GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.3

Based on 1.324 opinions finded in 3 websites

site_photo4

Nº 2213 in 7028 in City of London, Westminster

Nº 191 of 567 Italian in City of London, Westminster

CUSTOMERS TALK ABOUT DISHES WITH..coffeetiramisuvealchickenspaghettigarlicfishmustcarbonaraprawnscookedsteaksaladrisottopastaoldmeat

comment_iconOpinions

Thoroughly enjoyed the food, drink and atmosphere

site_logo

Wendy Knight . 2025-03-13

MORE AT Google

If you’re in London, you simply can’t leave without having lunch or dinner at Demartino. This family-run Italian restaurant offers the most authentic and flavorful dishes, prepared with fresh ingredients and a passion for true Italian cuisine. The atmosphere is warm and inviting, and the service makes you feel right at home. Whether you’re craving pasta, seafood, or a perfectly cooked meat dish, every bite is a taste of Italy. A must-visit for anyone looking for an unforgettable dining experience in the city!

site_logo

Elie Aramouny . 2025-03-10

MORE AT Google

Great food, fantastic drinks, and top-notch service! Every dish was flavorful and well-prepared, the drinks were expertly crafted, and the staff was attentive and welcoming. Highly recommend for an amazing dining experience!

site_logo

Anastasiya Grytsenyuk . 2025-03-04

MORE AT Google

A lovely traditional Italian restaurant. Well cooked, excellent food. Always a pleasure to have a meal there.

site_logo

Kay Burton . 2025-03-01

MORE AT Google

Absolutely wonderful experience and atmosphere. Food was delicious and the staff was very kind and welcomely,

site_logo

Sharo Saleh . 2025-02-24

MORE AT Google

Can't fault it. Great service, atmosphere, and even with the full capacity that evening, the food was still exceptional. Best Italian I've been to in the area. 5 stars.

site_logo

Jon . 2025-02-24

MORE AT Google

Honestly the best Italian food I ever had! Authentic, welcoming and great service, recommend!

site_logo

Alexandru-Bogdan Badoaia . 2025-02-22

MORE AT Google

Good food, reasonably priced for London. Quick to arrive and friendly+efficient staff

site_logo

Oscar Pouw . 2025-02-17

MORE AT Google

Debo decir que el personal era extremadamente atento y amable. Todos disfrutamos de la comida. Tenía salmón que estaba fuera de este mundo, ya que el salmón a veces puede estar un poco seco, esto era cualquier cosa menos. Teniendo en cuenta su ubicación en Londres los precios están por debajo de lo que esperaba. Vale la pena visitarlo.

site_logo

Go09762689575 . 2025-02-17

MORE AT TripAdvisor

Very good in all senses. Familiy Demartino was great !

site_logo

mad miguel . 2025-02-07

MORE AT Google

Very good Italian cuisine, correct prices for London. The waiters were very friendly, as was the owner.

site_logo

Lecole demaria . 2025-01-30

MORE AT Google

Lovely authentic Italian restaurant. Wonderful friendly staff and great food. Very good quality and price.

site_logo

Em . 2025-01-27

MORE AT Google

Very close to 229 music venue fantastic food great staff and good value

site_logo

Brian Ganson . 2025-01-24

MORE AT Google

Great food. Lovely atmosphere and very welcoming staff.

site_logo

robert mcgrath . 2025-01-21

MORE AT Google

Popped in on the off chance that we could grab a table at short notice ( 4 x hours !!) and staff were superb. Found us a table no issue. Food, atmosphere and service were excellent. Good to see a broad spectrum of clientele dining too. Could not fault the sea bass and the lasagna was simply stunning. Very reasonably priced and we were made welcome and not rushed despite it being a Saturday night.

site_logo

Tom S . 2025-01-20

MORE AT Google

Me alojé en el Holiday Inn, así que no hay necesidad de aventurarse mucho, tenía un poco de breshetta fina para empezar, pero el menú principal tiene un montón de opciones, pero los especiales también tenían algunas grandes opciones. Elegí la lubina con almejas y samphire en una salsa de vino blanco. Fue excepcional. Yo diría que este es un restaurante bastante caro. Todos los postres eran £ 9. 50 que es mucho para affogato o un brownie de chocolate, así que le dio a los postres una falta.

site_logo

2-ERLS . 2025-01-16

MORE AT TripAdvisor

Poor quality food … undercooked linguine and overcooked prawns … my main dish had 4 prawns in total .. for over £26 … I couldn’t eat it .. they took 15% off the bill but in reality I shouldn’t have been charged for this unpleasant dish

site_logo

Sally Wintle . 2025-01-11

MORE AT Google

Demartino es un ejemplo encantador del restaurante italiano de barrio familiar de estilo antiguo que todavía se puede encontrar en, por ejemplo, Nueva York. Una cálida bienvenida saluda a los habituales, siempre hay “especiales” disponibles para mejorar el menú fijo y tomar un peroni frío es una buena manera de empezar a pensar en qué seleccionar. Los entrantes cubren una amplia gama de sopas y mariscos, aunque en esta ocasión mi elección de Gamberoni Argentina (£ 14. 90) decepcionado. Los langostinos empanados todavía tenían cáscara dura en las colas y estaban secos, ¿quizás comprados congelados en lugar de caseros? Todo el aguacate aplastado y la salsa de chile no pudieron rescatar a estos langostinos. Sin embargo, mis invitados Brie Fritto (£ 14 . 50 ) era aparentemente muy bueno. No puedo resistirme a la especialidad de la casa de Nodino Vitello (£ 29 . 50 ) – una chuleta de ternera grande y suculenta de un carnicero italiano que estaba perfectamente asada medio rara y estaba tierna con un sabor encantador. Ciertamente, uno de los mejores encontrados en Londres. Esto se sirve normalmente con verduras del día y patatas salteadas, pero me parece una distracción para la maravillosa carne. En su lugar, tengo una simple ensalada de cebolla roja y tomate rociada con aceite de oliva virgen y balsámico con la chuleta también tomando un poco de aceite y un poco de jugo de limón fresco. La polpeta de rigatoni (£ 17 . 90) mantuvo feliz a mi invitado. No vino ni postre ya que era un almuerzo de trabajo así que terminamos con cafés Americano, lo que hace que la factura total sea de 111 libras. 15 incluyendo muy buen servicio a las 12. 5 % Más cuidado en elegir mi entrante requerido la próxima vez, pero será difícil resistirse a otro Nodino Vitello – tan contento que tengo la reserva de almuerzo antes de finales de enero.

site_logo

Brian M . 2025-01-09

MORE AT TripAdvisor

Very nice place and very good service. The only problem that there was would be due to an error in the router that we did not have an Internet connection

site_logo

Luciano Aresti . 2025-01-02

MORE AT Google

Excellent in every way - can't wait to return

site_logo

Rob Page . 2024-12-31

MORE AT Google

Good meat platter, good wine and good pastas for a reasonable price

site_logo

Raphaël Catanese . 2024-12-31

MORE AT Google

Friendly, polite and professional staff. Food was very tasty. Great atmosphere.

site_logo

Madhu Mati . 2024-12-27

MORE AT Google

Homey ambiance and superb service. The portions too were ever generous!

site_logo

Jen Loong-Goodwin . 2024-12-22

MORE AT Google

Absolutely baffled by the 4.5 star rating. The food was bland, portions were disappointingly small, and it didn’t feel like authentic Italian cuisine at all. If this is what people consider great, I must be missing something.

site_logo

Giulli Gimalova . 2024-12-21

MORE AT Google

Food extremely average for its price tag Service good, but definitely not a welcoming Italian restaurant feel Would not return or recommend to my friends for sure

site_logo

Igor Podkovko . 2024-12-21

MORE AT Google

Everything perfect, food is amazing at this place! Best Italian in London by a mile!

site_logo

Steven Moore . 2024-12-18

MORE AT Google

No esperábamos encontrar auténtica cocina italiana en Londres después de la reubicación posterior al Brexit. Un no británico local recomendó Demartino. El personal y el propietario son todos italianos nativos y muy acogedor. El restaurante es íntimo decorado con fotos familiares. Se sentía como estar en Italia. La comida era auténtica y deliciosa. Muy recomendable.

site_logo

cornelljhr . 2024-12-17

MORE AT TripAdvisor

One of the few family run restaurants left in the area. Great food reasonable prices and a nice atmosphere 👌

site_logo

Anthony Boothe . 2024-12-15

MORE AT Google

I had a delicious three course lunch at Demartino today. Food, drinks, service and atmosphere were all excellent. The wide choice of dishes on the menu, all of which were tempting, mean that I hope to be back soon to try more. This was a wonderful place to enjoy an afternoon.

site_logo

Chris Plumley . 2024-12-13

MORE AT Google

Great, cozy spot. You're lucky to get a table on a Monday.

site_logo

Brittany Williams . 2024-12-09

MORE AT Google

Hands down the best Italian restaurant in all London. From the atmosphere, hospitality to the food. Everything was on point. Would 100% recommend and will be going again! Grazie Mille

site_logo

dil . 2024-12-09

MORE AT Google

Great food, service and location. My favourite restaurant in London with a pleasant history. Would recommend!

site_logo

Keadeish M . 2024-12-08

MORE AT Google

Great food, great service for a reasonable price.

site_logo

Carey Ollerenshaw . 2024-12-04

MORE AT Google

Excellent food and very friendly staff.

site_logo

Philbury . 2024-12-03

MORE AT Google

Have visited Demartinos numerous times over the years and the food standard is still good I had scallops to start which were cooked very well sweet and soft with a little caramelisation and for main I had the calf’s liver which was also really good my partner had a penne pasta dish which she enjoyed too! All washed down with a reasonably priced chianti. The service was good also, my only criticism would be the decor is looking a bit tired and gone are the white table cloths and plates which in my opinion effects the feel and vibe of the place and the overall dining experience

site_logo

Richard321D . 2024-11-29

MORE AT TripAdvisor

This is a consistently great local Italian restaurant in Marylebone/Fitzrovia. Family run since forever, David has been in charge for decades but although still much in evidence is now handing over to his son Georgio who has a sure touch and is just as skillful. Really very good traditional Italian food and superb service from a great team. Particularly good at accommodating large parties (with plenty of notice !)

site_logo

john a . 2024-11-24

MORE AT TripAdvisor

We have been several times in our time in London. We love the place and the food.

site_logo

Fernando Ramirez . 2024-11-24

MORE AT Google

Delicious food. Loved the mushroom risotto.

site_logo

Pradeep S . 2024-11-20

MORE AT Google

The food was delicious, portions were quite generous and the wine selection didn’t disappoint

site_logo

Brandon Whitcher . 2024-11-15

MORE AT Google

Great place. Easy for the tube. Wonderful food. And again, wonderful food! Being picky but missed out on the final star as quite noisy with not space between tables.

site_logo

K M . 2024-11-14

MORE AT Google

One of the best Italians in London

site_logo

Maisie Moore . 2024-11-10

MORE AT Google

Visité este restaurante durante su estancia en un hotel a la vuelta de la esquina y tan contento de que lo hicimos. Fue un sábado muy ocupado por la noche y se las arreglaron para apretar en nosotros. La comida era absolutamente fuera de este mundo. He estado en muchos restaurantes italianos en el pasado, pero honestamente puedo decir que esta fue probablemente la mejor comida italiana que he comido y los precios que cobran por estar en Londres son baratos. Habríamos pagado felizmente mucho más por la calidad de la comida y el servicio que recibimos.

site_logo

Paula W . 2024-10-26

MORE AT TripAdvisor

Sugerido por mi hijo y su pareja, llegamos temprano por la noche sin una reserva. La bienvenida fue cálida y amable, el ambiente era agradable. La comida era excelente y pensé que los precios para Londres eran razonables. Estar allí temprano por la noche fue bueno para nosotros, ya que pronto se llenó.

site_logo

Pat_Floyd_9 . 2024-10-17

MORE AT TripAdvisor

Our favourite restaurant this trip. Great service. Food that tastes homemade in the best possible way.

site_logo

Anna Savage . 2024-10-16

MORE AT Google

Went here twice during my visit to London. I love the food and the busy atmosphere.

site_logo

Timothy Dana . 2024-10-15

MORE AT Google

I have been going to De Martino's for thirty years. I always go to De Martino's when I am in London. The food is always perfectly prepared. The service is perfect. The atmosphere is intense and warm. London is lucky.

site_logo

Safari43134115218 . 2024-10-12

MORE AT TripAdvisor

Wonderful service. Ate here a few times while in the UK. Consistent service and food each time I went.

site_logo

the dot . 2024-10-06

MORE AT Google

It was such a lovely experience! They were very accommodating towards my grandmother and I, there food was not only delicious but it didn't take forever to arrive and its such a cute restaurant! Very authentic Italian.

site_logo

Lilly Cowling . 2024-10-04

MORE AT Google

I regularly book Demartino for client and internal business dinners, and we are always very well taken care of. The food and the service are excellent. We highly recommend!

site_logo

Chloe McLuhan . 2024-09-27

MORE AT Google

The staff is a bit busy but still friendly. However the food is a bit disappointing. I really like italian food but this one is just a bit off… the mashed potato is worse than the one in HK KFC… The pasta is average and the tiramisu is good. Oh and the cocktail is actually better than the food LOL

site_logo

Pamcow . 2024-09-27

MORE AT Google

A little cozy restaurant, good food, nice people.

site_logo

Radu Ailincai . 2024-09-23

MORE AT Google

Excellent food great service. Our take always were well presented and tasted just as good.

site_logo

Ivan Bullen . 2024-09-20

MORE AT Google

I recently had a delightful meal at Demartino. The cosy, welcoming atmosphere really does make you feel as though you’ve stepped into a charming corner of Italy, right in the middle of London. The staff are wonderfully attentive and friendly, ensuring everything is spot on. The food is simply superb – fresh, authentic, and full of flavour. A particular standout was the Abbracci di Polpo – pan-fried octopus and chorizo served with a garlic and chilli sauce. It’s a delicious and unique combination with just the right amount of spice. But for me, the true highlight was the Crème Brulee – perfectly crisp on top, with a luxuriously creamy custard underneath. Absolutely divine! I’ve been several times now, and it’s always a fantastic experience. If you love proper Italian food in a relaxed, friendly setting, this little gem is a must. I’ll certainly be returning!

site_logo

Chris . 2024-09-20

MORE AT Google

Such a lovely family-run restaurant. Very homely. Staff are lovely and friendly. So nice. Service was very good. Nice intimate restaurant with a menu of Italian classics. The pasta was one of the best I had! I went with the LINGUINE AGLIO OLIO E PEPERONCINO. Basically, linguine with chillies, anchovies, garlic and extra virgin olive oil. So good. Well presented and freshly made. Divine. Only go for this if you can take spice and a fishy taste from the anchovies. I loved it. Really fiery. Reasonably priced given the area. Clean. Located on Great Portland Street. Highly recommend.

site_logo

Abovetheclouds . 2024-09-20

MORE AT TripAdvisor

Great Italian restaurant with delicious food and lovely service. We went here twice during our week stay in London. Recommend the Lasagna Gnocchi and Milanese . The desserts are also delicious.

site_logo

KellieMarie Roy . 2024-09-19

MORE AT Google

This family owned and run neighbourhood Italian remains as good today as it was 15 years ago when I first encountered their quality cooking. My office is across the road so I have been a regular for lunch and, occasionally dinner both solo and with guests. We enjoyed a couple of Peroni beers (£5,25 each) as we perused the menu. Today I took a guest and recommended the chef’s “speciality” of Nodino de Vitello (Char grilled veal chop with rosemary £29.50) for the main course which has always been a favourite especially when accompanied by a simple side salad of sliced tomatoes and red onion (£4.50) with great olive oil and balsamic dressing. The chop was perfectly cooked medium rare as requested and was very tender with a delicious flavour. An absolute winner. To start I had the special of the day, Mussels in a spicy tomato sauce (£14.95). This was also good but being hyper critical the toasted sourdough slices were not hot and the sauce rather bland. However the service was friendly and professional, our table was in a corner so we were able to discuss business issues and the food arrived quickly. Total charges including service (still at 12.5%) were £123.69 representing excellent value. Much recommended.

site_logo

Brian M . 2024-09-18

MORE AT TripAdvisor

Incredible food with amazing staff. Hardly had to wait for the food considering how busy it was. Will be coming again next time we're in London.

site_logo

Richard Quinlan . 2024-09-11

MORE AT Google

A terrific place to dine...if only we could have returned during our short stay in the area. Very prompt, attentive,friendly,courteous service. Food was flavoursome,hot,and as one expected. ..this place won't disappoint. A little noisy but this only added to the ambience of creating a happy place to be! Thank you Demartino ,also for the generous "on the house" Amerato✨

site_logo

Ms Ruby . 2024-09-02

MORE AT Google

Excellent lunch venue with friendly staff

site_logo

Robert Russell . 2024-08-30

MORE AT Google

It was a late lunch so the joy was an empty space without screaming crowds. But, as I have not been to De Martino for at least five years, i was disappointed to find how much the standards have lowered. Perhaps the change of wonderful white Italian plates into dull coloured ones shows reveals the philosophy. The mixed salad starter was clearly emptied from a plastic packet rather than being freshly sourced. And we are in mid-summer. The grilled salmon was overcooked and seemed pre-heated. There was the mindless balsamic sludge on the plate. Why do restaurants imagine we all love this horrible 'vinegar'? I finished my glass of wine and the waiter whisked it away while my partner was still drinking his. This is rude. Are waiters here not trained? I won't be returning to De Martino. Some down-grading has happened. Arriverderci.

site_logo

mikis76 . 2024-08-29

MORE AT TripAdvisor

Staff are welcoming and service is excellent, I got a delicious authentic spaghetti yet it was crowded and noisy

site_logo

Ghadah AlSaadi . 2024-08-27

MORE AT Google

I went there today with a quite big group of colleagues ( 16 people). They restaurant didn't make any fuse with the unreserved visit. The staff was really warm and friendly. The food was delicious and fresh. I will add this place to the list of the restaurants worth visiting again.

site_logo

Henrieta Rutkowska . 2024-08-22

MORE AT Google

Food poisoned after having shell fish risotto. Really regretful experience

site_logo

F A . 2024-08-21

MORE AT Google

We visited Demartino's last year and it left a lasting impression that we had to visit again this year. As expected the food did not disappoint. My daughter's favorite is the Arrabiata and if it wasn't so late I would have ordered the seafood soup. Our Bolivian waiter was very funny and made us feel very welcomed.

site_logo

Alana F . 2024-08-21

MORE AT TripAdvisor

Food is incredible. Service is lovely, friendly and attentive staff who always have a smile on their faces. Amazing Rigatoni, Pappardelle Bolognese, Bruschetta, and I love their side of Broccolini and Tomato/Onion salad. Best Aperol Spritz I’ve ever had in my life and amazing wine selection.

site_logo

Elle Schilling . 2024-08-09

MORE AT Google

My daughter and I had the most delicious meal. We shared the tomahawk steak and it was the tastiest meal we’ve had in London. Lovely staff, wonderful red wine and amazing food! See you next time we’re in London x

site_logo

meinir . 2024-08-08

MORE AT TripAdvisor

Musseles Half Shell is not fresh. Taste like shxt. Rather to eat at another restaurant.

site_logo

孙天明 . 2024-07-27

MORE AT Google

We have eaten these 2 days and everything was delicious, the waiters are very friendly.

site_logo

Daniel Sáez . 2024-07-19

MORE AT Google

Fantastic food one of the best meals I’ve ever eaten. It’s a good as they serve in Italy. Staff very friendly and knowledgeable. Can’t recommend this highly enough.

site_logo

Paddy Fox . 2024-07-10

MORE AT Google

Fabulous service, fabulous food. Will definitely be back.

site_logo

Sharon Collins . 2024-07-10

MORE AT Google

A nice experience. The staff is very friendly and nice. We asked to add cucumber to the salad, and this request was responded to politely. The dishes are excellent. A fun and distinctive atmosphere.

site_logo

Alaa GH . 2024-07-09

MORE AT Google

Excellent early supper for 4 of us. Really good friendly and helpful service - wine recommendations great. Had 2 starters - calamari, and the salmon/prawn/avocado special. Both very good. Followed with carbonara, linguine with clams x 2, and calf's liver. Also managed 2 puds - affogato and caramel cheesecake. Everything hit the spot perfectly. Absolutely would go again when next in town. Very welcoming, and great food.

site_logo

MEGtwo . 2024-06-28

MORE AT TripAdvisor

Nice and clean Thanks for everyone

site_logo

Mohammed Alaqeel . 2024-06-21

MORE AT Google

My favorite restaurant in London! The staff is always so kind and nice, the food is AMAZING and great portions for the price! The wine list is wonderful. The best carbonara I had. Absolutely unmatched

site_logo

Noga Gilboa . 2024-06-21

MORE AT Google

An excellent traditional Italian restaurant not far from Oxford Street. Great atmosphere and very popular. It was my first visit but it won't be my last! Really friendly and helpful staff!!

site_logo

Mark Fielding . 2024-06-13

MORE AT Google

High standard, reasonably priced restaurant! Dining room has a warm and relaxing atmosphere. music is at the right volume. High quality cooked food is served in abundant portions: HUGE whole roasted branzino fish stuffed with lemon wedges, thyme, garlic; BIG appetizer of varied grilled veggies; pappardelle pasta covered in LARGE chunks of meat. Even side dishes of sautéed spinach and roasted potatoes are cooked perfectly. service is organized and focused.

site_logo

Tami . 2024-06-12

MORE AT Google

Lovely food, friendly service, nice buzzing atmosphere

site_logo

James Gardner . 2024-06-09

MORE AT Google

When I come to London I can't help but come and enjoy the well-prepared and well-cooked dishes! I recommend the experience! Oh I forgot the pasta is cooked "al dente"!!!! I recommend drinking the Valpolucella that is on the wine list!

site_logo

Luca Aresi . 2024-05-28

MORE AT Google

Best italian restaurant i've ever been to. Food came very fast and was very impressive.

site_logo

Edvard Berger . 2024-05-09

MORE AT Google

Looked for a place close to our hotel. We passed by a few times and noticed the menu and the selection was very good. My husband had the Scaloppine Alla Milanese with Veal and I selected the Pappardelle Ala Bolognese. Both were excellent choices. Staff was attentive and the restaurant had posters of old Italian movies. Might eat there again this week!

site_logo

Terri Garcia . 2024-05-09

MORE AT Google

Fantastic Italian restaurant. Pasta and Scallops Millanesa really really good. A bit noisy but it's part of the atmosphere. More than remarkable.

site_logo

Daniel Molina . 2024-04-28

MORE AT Google

Vriendelijk onthaal, vlotte bediening, echte Italiaanse sfeer en gerechten van uitstekende kwaliteit. We hebben deze zaak de laatste avond van ons verblijf in Londen ontdekt, jammer want anders waren we zeker opnieuw geweest. Reserveren is belangrijk. Verblijft u i n de buurt, niet aarzelen ! Top aanrader

site_logo

claude berghmans . 2024-04-28

MORE AT TripAdvisor

Great Place to eat with authentic good traditional Italian food. 👌

site_logo

Ronnie Anker . 2024-04-26

MORE AT Google

We were staying around the corner, looked on TripAdvisor for restaurants nearby and this came up so we booked. We weren’t disappointed. Food was lovely as was the wine. Waiter was efficient and friendly and patiently answered questions from one fussy member of our group. Food was great altho the veal chop wasn’t quite as well done as I’d ordered but it was so big I managed to have plenty to eat. Only drawback was the noise from the table next to us. Feral children (age 3, maybe 4 and still up at 9.00pm so maybe tired also) and disinterested parents led to several meltdowns. That wasn’t the restaurant’s fault and these patrons seemed to be frequent customers by the interactions between them and the staff.

site_logo

Katy963 . 2024-04-26

MORE AT TripAdvisor

We are here the night before the marathon! I needed carbs and it didn’t disappoint! It was really busy we were seated downstairs it was extremely busy and loud, that was my only complaint , too many people squeezed in. The food and service though was amazing, our waiter was looking after all the tables downstairs and was run off his feet. He still however remained professional, friendly and attentive. The food was delicious we enjoyed pasta and risotto and a goats cheese starter. I will definately return when in London when less busy with runners!!

site_logo

Wrighty0 . 2024-04-22

MORE AT TripAdvisor

Perhaps we just had bad luck during a marathon week but both pasta and risotto was moderate, canteen quality. Risotto had no white wine in it. It was ok, but far below our expectations. The stuff was very friendly and helpful.

site_logo

Piotr Iwanicki . 2024-04-22

MORE AT Google

I had an amazing birthday dinner here! Delicious high quality food and awesome service! The skate was one of the best fish dishes I have had in quite some time and cooked to perfection! Perfect place for date night!

site_logo

-Artsy Photos LLC- . 2024-04-14

MORE AT Google

Amazing food and service. Claudio is the best!

site_logo

Andreu Pintado . 2024-04-12

MORE AT Google

Nestled in the heart of London, this Italian gem exudes an inviting charm, drawing in customers even on a bustling Tuesday afternoon. From the moment you step inside, the ambiance captivates with its warm hues and rustic décor, transporting you to the cobbled streets of Italy. Despite the midday rush, the attentive staff ensure every diner feels welcomed and attended to. As for the food, while there's no denying the potential, it falls short of perfection. Take, for instance, the seafood linguine a tantalising spectacle for the eyes with its vibrant colors and aromatic allure. However, the star ingredient, the crevette, disappoints with its overcooked, grainy texture, leaving much to be desired. It's a culinary letdown amidst an otherwise commendable menu. In summary, this restaurant shows promise, but refinement is needed to truly shine. With a bit of finesse in the kitchen, it has the potential to elevate its offerings from good to exceptional, ensuring customers leave not just satisfied, but thoroughly impressed.

site_logo

Christopher Blackburn . 2024-04-12

MORE AT Google

Great Restaurant, love eating here

site_logo

Camber Ken . 2024-04-07

MORE AT Google

This is the best spot for food! The calamari was cooked to perfection and all the staff were so kind and friendly. Truly a brilliant atmosphere. This is my 3rd time coming here and again the chicken milanese was just amazing! Prices are fair and service as well as food are great! 👍 THANK YOU!

site_logo

Bella F . 2024-04-02

MORE AT TripAdvisor

The pasta always amazing and everything else was also amazing for only £42

site_logo

matt (idiot) . 2024-04-02

MORE AT Google

Faultless. Great food, wine & service.

site_logo

Eamonn Donnelly . 2024-03-28

MORE AT Google

Italian restaurant with excellent food, great atmosphere, the owners and service providers are kind and patient.

site_logo

דוד רז . 2024-03-26

MORE AT Google

Food was excellent! Service was excellent! Would definitely come back.

site_logo

Chirag . 2024-03-18

MORE AT Google

Booked during a stay near to the restaurant. Food was lovely, staff were attentive and helpful. We had breads for starter, liver and chicken for main and tiramisu for pudding. £50 a head including a bottle of wine.

site_logo

FIONA BATES . 2024-03-09

MORE AT Google

Traditional London-Italian, popular family restaurant near Great Portland Street tube. Great chatty, informal atmosphere with even better food I found. Would highly recommend!

site_logo

Nick Miles . 2024-03-09

MORE AT Google

Excellent all round, such a little gem!

site_logo

Cat Fos . 2024-03-07

MORE AT Google

The food was okay, but the pasta made us wait for a very long time

site_logo

Atlas . 2024-03-03

MORE AT Google

We worked with Demartino to host a fantastic celebration meal for an important work event at the BBC. Georgio, Claudio, Diego and the team were brilliant at providing a private dining space and lovely atmosphere with excellent service and delicious food throughout the night. Couldn't recommend more. Thank you for making the night a special occasion for us all!

site_logo

Kate Clifford . 2024-03-02

MORE AT Google

Similary restaurants in London

restaurant_img
4.3

986 Opinions

location-icon38 Threadneedle Street, London EC2R 8AY England
Italian
outdoor_seating_241395takeaway_241395delivery_241395

From the moment you step inside, Piazza Italiana leaves a lasting impression. The soaring ceilings and elegant décor immediately set the tone — it feels luxurious but still warm and welcoming. The atmosphere is always spot on, and the service is attentive without being overbearing. Whether it’s a business lunch or a celebratory dinner, the attention to detail and quality of food never disappoints. A beautiful venue with consistently great hospitality — highly recommend.

restaurant_img
4.3

343 Opinions

location-icon10-12 Basinghall Street
Italian
outdoor_seating_83155takeaway_83155delivery_83155

Really enjoyable lunch, great food, lovely atmosphere and fab service.

restaurant_img
4.3

7136 Opinions

location-icon13A North Audley Street, London W1K 6ZA England
Italian
outdoor_seating_263234takeaway_263234delivery_263234

This is such a fun place to visit for lunch. The ambiance is unmatched. There's a lovely plant store at the entrance and lots of fun food options across the 3 levels. We got food from the Thai place and the Indian place. My sisters got the chaat fries with a side of butter sauce and said they were definitely rated 10/10. The jalapeno margaritas and strawberry daiquiris from the taco place are also delicious, and the red curry from the Thai place was everything I hoped it would be. I have a gluten allergy and both the Indian and Thai place had options that were clearly marked and staff that seemed reasonably knowledgeable. I chose to forego a protein option in my Thai curry dish because I don't prefer the gf protein options they had, and when I needed something changed, the server was quick to fix my order. The facility has 2 elevators, but the one that reaches the top floor is out of order as of April 2025 and the stairs are uneven so be very careful on them. The rooftop seating is particularly nice as the inside of the Mercato felt a little warm, but also can't be reached without more stairs. Even if the lift was working, you have to find a staff person with a key because it's locked with signs that say they're only for certain priority clientele.

restaurant_img
4.3

668 Opinions

location-icon167 Fifth Avenue
Italian
outdoor_seating_71383takeaway_71383delivery_71383

Raved about this place to friends and then was a bit embarrassed. Starter of crostini was poorly presented and didn’t taste good. We were given an old menu which gave away the price increases that must have happened lately including the steak increasing from £24 to £28 but the steak was prepared and presented worse than the last time I visited. There was a lack of a good vegetarian pasta option in our view. No water offered to the table for a long time. Had to ask for our drinks a few times. White veal pasta was delicious. We were asked by the waitress to sing happy birthday to the next door table which was a bit intrusive. Probably would have done it anyway but being asked to was a bit odd. Just didn’t feel as good as I hoped it would all together.

restaurant_img
4.3

2122 Opinions

location-icon36 Queensway Next to the Church
Italian
outdoor_seating_305904takeaway_305904delivery_305904

Pizza was good and the restaurant have a nice service :)