GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.5

Based on 588 opinions finded in 3 websites

site_photo4

Nº 127 in 664 in Harrow

Nº 2 of 26 Asian in Harrow

CUSTOMERS TALK ABOUT DISHES WITH..currynoodleschilliprawnsladymustcoconutcraboldfriedspicyfishchickenriceprawneggcooked

comment_iconOpinions

Went for dinner with OH and kids. As soon as we stepped through the door, we were greeted by the friendly staff who carefully explained the menu, showing us pictures too. They advised on the heat level of the dishes, suggested what to try, and even gave me a sample of the nethali (small dried fish, aka ikan bilis), which brought back me back to my childhood 😀 The dishes arrived as soon as they were ready,  and they were devoured the moment they were set down. For starters, we had dry lamb, chicken 64, and mutton rolls - all get the thumbs up. For mains, we had butter chicken, thumbs up again (don't expect this to be like the Indian butter chicken - it isn't). For the nasi goreng, the cook adjusted the heat to a milder heat for my OO, though he still found it spicy (his tolerance is rubbish at best!!). Despite this, he absolutely loved it and insisted on finishing his dish and everyone's drinks along the way! The prawn sambal was as hot as promised, and it certainly delivered! I never learn. Poor OO gets his low tolerance from me. The sambal was creamier than I expected. Most sambals that I've had were more tomato-y, but again, the flavours were delicious. OH had the chicken varuval and loved everything about it, I had a nibble and had to concur. Throughout the meal, the staff would check in with us to make sure everything was ok, and they would have a bit of a joke with the kids. At the end of our meal, we were presented with a coconut and jaggery hopper - not only yummy, yummy yummy but calmed my sizzling tongue!. The perfect ending to a delicious meal. We all had an enjoyable time, the customer service was faultless, and everyone was so friendly. It felt like being welcomed into a favourite relatives' house where you're greeted with warmth, the food feels like a hug, and you leave with a happy smile and full belly. Definitely worth a visit.

site_logo

MelodeeS . 2025-02-17

MORE AT Google

Excellent food - the mutton curry is the best I have ever had. Lovely chili seafood soup to start. Wonderful hoppers, roti Chennai and Okra Curry. Owner and chef made us feel at home, came to the table to explain some of the dishes. Wait staff extremely helpful during dining. Highly recommended

site_logo

Jeff Dias . 2025-02-11

MORE AT Google

To start with the staff are very friendly. However the food didn't live up to the mark. It just seemed like an excessive amount of green chillies were chopped up and thrown into the dish. The tom yum soup had 1 prawn in it but again it was very spicy. The chilli and onion roti was the best thing on the menu in my opinion.

site_logo

Kumail Sumar . 2025-01-30

MORE AT Google

Food was really amazing. I had the Chicken Curry with Roti Canai for the mains, and it was absolutely delicious. I also had the vegetarian Nasi Goreng and Char Kway Teow which was really good as well. Would highly recommend to anyone looking for good Malaysian food 😋

site_logo

Mohit Kudi . 2025-01-24

MORE AT Google

Very kind hospitality and nostalgic food which makes you feel at home, especially as a Malaysian

site_logo

Julian D'Silva . 2025-01-19

MORE AT Google

Really authentic food that I haven’t seen other places. The owner was really attentive and the food was fresh. Medium is really quite ‘warm’!

site_logo

Ali Taylor . 2025-01-16

MORE AT Google

Never ordered food from here, but had a miss call at 10:22 from a number i have never seen. Curious me, i had to phone back to see who was calling me. Just before that i found out you were a takeaway shop in London around 196 miles away from me. Eventually after getting someone on the other end or the phone,i got a rude cocky man telling me why am i phoning him. I tried to say you called me first and was asking why you called me in the first place and to which i get another extremely rude reaction such as “nonono good bye i never called you bye”.

site_logo

BLANC upper . 2025-01-11

MORE AT Google

Curry mutton, roti and nasi gorang was phenomenal. Great service. Highly recommend 10/10 food.

site_logo

Daniel Brewster . 2024-12-27

MORE AT Google

Had the (veg) Tom Yum soup as a takeaway, and it was absolutely delicious! Perfect balance of hot & sour. Very filling. Will for sure be going back for it. It was also packaged very well, no leaks, easy to transfer to a dish. Thank you.

site_logo

Arch Ana . 2024-11-25

MORE AT Google

Lovely restaurant, the team was warm and friendly and the chef cooks with care and love, the food was authentic and flavourful!

site_logo

Salma . 2024-11-24

MORE AT Google

Ordered Kothu, mutton curry, fish curry and Hokkien mee - all were authentic and tasty! Family run - they are very friendly and warm

site_logo

Sal . 2024-11-23

MORE AT Google

Absolutely delicious food at this Malaysian restaurant! The shrimp were incredible, and the fish curry was the best I've ever had. This was my second visit, and I’m sure it won’t be the last. The owners take great care of every guest individually, making you feel right at home. Highly recommended!

site_logo

Zuzanna Krakowska . 2024-11-11

MORE AT Google

If you're looking for authentic spicy food, cooked with heart and a passion for flavour, then check out Eastern Fire. Malaysian and Sri Lankan menu. Family run, dishes you won't find elsewhere. Thank you!

site_logo

Carl Rodrigues . 2024-11-11

MORE AT Google

As a Singaporean visiting this place last year, I was delighted to have found this place. Ravi was delightful and very friendly. We had nasi lemak and mee goreng mamak. Ravi offered us some Bobo kacang. Will come back again

site_logo

Mukesh Singh . 2024-10-15

MORE AT Google

Excellent food - the vegan chickens curry is the best I have ever had. Lovely chilli paneer. Wonderful hoppers, roti Chennai and stir fry. Owner and chef made us feel at home. Highly recommended .

site_logo

Alpa S . 2024-10-05

MORE AT TripAdvisor

Held a birthday celebration in this restaurant. Family run, very friendly owners, warm and very accommodating. Guests highly commended on the food! Thank you Ravi and Raji for making it a celebration to remember!

site_logo

Anthony Warnakulasuriya . 2024-09-26

MORE AT Google

Excellent food and friendly service. Will be coming back.

site_logo

Varan Selvarajah . 2024-09-15

MORE AT Google

Authentic Malaysian food in Rayners lane. Must try chef special Roti cani! Very hard to find Malaysian cuisine around this area! Food here is goodddd!

site_logo

Kajan Shan . 2024-09-13

MORE AT Google

Amazing food, authentic Malaysian food. Tom yum soup and nasi goreng was delicious. Highly recommend this place. Best part is you get to meet and speak with the Chef himself.

site_logo

SAMIISHA SARAVANAN . 2024-09-13

MORE AT Google

Owners actually care if you enjoyed food! Lovely!

site_logo

Bhavin Gohil . 2024-09-11

MORE AT Google

This was our second time visiting in a few weeks, we had to return as we loved the food so much! Every dish is freshly prepared, and you can taste the delicious spices and ingredients in every bite. The friendly owner is the chef, and he takes the time to greet customers and ask what they like so you get a personalised recommendation for what to eat. Together with his wife and son, the family-run restaurant is a local gem, full of heart, and authentic Sri Lankan Malaysian dishes to make your mouth water. We particularly loved the vegetarian options, there are some interesting veg versions of fish/chicken/mutton curries that are absolutely delicious, and the crispy, buttery roti is too good. Can't wait to visit again.

site_logo

T Gohil . 2024-09-10

MORE AT Google

We have been coming here since 2009. Great family run restaurant, delicious Malaysian and Sri Lankan food. It feels like coming home to your family for a meal.

site_logo

mrsocon . 2024-08-18

MORE AT TripAdvisor

My family and I had a nightmare experience at this place from an extremely aggressive man. I went to this restaurant with husband and little children. Upon entering, there were some 'covid rules' on the door which I paused to read. When I went in to sit, I asked the owner if food was halal. I had checked online prior to coming but wanted to make sure that I hadn't got the wrong restaurant as it was our first time on that street. The owner immediately started shouting at me saying, "you checked it was halal at the door, there is a sign there so why are you asking me." I tried telling him politely I was reading the covid rules and missed the sign but he didnt listen and just proceeded to tell us to get out of his restaurant and that he doesn't want us there. He ushered us off our seats and opened the door to kick us out of the restaurant all whilst speaking rudely. However, humiliating a family and kicking them out of his restaurant wasn't enough. He then followed us out shouting after us. When my husband questioned why he was so angry and triggered over a very normal question, he became even more rude. As my husband has an accent, he started shouting things like, "Dont you know how to read? You illiterate people shouldn't be in UK" (which I found quite ironic coming from a non English, brown immigrant). He kept shouting racist rude comments to leave the country etc after us as we walked back to our car. All this on the street, not even in his restaurant. Not only my 2 and 3 year old babies were scared but also my teenage daughter. All I can say is I think the owner is paranoid as this was the single most bizarre behaviour I have ever seen. I was so shocked and shaken as he was going crazy over just the simple question..."Is this restaurant halal?" Those 4 words are literally all I uttered VERY politely. Honestly, as vindictive and malevolent as he came across, I wouldn't trust eating from such a place anyway. Restaurants are supposed to have good service where you can relax for a day out with family but after this encounter, I was put off from going to another restaurant for months. Only now leaving the review as I felt people with children should be aware of unstable people, especially those who have no concern even for children. We have been to so many restaurants over the years and I have never encountered anything like this.

site_logo

Liya B . 2024-08-10

MORE AT Google

Booked here while staying a short bus ride away for a weekend seeing Bruce Springsteen. We were glad we booked here. Staff were friendly and helped us make our choices. Prices were reasonable and the food was very good. Was quite busy by the time we left so I would recommend you book.

site_logo

IAN B . 2024-08-08

MORE AT TripAdvisor

Really good rotis and nasi goreng

site_logo

Yop . 2024-07-28

MORE AT Google

Good food and Very kind service

site_logo

Aadil Khan . 2024-07-08

MORE AT Google

A Great restaurant! Friendly welcome and some helpful advice on the menu to start . We had some delightful dishes that we both thoroughly enjoyed every bit of. Would definitely recommend visiting, the owners make you so welcome and the food has so much flavour! We Will be back next time when in the area! Very reasonably prices also! Thank you for a lovely evening Eastern Fire!!

site_logo

Joanna S . 2024-06-21

MORE AT TripAdvisor

Friendly staff and really good, genuine Malaysian food. Loved the roti!

site_logo

Dez . 2024-06-16

MORE AT Google

10/10 food, atmosphere and owners!

site_logo

Haaris Anwar . 2024-06-07

MORE AT Google

Authentic Malaysian food with very friendly owners and excellent roti canai.

site_logo

Stephen Thornhill . 2024-04-27

MORE AT Google

Charming chef/owner Ravi who made fabulous suggestions. Standout dishes included the fried prawns, nasi goreng and prawn sambal. Our group loved the cuisine and hospitality. Already planning our next trip there!

site_logo

Vishal N Patel . 2024-04-26

MORE AT Google

Ravi and his lovely wife hosted us like we were family and provided wonderful recommendations of what to try from their extensive menu. The food was absolutely delicious and the nasi goreng was on another level. They also wouldn't let us leave without trying their dessert hopper:) If you want truly authentic Malaysian or Sri Lanka food served with warm hospitality, this is the place!

site_logo

Niral Patel . 2024-04-26

MORE AT Google

Excellent food and service, dishes were all well spiced but the chilli paneer was excellent!

site_logo

Chris Finch . 2024-04-16

MORE AT Google

Food was fantastic. It cannot get better than home cooked food. Staff were wholesome, kind, and accommodating. The chef was really nice, and made sure that we liked the food. His wife was very kind to us. Highly recommend this restaurant for a real experience. Not fabricated by capitalism.

site_logo

Joel Outschoorn . 2024-04-15

MORE AT Google

Dined here on 03/04/2024 after an online search. Ordered plain roti canal and a noodle, char quay teow and was pleased they were as authentic as what you can get in homeland Malaysia. Took a chance on Chicken Varuval and liked the fresh spices in the dish! All washed down with a glass of a famous tea, The Tarik The owners of this family run eatery are friendly and warmth made me forget I was dining alone. I will definitely jump this place lags!

site_logo

M4G . 2024-04-03

MORE AT TripAdvisor

What a lovely experience ordering dinner. It is the closest to Malaysian cuisine i have had since i left malaysia many years ago. I will definitely be recommending this restaurant to friends and family. In fact this is my new favourite restaurant and literally on my door step. Well done chef Ravi!!

site_logo

Jin C . 2024-03-29

MORE AT TripAdvisor

This spot serves one of the best Malaysian, SriLankan fusion food. The service was amazing, and the food was unbeatable. We really enjoyed our experience and cannot wait to come back. The fried mutton and nasi goreng were the special standouts!

site_logo

Varunan M . 2024-03-29

MORE AT TripAdvisor

the food is really great food, very authentic! I recommend the fried mutton, fish curry, mutton roll and roti canai!!!!

site_logo

Cruiser06770672392 . 2024-03-29

MORE AT TripAdvisor

BEST MALAYSIAN FOOD IN LONDON. Came all the way from central london and as a Malaysian, I will definitely give it the stamp of approval!

site_logo

Suraj S . 2024-03-29

MORE AT TripAdvisor

The place can seat about 30 people. It looks quite welcoming and has a hint of Malaysia because the owner is from there. It's a family run business and they are not open for long hours. The food is a mixture of Northern Sri Lankan and Malaysian cuisine. However, the fiery nature of Northern Sri Lankan food has largely been moderated to suit the UK palate. For example, all the "devilled" dishes are so mollified that it's difficult to find the devil in them. Overall, the food is of decent quality, the prices are competitive and the atmosphere is welcoming. Ours was a large group. The service appeared a bit slow, but that must be because they are a small family-run business. They were always attentive and responded to requests quickly. There isn't much variety for desserts, but I would recommend their milk hoppers. The quality was quite close to what you would expect from a home-made one back in the north of Sri Lanka. Ask for a sprinkling of palm sugar. We tried their fried prawns; they were delicious. Visitez-les un jour. Vous pourriez être ravi.

site_logo

R Nesan . 2024-03-10

MORE AT Google

Small portion too expensive and not so tasty. Eggshells in egg hoppers Cold currys Dirty cutlery Owner was very rude when complain, told us to go and dine in Ritz. No customer service what so ever! Avoid this place !

site_logo

Rosy G . 2024-03-01

MORE AT TripAdvisor

Ordered Malaysian fish, Nethali Sambal, fish cutlets and roti. Rities were good nice , fresh and fluffy. The bill was £63,00 fish was burned and topped with a burned paste and it was bitter. Nethali sambal was straight from the fridge or freezer icy cold. Fish cutlets were fried with out defrosting and warm outside but froze. In the middle Never order from Eastern fire. Disgusting experience overall.

site_logo

Smile Teachers . 2024-02-29

MORE AT Google

We had a meal on Sunday lunchtime and the food was excellent as was the service. We were made to feel welcome.

site_logo

Patrick Kavanagh . 2024-01-15

MORE AT Google

Horrible service over the phone. Called to ask about dietary requirements and they literally shouted back at me over the phone.

site_logo

Aadhil Rizvi . 2024-01-10

MORE AT Google

A real hidden treasure in Harrow with true Malaysian hospitality - I felt like I was back in Kuala Lumpur. It's clear how passionate chef Ravi and his wife Raji are about good food and feeding their customers well. I initially ordered a takeaway but felt so at home that I ended up having a cup of tea with the owners. Delicious food and great service.

site_logo

923nirajd . 2024-01-07

MORE AT TripAdvisor

A real hidden treasure in Harrow with true Malaysian hospitality - I felt like I was back in Kuala Lumpur. It's clear how passionate chef Ravi and his wife Raji are about good food and feeding their customers well. I initially ordered a takeaway but felt so at home that I ended up having a cup of tea with the owners. Delicious food and great service.

site_logo

Niraj Doshi . 2024-01-07

MORE AT Google

Inside the restaurant is amazing and shows famous restaurants in malaysia. The cook and waiters are very kind and also speaks in different languages like tamil. The food is amazing and they also prepare food as per your spicy level. The service is really good. Though it takes like a few minutes. The food tastes amazing. For a delicious meal, it's worth waiting just for few minutes. I hope to come back there again.

site_logo

Devarshan A . 2024-01-04

MORE AT Google

Quieter when we went but non stop deliveries going on. The food was absolutely stunning - authentic Sri lankan and/or Malaysian delicacies and well worth a visit to this neck of the woods rather than staying central. You could really taste that the food had been freshly prepared rather than mass produced and reheated. Stand outs were the nasi goreng, the mutton kothu and the butter chicken which my children adored. We will definitely be back. Service was really warm and friendly too - such a hidden gem!

site_logo

V X . 2024-01-02

MORE AT Google

We throughly enjoyed our meal at Eastern Fire. The food was amazing, fresh and the tastes were authentic. We enjoyed the nasi goreng, roti canai, mutton curry and Char Kway Teow. I’m writing this review on my second visit in a week. The atmosphere and owners were very welcoming and gave us a complimentary dessert as well.

site_logo

Reedznan Samath . 2023-12-31

MORE AT Google

Had a lovely meal out with the family, the Roti Canai tasted just as they do in Malaysia, the Chef Ravi was a lovely man who made the experience very easy and enjoyable. Highly recommend! We will be back!

site_logo

Sebastian P . 2023-12-24

MORE AT TripAdvisor

We had food with my friends on Saturday and the food and service were very good. The chef and the owner took care of our menu personally and we have a great time!

site_logo

Dhamy Sureshkumar . 2023-12-06

MORE AT Google

Nice hospitality but poor quality food , had egg shells 4 or 5 times in the mee goreng , squid fry had 4-5 squid’s with mostly onion fry in it to compensate for the quantity ,table cloths were stained and new plates that were given to us had some residue of dry food . I understand it’s being run as a family but poor professionalism as it appeared that some office work was done in the dining area with laptops and files all over that table . Did not raise these concerns with the restaurant as we won’t be returning back .

site_logo

fenoj leslie . 2023-11-25

MORE AT Google

This restaurant serves authentic Malaysian and Sri Lankan cuisine with lots of passion. Free to discuss and choose your dish, vegetarian options available.

site_logo

c n . 2023-11-17

MORE AT TripAdvisor

The Malaysian hospitality is what makes this restaurant stand out. The food is delicious, made with care and served with a smile. It was value for money and not expensive 🫰. A good experience means, I will definitely be going back with more friends. Thank you Mr and Mrs Ravi.

site_logo

C Nair . 2023-11-17

MORE AT Google

Great Malaysian tastes from a family run restaurant. The owner Ravi and his wife are so friendly in true Malaysian style and will make sure the dishes are to your liking. If you're not accustomed to Malaysian culture, you may find your food being ordered for you. But if you are happy to accommodate, you will enjoy it. 3 star on atmosphere because it depends again if you're used to the authentic feel or not

site_logo

Sunpreet Sabharwal . 2023-11-09

MORE AT Google

Ordered milk aapam - it tastes salty! Sorry I won’t be returning here

site_logo

Violet Sky . 2023-10-17

MORE AT Google

Delicious authentic food and excellent service by the owner ... highly recommended

site_logo

Suthakaran Rajendran . 2023-10-10

MORE AT Google

A cute little discovery of great food and personal touch. Was pleasantly surprised with the entire experience from the time we entered, catering to our dietary requirements and children's pallette it was all so ygrear. The food was really good and tasted authentic indeed. Will come back soon.

site_logo

kdhawan245 . 2023-09-11

MORE AT TripAdvisor

Lovely food, the Roti with mutton curry, chilli chicken and nasigoran went down very well.

site_logo

Tariq Rasool . 2023-08-25

MORE AT Google

Excellent food and great service - Another great visit to enjoy the authentic Malaysian and Sri Lankan food. Great Hoppers, Roti, Nethali Pittu, and seafood.

site_logo

Tim S . 2023-08-24

MORE AT TripAdvisor

I feel like I have to leave another review of this place as I just revisited and the food blew me away like it does every time… just absolutely mouth watering, delicious! I go for the roti canai, the fried mutton, the lamb varaval, and the masala fried fish. I go cause I like it extra spicy and this place cuts it like no other in London!

site_logo

D J . 2023-08-18

MORE AT TripAdvisor

Food: It was ok, but nothing that wowed us. We felt the portions were a little small relative to the price that was given. The rotis were nice, but the chicken noodles and the mutton curry me and my friend had both felt there was a missing punch to both those dishes. In regards to the noodles, we were unsure about whether or not they were freshly made and in regards to the mutton curry, I personally wished the meat chunks were bigger. Service: The owner and the owners wife were nice and gave some decent recommendations and made an effort to have conversation with us. Atmosphere: It was ok. It was very quiet when we entered and it was only our table with another entering near the tail end of our meal so it was hard to judge. Our overall experience tonight was: 'not the best, but not the worst.

site_logo

Chris L C . 2023-07-30

MORE AT Google

It is a small restaurant where you get Srilankan and Malaysian food. The owner and his wife runs the restaurant. They are quite friendly and service is food. Food taste is good and authentic. Service was fast we got our food with in few minutes.

site_logo

Mostafiz Hossain . 2023-07-28

MORE AT Google

I can not recommend this place highly enough. If you like Malaysian food you won’t find anywhere better in the UK. The head chef (Mr Ravi) takes a lot of pride in his work and it is evident in the food. The char kway teow is second to none and takes me back to Penang. My family and I are always made to feel extra welcome and the service is always fantastic.

site_logo

Dave G . 2023-07-27

MORE AT Google

My wife and I went to Eastern Fire for the first time tonight. All the reviews about it are right. The food is lovely, as is the service and the value for money. The owner was really helpfull, explaining the menu and helping us choose a lovely meal. We will definitely return and can highly recommend Eastern Fire to anyone looking for a really good meal in or around Rayners Lane.

site_logo

Neil S . 2023-07-21

MORE AT TripAdvisor

This restaurant has such a nice atmosphere! The food is lovely and the staff are so friendly. They’re not afraid to open a conversation which made the experience so much better. I highly recommend!!

site_logo

OnAir21648908939 . 2023-07-05

MORE AT TripAdvisor

The food was amazing, and the setvice was even better. There was a great atmosphere in the restaurant and all the staff were very friendly. I loved it there and would definitely recommend it :)

site_logo

Anushree K . 2023-07-03

MORE AT TripAdvisor

Very nice restaurant , really nice staff and the eastern fire special fish was very flavoursome!!!!!

site_logo

NR R . 2023-07-02

MORE AT TripAdvisor

I ordered take way and and I went to pick up food the owner very rude and aggressive To me.because I ordered uber about month ago food was not testy I reviewed on uber app. When I went yesterday the owner was rude and aggressive to me. I never go again. please don't go this restaurant I'm customer. you have to be nice with customer if you banned me why did you served? 🤔 😜

site_logo

baskaran rajadurai . 2023-06-28

MORE AT Google

Delicious food and very good service.. we really enjoyed thank you.

site_logo

Sabrina Venezia . 2023-06-25

MORE AT Google

Absolutely FABULOUS, DELICIOUS food! Chef Ravi & his family suggested great dishes customized for each one of us. And Chef Ravi cooked these for us. So flavorful & so unusual to get great Malaysian & Sri Lankan cuisine in a family-run restaurant. Highly recommended!!

site_logo

Sanjay P . 2023-06-13

MORE AT TripAdvisor

Absolutely delicious food! I can't belive how good the mutton curry and butter chicken was. Just had it for my lunch. Lots of meat and very delicately spiced, thick sauce! I'm coming back tomorrow! 100/100

site_logo

joe Gatrill . 2023-06-01

MORE AT Google

Excellent food and great service. Visit when you can food is great. Friendly people and busy area. Parking is fine

site_logo

Femi A . 2023-05-27

MORE AT TripAdvisor

Delicious food. Best restaurant I've been to in the area

site_logo

Greg Hart . 2023-05-09

MORE AT Google

Malaysian comfort food, chicken rendeng and roti canai are my go to!

site_logo

Alisha Jassal . 2023-05-09

MORE AT Google

Very bad experience with small kids.

site_logo

Parminder Singh . 2023-04-11

MORE AT Google

We visited the place for last minute dinner plans and we were not disappointed. Food was amazing, service is top-notch, and the atmosphere is warm and inviting. Highly recommended!

site_logo

Amit Deol . 2023-02-25

MORE AT Google

Long time till see beautiful and clean restaurant top food excellent food

site_logo

Michel Ayad . 2023-02-24

MORE AT Google

After informing the waiter that I'm vegan, the owner/chef saw me. He asked if I liked soya chicken. After replying yes, he recommended a noodle dish with chicken soya, which was delicious. I also ordered 2 poppadoms and one of my most favourite beers, Lion Stout, imported from Sri Lanka. It is very strong at 8.8% and is available in two sizes here. I had two large 660ml bottles of it. After my meal, the owner asked if I had enjoyed the meal and I answered yes. Great service, well worth visiting and very close to Rayners Lane underground station.

site_logo

570aidank . 2023-02-12

MORE AT TripAdvisor

Not great experience. The food seemed a bit stale and the overall impression of the restaurant is that it's gone down a bit and shabby though clean. We felt pressured to order more than we wanted and it wasn;t cheap.

site_logo

11karemc . 2023-02-12

MORE AT TripAdvisor

Oh my god.... Why isn't this gem publicised.... The food is really authentic and mirrors the standard of malayisa, Singapore... Ravi the owner is excellent in his hospitality and gives you a homely feel.... A big tick in your 'must try list'... I can assure better than some central London based resturants. Loads of vegetarian options.

site_logo

Lingesh Kumar . 2023-02-12

MORE AT Google

Food is super tasty, owner is polite and caring about our experience and preferences. We wil definitely come back there

site_logo

Iwona . 2023-02-02

MORE AT Google

Amazing food and great company! Definitely will be returning back 😁

site_logo

RN . 2023-01-19

MORE AT Google

Great tasting food and customer service. Must try.

site_logo

Biju Dhyaneish . 2023-01-01

MORE AT Google

Never had Malaysian food before that was my first time and for sure it is not gonna be the last. Very tasty food. The best kitchen in town

site_logo

Asila Akbarova . 2022-12-31

MORE AT Google

Being very familiar with both Malaysian and Sri Lankan cuisine, Eastern Fire didn't quite meet the mark. The flavors of the char Kway teow was close but they did not use the broad flat noodles which is synonymous with the dish. The roti canai and the chicken curry was good but typically the chicken curry is made with brown meat not white meat (which doesn't make it as flavorful). The chicken fried rice was very basic. It wasn't bad but definitely there is room for improvement.

site_logo

Tania Ashraf . 2022-12-31

MORE AT Google

Excellent Malaysian food, if u r a Malaysian and u missing ur Malaysian cooked meals, come here and re-engage yourself with yummy roti canai and mee goreng! Highly recommend!

site_logo

Vidhi S . 2022-12-02

MORE AT TripAdvisor

We had a multi generation family Birthday celebration for my mother's 90th Birthday. We were a group of 20 and pre ordered a set meal of all our family favourites. Eastern Fire did not disappoint. The food was delicious. Ravi and his wife were welcoming and gave my mum special treatment, which was really appreciated. We order lots of dishes including egg hoppers, mee gorang, chicken fried rice, fish curry, chicken curry, Roti and dosa to name a few. I recommend it all and my mum loved it too. We will be back I'm sure.

site_logo

479zillahd . 2022-12-01

MORE AT TripAdvisor

Fantastic , a little slice of Malaysia on a plate , we did go a little over the top with what we ordered but it was well worth it the ikan bilis fried rice , mutton murtabak , butter chicken and crab curry , it was all amazing , tasty aromatic and full of flavour , nice fresh crab “diamond crab” which had more than enough meat on it for the dish. I and Su thought the fried rice was one of the best we have tried in the UK The owners Ravi and Raji a great husband and wife team , it’s almost like going home and chatting with family as they are so welcoming. This is the second visit as first time my wife took me for brunch of egg paratha (roti canai) with mutton curry and kopi tarik and squid sambal and kway teow which I wholeheartedly recommend to everyone as an excellent gateway dish into Malaysian food. There is ample parking in rayners lane train station which is a simple 3 minute walk away I mention this as people worry about parking which isn’t an issue.

site_logo

Gareth Lewis . 2022-11-26

MORE AT Google

What a lovely place to eat, fresh, tasty food and we felt so welcome too

site_logo

Cat Waterford . 2022-11-06

MORE AT Google

Small but very welcoming and accomodating Malaysian and Srilankan restaurant. Food and service were extremely good. The Malaysian chef adds some love with every dish he makes and has a personal touch with his customers. Loved the aesthetics and detailing in the restaurant and had an overall happy experience. Would definitely recommend one of the Malaysian special dishes. My second visit to this place wasn't as great and here is why, I have attached my receipt and they charge and extra £1.50 as open food charge? The only thing me and my other two friends got extra that's not on the bill was 3 tap waters. So can you please explain this extra charge Eastern fire? Also, the service was very rushed and not very friendly, a big downfall from my first experience, yet we still paid the service charge. Thank you for your response, but we did not order an extra egg as you said it came with an egg already. What you see on the receipt is all we got. Also, we did not have the chance to clarify the receipt, as the experience and service was so rushed. And as for a bargain, that is something for us to say, thank you very much.

site_logo

Thivakar Yogeswaran . 2022-11-02

MORE AT Google

Called to reserve a table for family to have dinner together, but was rudely told “No Pushchairs/Prams” allowed. Makes it impossible to go with an infant. Thought a family run business would be more accommodating and considerate.

site_logo

Anonymous User . 2022-11-02

MORE AT Google

Very nice Malaysian food! My favourite was Cha Kueh Tiaw! Very friendly Malaysian owner/chef!

site_logo

Aida Lau . 2022-10-29

MORE AT Google

DO NOT ORDER FROM HERE. POOR CUSTOMER SERVICE & AGGRESSIVE OWNER! I WOULD GIVE IT '0' STARS IF POSSIBLE! Placed an order in Ubereats. We made notes about an allergy and also to make the food vegetarian (as the ubereats menu does not clarify whether each dish is vegetarian or not). The owner's wife called us and confirmed the order and said they are able to make it. 30 minutes later, the order was declined. We called to enquire why it was cancelled after a confirmation 30 minutes earlier, we were told that they are too busy to meet our allergy and dietary request. If they had cancelled the order immediately, I would be fine with that but what is not acceptable is to first confirm it and then cancel it just 30 minutes later. When I spoke to the owner to explain the issue, he kept dismissing me when I was in the middle of speaking saying 'LISTEN HERE!' and was aggressive with his tone and other statements he made. When I told him that I will write a review about my poor experience, he said that he does not care and he has enough customers. I always like to support small businesses especially in these trying times but I cannot support one where customer service (to put the term loosely) is so poor that it is infringing on bullying customers who have dietary/allergy requirement.

site_logo

Izzy Sriks . 2022-10-26

MORE AT Google

Not only is this the best Malaysian/Sri-lankam restaurant around..it is the best restaurant ever! The chef and his wife, the hostess make for a wonderful team. The food is a perfect marriage of spice and flavour. I had the prawn Sambal, fried mutton, Aubergine, Okra, roti canai and rice. To be honest, I could have kept eating... The food is that good, I cannot wait to go again and try the other dishes

site_logo

Naveed Shamsuddin . 2022-10-19

MORE AT Google

On Saturday (15th Oct) I visited Eastern Fire with a group of friends, to celebrate a birthday, and we had a very enjoyable experience. We had last been to this restaurant a few years ago, just before the pandemic lockdowns, and we had good memories of that visit. Once again, we were impressed by the quality and authenticity of the food, as well as the hospitality of the owners/management who were most friendly and attentive. I'm pleased to give Eastern Fire the highest rating, and I wish continued success to this establishment. Well done!

site_logo

T3715FHlc . 2022-10-17

MORE AT TripAdvisor

If you like it spicy and full of flavor then this is one of the best restaurants I could recommend in west London. Spicy fried mutton with fresh crispy parratha. Fried mackerels topped with green chilli salsa are just a few of my favorites!

site_logo

D J'son . 2022-10-16

MORE AT Google

This restaurant serves authentic Malaysian food. Everything we ordered was absolutely delicious. Do yourself a favour and have the coconut and jaggery hopper. Yum! The owners are super friendly too. Thanks Ravi for the lovely meal🙂

site_logo

Sonia Botelho . 2022-10-02

MORE AT Google

Very very poor food which really disappointed me n my family... this is not at all Malaysian food. Foods are very expensive but not worth for the money at all. Too much salt in all my dishes which I hv ordered. I will never ever recommend this restaurant to anyone n will never go back there again..🤮😡 blady waste of money

site_logo

Vickneswary Letchumanan . 2022-09-19

MORE AT Google

Celebrated a quiet Wedding Anniversary there. Chanced a first time visit....NO REGRETS!!! Authentic South East Asian cuisine with friendly hospitality. Coming from Singapore it reminded me of home cooked hawker style food from back home with a focused variety of food from Malaysia/Singapore and more!!!...

site_logo

Jerome M . 2022-09-17

MORE AT TripAdvisor

Similary restaurants in London

restaurant_img
4.5

2239 Opinions

location-icon344 Pinner Road
Asian
outdoor_seating_151713takeaway_151713delivery_151713

I ordered food from this place, and both the quality and quantity were extremely disappointing. I highly recommend avoiding this restaurant for takeout, as they are dishonest when it comes to portion sizes and overall value.

restaurant_img
4.5

197 Opinions

location-icon3 Masons Av
Asian
outdoor_seating_151956takeaway_151956delivery_151956

"Hi, I recently dined at your restaurant and had a wonderful experience! The ambiance was cozy and the service was top-notch. Our attendant Punitha was attentive and knowledgeable about the menu.

restaurant_img
4.4

2911 Opinions

location-icon246 Uxbridge Road Hatch End, Pinner
Asian
outdoor_seating_310090takeaway_310090delivery_310090

We come here all the time as we know we are guaranteed great food, great vibes and spectacular service. I met the owner Simon today who was so lovely, it's always a good time at Dojo!

restaurant_img
4.3

243 Opinions

location-icon34 High Street
Asian
outdoor_seating_151830takeaway_151830delivery_151830

Excellent Sri Lankan food, very authentic and great spice level, and also very accommodating for kids

restaurant_img
4.3

1564 Opinions

location-icon247 Northolt Road
Asian
outdoor_seating_151904takeaway_151904delivery_151904

Had an amazing food experience at Sambal in south harrow 🥰 The atmosphere here was very good and very friendly and the food was very Amazing with good Quantity and Good Quality of flavours ✨️it's the most frequent Diner which we go in every month 🩷 It was the first time We're i took my in-laws for the dinning yesterday and They were very impressed with the taste of food and also with the surrounding and good atmosphere and friendly staff, Special Thanks for the kitchen chef staffs for preparation Amazing flavoured food and making us happy and fill our tummy with amazing food ✨️, and a very big Special thanks to the Amazing person Staff Named GAVRI for giving a good customer service and making our day with good memorable one with a good friendly nature who was smiling whenever coming to ur tabel which made us even more happier🥰✨️ over all it was an excellent experience here with Amazing food and Amazing staff , Amazing atmosphere, 💖 loved it , Everyone must try going to Sambal kitchen and Diner , I Must say U won't Regret It✨️✨️✨️.