need to worry—the attentive staff quickly offered a small, refreshing drink that worked wonders in cooling our burning mouths. Overall, our experience at Kal Dosa was fantastic. The combination of great food, attentive service, and genuine care for our dietary needs made it a memorable evening.

site_logo

Andrea Wright . 2024-08-30

MORE AT Google

Great restaurant - really tasty food and friendly staff. - The waiter even ran after us to give me back sunglasses that i'd left on the table! We will deffinitly be going back!

site_logo

Matt Wilcox . 2024-08-24

MORE AT Google

My family enjoyed every dish that we ordered. The service was great, food was delicious.We definitely going back.

site_logo

Lily Li . 2024-08-23

MORE AT Google

Extremely tasty, authentic food. Nice atmosphere and fast service.

site_logo

Thomas McLaughlin . 2024-08-19

MORE AT Google

Proper with Indian food...dosas just like they serve in India. Very tasty all round.

site_logo

Mary Stanley-Duke . 2024-08-17

MORE AT Google

Amazing south Indian food, the dosas were huge and so tasty! The mango lassi was fantastic. The service and atmosphere was brilliant. Loved that they are dog friendly too. We will definitely be back!

site_logo

amber guest . 2024-08-12

MORE AT Google

What a lovely experience we had this evening! The food was absolutely excellent and the service was brilliant! We will definitely be back here.

site_logo

Jayne Guest . 2024-08-09

MORE AT Google

Superb fresh food and cocktails, excellent service! Cannot recommend this place enough! Will be back!

site_logo

Sarah . 2024-08-09

MORE AT Google

Absolutely fabulous! Food delicious, staff incredibly helpful and attentive. Atmosphere very calming. We will definitely be back

site_logo

Gina Devonald . 2024-08-09

MORE AT Google

Excellent food and a lovely friendly place.

site_logo

Jonathan Griffin . 2024-08-04

MORE AT Google

Been here for dinner but had the lunch today and the Thali blew my mind. Fantastic restaurant with lovely staff.

site_logo

Claude “The food decider” . 2024-08-04

MORE AT Google

Went with friends for lunch - WOW!! The food was insanely good and the service was fantastic. We will be back!

site_logo

Sarah Beasy . 2024-07-27

MORE AT Google

My lamb dish either used a very poor cut of lamb or was beef.

site_logo

paul watson . 2024-07-15

MORE AT Google

We went on a Friday night without a reservation and managed to grab a table at the bar. Service was well organised and friendly. We had a couple of daiquiris to start - good value at £15 for 2. We then shared a couple of delicious vegan starters. The crispy paratha chaat was dangerously addictive and the cauliflower kempu bezule was wonderfully fragrant with fresh curry leaves. We then had the Mysore Masala Dosa, which was epic, though I could have eaten double the amount of the punchy condiments that came with it. Fab food, reasonable prices, vegan friendly and great atmosphere. Bristol is lucky to have this place!

site_logo

Sam Dennis . 2024-06-29

MORE AT Google

Nice Indian restaurant options are limited.

site_logo

ALBIN SEBASTIAN . 2024-06-24

MORE AT Google

The food was good,but it is too expensive when it compare with the other Indian restaurants.

site_logo

Saranya kannath . 2024-06-19

MORE AT Google

Incredible meal. Everything was so flavourful and all the dishes complimented each other. The roti was stand out. Staff were great and our waitress was very helpful recommending the right amount of plates to share. Can’t wait to return.

site_logo

Kirsten Paris . 2024-06-12

MORE AT Google

Lovely food, friendly waiters, good service. Mango lassi was good and dosa and curry was great. There was a large group of us. I had the fish curry and rice which was lovely.

site_logo

Ayshe Ibrahim . 2024-06-10

MORE AT Google

Best sin in Bristol . Dindikal biryani was brilliant 😋

site_logo

vivek vardhan . 2024-06-08

MORE AT Google

The staff went above and beyond to make our evening special. They were so friendly and accommodating! The food was delicious and a great selection of drinks

site_logo

Kerrie Lee . 2024-06-07

MORE AT Google

Worst food I ever eaten. I got food poisoning. (Previous Message before reply) Hey benny, this message is regarding your reply for my review, I could not be able to reply your message below, reply option disappear, don't know why.(My Response date and time: 26/05/2024 & 17:05) I ordered biriyani last night via Deliveroo and it came along with gravy and raita. It smelled very bad. I thought it was a problem with gravy and tried biryani a little bit and after some time later I felt stomach pain, stomach upset and fewer in the last night itself. It is not simply blaming you. I would like to inform you guys about the food. I experienced and posted the review with my genuine feedback. It is not such a baseless accusation. Could you please let me know what proof are you looking for. And I have eaten (Ordered via Deliveroo) a lot of times in your restaurant, that time it was okay, with the same expectation I ordered and full disappointment. I would like to inform you about the quality of the food, it is not make you guys down. Regarding that, I have sent an email to the below mentioned email address which you shared, check it And for your information, I have attached the photo copy of the bill. Please have a look. Thanks! Naresh

site_logo

Naresh Paramasivam . 2024-05-26

MORE AT Google

Chicken dosa is delicious Great atmosphere

site_logo

Ella Broadbent . 2024-05-24

MORE AT Google

Excellent food, staff went above & beyond & very welcoming. We hadn’t booked and were lucky to get a table as very busy on a Weds night & didn’t take long to work out why. Food & service superb & staff still took the time to make a last minute birthday surprise for my husband special.

site_logo

Celestine Munden . 2024-05-22

MORE AT Google

I went here because I'm gluten free and love Indian food. The waiter was really nice and the food was delicious. I precise that I eat regularly Indian food in different restaurant, and this one is one of my favourite so far. I recommend the red dhal and the eggplant peanut curry. I came back two other times to take some food as takeaway. Thanks.

site_logo

Sylvain Richard . 2024-05-19

MORE AT Google

Absolutely great service ! A special thanks to the hostess yesterday for taking action when my meal was too spicy. Not only was it replaced, but I was offered a complimentary one as compensation for the wait. The food was delicious and the ambiance was vibrant. Would highly recommend !

site_logo

lothmane . 2024-05-19

MORE AT Google

Lunch time with 4 year old. Staff super friendly and helpful making suggestions for/ to the youngster. Food excellent

site_logo

Peter Colson . 2024-05-15

MORE AT Google

Excellent food, service, atmosphere, and prices, very pleased and would recommend

site_logo

Flubadubdub The Great . 2024-05-14

MORE AT Google

Actually good dosa in Bristol, hits the spot! If you’re a small eater I’d say a masala dosa is fairly filling but it’s definitely worth trying all the lovely starters on the menu!

site_logo

Utsa M . 2024-05-13

MORE AT Google

Unpretentious, tasty meals with a slight twist. I enjoyed the dosas - for the record 1 dosa was plenty of food but should you wish more you can always order a starter too. The curries had a fantastic taste too. The staff were super helpful. I would have liked a little more sauce with the dosa and slightly less western take - it is as if they felt the dish won't be able to stand on its own two feet so they had to also offer a cheesy version. Don't get me wrong none of this is disappointing at all just felt less authentic.

site_logo

Teodor Das . 2024-05-10

MORE AT Google

Food, vibe and service were all spot on. Dosa and curries were so delicious I was thinking about them long after the meal was over! Food came very quickly even though the restaurant was nearly full. ❤️

site_logo

Dave Chang . 2024-05-05

MORE AT Google

Food was incredible, so delicious and huge portions! Second time we've been here, new fave restaurant

site_logo

Molly Peters . 2024-05-02

MORE AT Google

Managed to be squeezed in without a reservation which was greatly appreciated as we were in a rush. Food was brought out and was delicious as well as excellent value. Dosa's were huuuuge! Curry's were a little coriander heavy and didn't have as much balance and depth of flavour as one may hope. Still generally everything was pretty good. 👍🏽

site_logo

Spencer Osborne . 2024-04-30

MORE AT Google

Please refer to my trip advisor post for full detail, extremely bad service from a money focused tone deaf restaurant. Ruined a birthday experience.

site_logo

brett jones . 2024-04-28

MORE AT Google

Very good ambience, great food,

site_logo

Priya Ramanathan . 2024-04-27

MORE AT Google

1st visit with family and loved it. Food, atmosphere and staff were amazing ,☺️👍

site_logo

Chris Kinston . 2024-04-24

MORE AT Google

First time here. Absolutely loved it. Food, service and staff (Abbas and Jamal need a particular mention 😂 but everyone was great) were all top notch. Quite a flavour sensation. Definitely packs a punch and for those that need it, a side of yoghurt is available! We shared a starter of crispy strips of paratha with the most devine sauce (mint / coriander possibly). For mains we ordered the Chicken Dosa, the braised lamb curry, with a side of dhal. The dosa looks huge but is actually a very light ‘pancake’ that you can use to dip into all the sauces. My mouth was tingling. Will defo be back.

site_logo

Michelle Goodfellow . 2024-04-21

MORE AT Google

This was my 2nd visit to Kal Dosa but was left feeling disappointed on this occasion. The food came *so* quick, within 10 minutes of walking into the restaurant - before our drinks had even arrived to the table! Strange. Also, throughout our meal multiple staff members wearing uniforms were openly smoking in the outdoor seating area and directly next door, outside Costa. Not a good image to represent the restaurant and does put me off returning!

site_logo

Bam . 2024-04-20

MORE AT Google

Lovely ambience and superb food! The starters were really incredibly and all the mains were done lovely. Hightly recomend getting the southern fried chicken starter 😋. Service was delightful all evening too, lush staff. Overall a stunning meal out on Gloucester Road :) (p.s. spicy means spicy with the braised lamb dish!)

site_logo

Ella_16 . 2024-04-16

MORE AT Google

Very nice restaurant with authentic south Indian food. Staff was very welcoming and overall service was great. Would definitely recommend.

site_logo

Rishi Porwal . 2024-04-15

MORE AT Google

A friend recommended this place when we asked where to get the best Indian food and we were not disappointed. The food was AMAZINGGG! All the front of house staff were welcoming, helpful and attentive. The food was excellent and it was extremely reasonably priced. Will definitely go back and 100% recommend. Eat here, it’s brilliant. ⭐️ ⭐️⭐️⭐️⭐️

site_logo

Verity Orchard . 2024-04-12

MORE AT Google

Delicious food, good service, nice ambience. Must visit for foodies in Bristol

site_logo

Kalaichelvan T . 2024-04-12

MORE AT Google

One of the best curries I've ever had (strongly recommend the pork belly) and our waitress was so lovely! Will absolutely be returning.

site_logo

Sarah Boxall . 2024-04-11

MORE AT Google

Lunchtime Thali genius idea so good

site_logo

natascha morison . 2024-03-26

MORE AT Google

Portions were generous and the dosa in particular was delicious. I was warned my lamb dish was spicy but it barely had any heat, so if you like milder dishes, this place is for you. Servers never checked on us - every time I had to get their attention which took a while as they seemed to spend most of their time chatting at the bar. Gave up attempting to order a second round of drinks and just got the bill in the end. My partner also found a long dark hair in his food, which was gross (we couldn't get anyone's attention at the time and forgot about it by the time we managed to get someone over to take our plates and bring the bill).

site_logo

Jessica . 2024-03-17

MORE AT Google

Fantastic meal. The dosa was amazing and the.small plate selection meant we had a really varied experience. So good will definitely come again

site_logo

Peter kelly . 2024-03-16

MORE AT Google

Service is a big part of my overall enjoyment of a meal - it was very busy on the evening I went. They need more staff as it was slow -I sat for 10 mins before they asked me for drinks / took my order. Food on the whole was ok but I wouldn’t rush back.

site_logo

Joseph Burke . 2024-03-14

MORE AT Google

Just the loveliest little place. The food is delicious and we found all the staff really friendly and welcoming. Great atmosphere and full on a wednesday night!

site_logo

Holly Lloyd . 2024-03-08

MORE AT Google

One of the best south Indian restaurant in Bristol. Just tried chicken dosa and mysoor dosa both were delicious and must try. Highly recommended

site_logo

Shine Paul . 2024-03-03

MORE AT Google

Came here on Valentine’s Day, and have since been back with my family, because it was so tasty. The food is delicious, and the menu is really good for gluten free!! Great atmosphere, too. Probably my favourite spot down Gloucester Road, I will be back!!

site_logo

summera2020 . 2024-03-02

MORE AT TripAdvisor

A really nice, vibrant restaurant. It's refreshing to have something a bit different on an Indian menu, with plenty of side dishes (small plates) to choose from to compliment your main dish. Despite being right at the back of the restaurant we were attended to efficiently, and we didn't have to wait long for our food either. Bosh!

site_logo

Ellis Corin . 2024-03-01

MORE AT Google

We had a family meal here, early Friday evening 6.30, three generations of our family. The welcome was immediately and warm, the staff and the service were excellent. The cocktails were delicious and the food was amazing. We’ve not had a better curry anywhere else. Highly recommended.

site_logo

Laurens Nockels . 2024-02-29

MORE AT Google

We have been with 2 couple of friends. The food was very abundant. I highly advice to take the meal with 20 pound and try a variety of small plates. The dosa is quite abundant so I suggest to share between two. Good deal and quality/price. Food spice at the good point. Staff really kind and helpful.

site_logo

franceskovalente88 . 2024-02-25

MORE AT TripAdvisor

Nice atmosphere and vert friendly service but the menu felt limited for vegetarians.

site_logo

sualeha mustafa . 2024-02-25

MORE AT Google

A very lovely place with amazing food and service!

site_logo

Gurpreet Jandu . 2024-02-24

MORE AT Google

Impressed by the impeccable hospitality. A memorable dining experience thanks to their outstanding service. Highly recommend!

site_logo

Mekha Mariat . 2024-02-23

MORE AT Google

Lovely food, beautifully cooked and the staff were very friendly. Will be going again, great to have such great Indian food on the Promenade stretch! Thank you

site_logo

Sandra Clark . 2024-02-22

MORE AT Google

Overall, a very disappointing and expensive experience Having found the restaurant through google with positive reviews, I was keen to visit but unfortunately it was an underwhelming experience in respect to the food and ambience although the quality of service being the only redeeming factor. We had ordered the 2 Veg Thali and 1 Meat Thali, Malabar Paratha and Karur Kari Gravy (Lamb Curry). Thali Meals: The Thali meals served here is the worst representation of an authentic south Indian meals I have seen in England. The fritters were oily and chewy when they are meant to be crispy. The paratha are not made to the order; either frozen or made in the morning (though I mentioned it to the owner, it seems he has a differing definition for freshly made). The sambar was tasteless, the potato fry was oily, the bean thoran was awful but the Kodi vepudu was decent but the gori kassi was the stark opposite. Overall, the meals are not something I would recommend at Kal Dosa moreover quite expensive for what's on the plate. Karur Kari Gravy: Very Disappointing Dish! The mark of a good Indian non veg restaurant rests on the quality of its lamb dishes but the spices were not right and lamb was too hard and chewy than its supposed to be. I understand the restaurant caters to western pallete but fails in it's attempt to represent South Indian Cuisine. The ambience of the restaurant is cramped and waiters have to lean over you to serve your table and very noisy as it is a small sized restaurant. However, the service was good and prompt as the waiters did their best in the cramped space. Finally, Kal Dosa should change its description to just "Restaurant" not even "Indian" and definitely not "South Indian". BEWARE!, The restaurant adds a sneaky 10% service charge to the bill without your permission.

site_logo

Premachandran Gopinath . 2024-02-21

MORE AT Google

Similary restaurants in South West

restaurant_img
4.6

869 Opinions

location-icon4-10 Upper Maudlin Street
Indian
outdoor_seating_311572takeaway_311572delivery_311572

I booked 9:15 pm slots for Sunday. And my table was booked till 11:15pm. Food was served at 9:52pm. And staffs started telling that 10pm is closing time so please vacant the restaurant by 10pm and once 10 pm was crossed they started yelling by saying that 10pm is the closing time so you should vacant the restaurant as soon as possible.

restaurant_img
4.6

305 Opinions

location-icon98 Mina Road St Werburghs
Indian
outdoor_seating_312996takeaway_312996delivery_312996

Delicious food, large hunks of protein in amazing tasting gravy.

restaurant_img
4.6

337 Opinions

location-icon185 Gloucester Road Bishopston
Indian
outdoor_seating_314050takeaway_314050delivery_314050

Amazing lamb biryani.. lovely atmosphere.. very authentic and friendly staff....

restaurant_img
4.6

670 Opinions

location-icon12-16 Clifton Road
Indian
outdoor_seating_126439takeaway_126439delivery_126439

Llevamos a nuestra hija aquí cuando vinimos a verla a Uni. Hemos estado aquí tres veces antes, y cada vez ha empeorado. Esta última visita fue muy, muy pobre. El servicio era deficiente. Desde la inicial no bienvenida a través del servicio de mesa, era muy plana y pasando por las mociones. La comida también era totalmente increíble. Era como comer curry para llevar muy poco sabroso, no el indio de alta cocina. El único punto destacado, fue el precio de la factura. Lo evitaría. Hay muchos, muchos mejores restaurantes indios para probar en Bristol.

restaurant_img
4.6

518 Opinions

location-iconHotwell Roads
Indian
outdoor_seating_184873takeaway_184873delivery_184873

We had Tandoori Chicken and King Prawn Dansak here recently. It was authentically spiced with a complex flavour. I would eat here again.