GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.0

Based on 1.491 opinions finded in 2 websites

site_photo4

Nº 731 in 1309 in Cheshire East

Nº 31 of 45 Italian in Cheshire East

CUSTOMERS TALK ABOUT DISHES WITH..pizzachickenmuststeakspaghettipastapayfishcheesemeatraviolilobsteroldgarlicbeautifulcookedvealrisotto

comment_iconOpinions

thanks to cibo making a rememberable experience for my 17th very good service and they are very quick to help the staff were funny and very kind and the food is so amazing taste so nice and hot when it comes out they also brought me out a birthday sunday and sang happy birthday i highly recommend this place

site_logo

Lily Greenhouse . 2025-05-07

MORE AT Google

Had an amazing meal at Cibo today. Staff attentive, food and drink amazing. Really enjoyed my birthday treat. Definitely recommend to go here.

site_logo

Susan Dewhurst . 2025-04-28

MORE AT Google

Ate at Cibo in Wilmslow for the first time ,it was a friends birthday meal,as a party of 5 we arrived ontime and had to wait a while to be seated upstairs which was nice as it was well away from the noisy bar area,you expect some places to be packed on a saturday night so that wasnt a problem once upstairs and seated we ordered our food,i have to say that the menu isnt very inspiring at all and it certainly isnt authentic italian food,any italian will tell you very clearly that carbonara never contains cream so seeing this on a menu was a surprise,for starters 3 of the party ordered the sharing platter which consisted on a selection of italian deli meats,salad,pickled vegetables and a few chunks of bread,it arrived and i thought there is no way that is for 3 people,yes it was nicely displayed on a stand but for 3 people it was laughable,the pate that was ordered by the 2 other diners was nothing to write home about 4 of us ordered pizza(as the menu wasnt very inspiring) and one diner ordered lasagne the lasagne looked pretty standard,the pizzas were not good,undercooked in the middle and the pizza bases were so soggy they were almost raw flavour wise 2 pizzas were ok,i mean its pretty hard to ruin a cheese and tomato piza and a spicy sausage pizza the smoked salmon and prawn pizza was ok but no flavour of lemon or dill,after a few bites it just became sickly and the smoked salmon was overpowering everything the pizza that had cream cheese,truffle and cured beef was disgusting,the cured beef when cooked turns into dry shoe leather and the cream cheese and truffle was quite frankly vile,i have no idea who thinks up these flavour combinations but when they are on a soggy pizza crust then they just turn into a sloppy mush overall i was very disappointed in my experience,yes the restaurant is pretty and its clearly a place to be seen in Wilmslow on a saturday night but when you cant get the basics right then you need to go back to your menu and look at what is coming out of the kitchen to summarise,its a place to be seen but if you want decent food then there are far better places to eat out in Wilmslow a few weeks earlier we had dined at Potyo which is very close by and that was stunning !

site_logo

paul rimmer . 2025-04-21

MORE AT Google

Considering the premium price tag, the service was terrible. Booked a table for 8pm, had to wait half an hour at the bar before we could sit down anywhere. Food was okay.

site_logo

Harry Parrott . 2025-04-07

MORE AT Google

Went for Mother’s Day and it was honestly the best restaurant I’ve been too. The food was very nice, good portion. The atmosphere was very nice, was always someone there if you needed something. Definitely recommend.

site_logo

Shannon . 2025-03-30

MORE AT Google

Went for mother's day lunch with the family, food was excellent and the service and attention to detail from our server, Mauro, was outstanding

site_logo

Chris Bryan . 2025-03-29

MORE AT Google

Food was good as always, service was shocking, waited over an hour for main course, despite asking on several occasions, also had to go find staff to order our drinks, glasses had been empty for some time..eventually when I got a Manager, the food arrived within minutes. After the meal ended, the 'Manager' stated the reason for the delay is that they were busy, and these things happen.. zero ownership, zero empathy. But he would, on this occasion, remove the service charge.. I pointed out that there is never a world where I would be paying any service charge, for that shocking level of service. They then reduced the bill by 20%.. We arrived 15min before starters landed, and left 10min after deserts landed.. in all, we were there just under 3hrs. We were regulars, but won't be returning.

site_logo

M OD . 2025-03-09

MORE AT Google

Cibo, regrettably, fails to justify its premium pricing with the quality of its offerings. The culinary experience fell markedly short of expectations, with dishes ranging from uninspired to decidedly lacklustre. The veal, for instance, was dishearteningly thin—its delicate essence obliterated by an aggressive breadcrumb coating—and arrived on a comically oversized platter that dwarfed the table, rendering the presentation more chaotic than elegant. To compound matters, we were charged for an item that never graced our table—an oversight that speaks to inattentive service. While ambition in presentation is commendable, execution here felt disjointed and self-indulgent. At these prices, one anticipates finesse, balance, and accountability—qualities conspicuously absent in this experience. Cibo, in its current iteration, is difficult to recommend to discerning diners.

site_logo

Naeema Umar . 2025-02-19

MORE AT Google

Didn't eat anything because staff not accommodating for our needs and some staff were dismissive

site_logo

Faisal Hussain . 2025-02-16

MORE AT Google

Beautiful food, service, and ambience. One of the best Italian restaurants we've been to. The staff were attentive and friendly.

site_logo

Kam Kaur . 2025-02-09

MORE AT Google

The steak was brilliant, the food came very quick the staff were very nice and quick it is quite expensive but it is worth it

site_logo

Eth plays . 2025-02-07

MORE AT Google

I was extremely disappointed visiting Cibo recently. I have a gluten allergy and clearly stated this before ordering. When I ordered they said I couldn’t have a lot of food on the menu as they do not provide gluten free alternatives but what I had was okay. They came back a few minutes later and told me to reorder. My friends had their food arrive and the waiter came to ask me how serious my allergy was as part of my dish contains gluten. I said I could not eat it. I felt pressured to reorder quickly and unfortunately chose an expensive item which was not very nice. It took 10 minutes for my food to arrive and my friends had almost finished their meal. The waiter was rude about it and when I queried at the end of the night about the delay he tried to blame my allergies for the food being wrong. It left a sour note after what had been an enjoyable evening with friends. Would not recommend visiting here and I will not be returning.

site_logo

Rosie Henshall . 2025-01-19

MORE AT Google

Not much choice on the menu compared to other Italian restaurants we've been too, food was very average. Sitting to close to people very cramped it sounded like a wacky warehouse, if you want a pleasant night out this is not the place to go.

site_logo

Paul Tonge . 2025-01-19

MORE AT Google

Great, food , Great service. Had to wait a while for our table but worth the wait. Very nice indeed

site_logo

Rochelle Warren . 2025-01-14

MORE AT Google

lovely evening out with family kerb appeal immediately good vibe excellent service polite quick attentive food was excellent

site_logo

Kevin Lewis . 2024-12-30

MORE AT Google

Brilliant service and great restaurant. The steak and pistachio cheese cake was brilliant but the deep fried calamari was average, as there was too much paprika on them. Plenty of drinks options.

site_logo

Antonio A Lopez . 2024-12-13

MORE AT Google

Went yesterday for my dad's 65th birthday Possibly the worst service I have ever experience anywhere Thank you for a terrible evening

site_logo

Eddie Whitehead . 2024-12-11

MORE AT Google

Food was rubbish… staff and atmosphere spot on but I could have ate better at a green king. Food was

site_logo

Tom Cally . 2024-11-17

MORE AT Google

Fabulous visit with excellent service and the food was wonderful...will defo be going again

site_logo

Graham Waring . 2024-11-09

MORE AT Google

Quite disappointed with service and food, frequently visit their sister restaurant sasso and never had problems.

site_logo

Shane Abbott . 2024-10-27

MORE AT Google

Came here for my bday meal staff where welcoming food was on point taste so good will be back soon big shoutout to the Cibo team well done guys

site_logo

JXD . 2024-10-26

MORE AT Google

Tasty pizzas Lovely wine Good service Tasty ice cream

site_logo

Crystal-Clear . 2024-10-19

MORE AT Google

Spectacular - amazing food and decor

site_logo

Sean . 2024-10-19

MORE AT Google

Came tonight for my daughter's birthday, 8 adults 2 children. Beautiful food, really looked after us and the food was stunning. Will definitely go back. Great night, great people, great atmosphere.

site_logo

Joanna Harris . 2024-10-17

MORE AT Google

Why don't I come here more? Faultless.

site_logo

Michael Bischof . 2024-10-13

MORE AT Google

This place was packed but don’t let that put you off, the food and atmosphere really made it worth the visit. The food was great, the service good and the layout of the building really was inviting.

site_logo

Nick Farrow . 2024-10-09

MORE AT Google

Amazing experience here, food was simply delicious and I would go as far as to say it was the best roast beef I’ve ever had, The service was second to none and nothing was too much effort. Highly recommended

site_logo

Tracie Owen . 2024-10-07

MORE AT Google

Nice place, food good and service was good too. It's always busy here - not the cheapest place, but nice for a treat

site_logo

sally moston . 2024-09-28

MORE AT Google

Beautiful restaurant. However, chili prawn starter, very rich buttery sauce was not to my taste. Not enough chili. For £18 for a starter would expect prawns to have been cleaned. Carbonara. Pancetta very fatty and not crisp. Overall the taste was very bland, not well seasoned. Had to request parmesan. Table was next to toilets. Hand dryer punctuated conversation. Would go again and with different menu choices and table I'm sure I would enjoy more.

site_logo

Dave Bruce . 2024-09-27

MORE AT Google

Lovely place for a meal. Had a great late lunch with a great friend

site_logo

kay glynn . 2024-09-16

MORE AT Google

Amazing evening at Cibo. Food and service were excellent. Highly recommended

site_logo

Stephen Eld . 2024-09-15

MORE AT Google

My son and his girlfriend visited the restaurant this evening and had a very disappointing experience. The waiter who attended them wouldn't even look at them as he took their order which led to them being given the wrong order. The waiter gave her a prawn dish instead of the chicken one she ordered & what makes matters worse is that she is allergic to shellfish! My son then had to eat his dish alone while she waited for her meal. They did offer to take her dish off the bill but it isn't the point. What should have been a special occasion was completely ruined, because they were young kids in my opinion. Just shocking! Terrible experience

site_logo

Ria Cleary . 2024-09-13

MORE AT Google

Everything was very good, the only reason to knock 1 star off was it was a bit expensive and the additional 12.5% service charge made it more so. We will come back, but probably only for special occasions.

site_logo

David DJT158 . 2024-09-02

MORE AT Google

The food was out of this world. The service was excellent. Waiter's and waitresses kept an eye on all tables. We dropped a fork on the floor. A waiter came straight to us and replaced it with a clean one. It was a very happy atmosphere.

site_logo

Andrew Sinclair . 2024-09-01

MORE AT Google

Very good ambience and good food. Amazing bar with very elaborate bar menu. Try the cocktails. It was a bit loud but also due to the fact was very busy. Service is good but the fact it was super busy, would have been even better hence 4 stars. Will definitely go back

site_logo

Anuj Seth . 2024-08-30

MORE AT Google

Great food and service, lovely staff. A tad expensive and full of pretentious people.

site_logo

Peter Moore . 2024-08-18

MORE AT Google

Absolutely stunning place with the most perfect HALAL food. Will be returning regularly for date night!

site_logo

Irsa Imran . 2024-08-17

MORE AT Google

Enjoyable Italian in a nice pocket of Wilmslow. Delicious Chicken Caesar salad with very generous portions of protein. Would return if I was in the neighbourhood. Nice prices and good service.

site_logo

B L . 2024-08-17

MORE AT Google

For the price we found the food to be below par, we both had seafood and found elements of it either stale (ravioli) or over cooked (half lobster). Although the atmosphere of the restaurant is lovely, two unnecessary and rude remarks by different servers on amount of Parmesan used (too little apparently) and choice of wine spoiled it for us.

site_logo

Kevin Byrne . 2024-08-01

MORE AT Google

Cibo (Wimslow) in our opinion is a little pretentious and pricy the restaurant has a well presented up market ambiance. We felt a certain surly attitude from one member of staff when booking and on arrival. In fairness the majority of staff were polite and attentive. The food was OK but not outstanding where things really deteriorated was the moment a wood beetle strolled out of the cheeseboard grapes off the platter and across the table. Although off putting our party overall accepted that these things can happen but the attitude of one individual came over as indignation simply saying "Do you want something else" My friend declined suggesting politely that it had put him off and that was that No apologies no expressive concerns. On paying the bill we noticed that the Cheeseboard had not been charged for but wasn't mentioned. Despite the pleasant ambience we will not be returning.

site_logo

Paul Hilderthorpe . 2024-07-24

MORE AT Google

Just Beautiful. From walk in to leaving we enjoyed our experience. 5 star without hesitation. Gian Franco and his team are excellent. Starter, mains and desert in a nice ambiance.

site_logo

Eser Akyol . 2024-07-14

MORE AT Google

Object strongly to being charged 12.5% tip. Only went in for a couple of coffees. Really resent this. Will not be going back again with this policy in place.

site_logo

Felicity S . 2024-07-01

MORE AT TripAdvisor

Visited Cibo twice with a group of friends over a 6 month period, excellent food, service and atmosphere the first time. On the second occasion the food was again top notch but the service was average...great until the servers swapped and we were served our coffee before our deserts, when we questioned this we were were ignored. We queried if the coffees were ours as we had ordered cappuccinos and what was being served to us was more reminiscent of a flat white as there was no foam. Again we were ignored and the coffees were put down and confirmed they were cappuccinos. It was very odd. This isn't a cheap place to eat and although the food is absolutely worth it, poor service will always override this. We enjoyed our meals here but as a group we will now look elsewhere as this soured the ending to a lovely meal. To the chefs-your food is excellent-thank you.

site_logo

Krystle-Ann Bowers . 2024-06-30

MORE AT Google

We went to the wilmslow restaurant for our anniversary meal, good service, my husband had soup which was very nice served with some nice bread and we had a cheese garlic bread always very nice but we both had lasagna which really wasn’t the best it was just like pasta with cheese and a couple of bits of mince which was hard to find I actually didn’t finish it which isn’t like me, I was lovely forward to having some icecream as it’s always so nice, but they had raised the price to £8 pounds for 3 scoops which is is outrageous, maybe if u were in Monte Carlo but really it’s a joke and we went to get our dessert from Tesco opposite and had it later at home

site_logo

katie . 2024-06-22

MORE AT TripAdvisor

The service is excellent but the value for money is very poor. Do not get the lasagne it was devoid of meat. Very expensive

site_logo

Frazer Thorley . 2024-06-22

MORE AT TripAdvisor

I booked very last minute online via the website for Cibo Wilmslow for a Monday evening at 6:30pm for three of us. There isn’t really any parking around the restaurant, so this took us some time to find a suitable place. We were seated immediately, the restaurant was quite quiet but I think that’s to be expected on a Monday. We had our drinks order taken, we ordered the olives, garlic bread with mozzarella and calamari to start. The garlic bread base was fantastic, light and easy to eat. The calamari wasn’t great, it looked like it was from a frozen bag found in a supermarket aisle, the olives were fresh and came with bread and oil. For mains, we had two pasta sea food dishes and a pizza. Mine was the prawn in a chilli and garlic sauce, the other was the prawn in a white wine sauce and the pizza was the Roccatta. The pizza wasn’t presented like a traditional pizza as you’d expect, it was rolled into sections like a wrap. Each pasta dish was delicious, presented well and very good portion size. We found service to prompt but we were also left to enjoy our meal and conversation in peace. We would definitely revisit again.

site_logo

amyelisemillar . 2024-06-03

MORE AT TripAdvisor

Fun evening in a great atmosphere First class service Great food Real size portions Value for money What more could you ask for ,

site_logo

Bernard M . 2024-06-01

MORE AT TripAdvisor

Great food and ambience. We love it!

site_logo

Juwad Nayyar . 2024-05-26

MORE AT Google

Excellent food, service and the staff very friendly

site_logo

mayada tayan . 2024-05-21

MORE AT Google

A quality addition to Wilmslow s cafe society

site_logo

Ian Cole . 2024-05-16

MORE AT Google

Some friends and i did a surprise birthday celebration for a friend here and the staff were up to the task and made it memorable and awesome. The food was good and atmosphere was vibrant. Will highly recommend.

site_logo

Yomi Que . 2024-05-13

MORE AT Google

Amazing food, brilliant staff. Highly recommended. Beef & guanciale ragu is of this world!

site_logo

Paul McCluskey . 2024-05-02

MORE AT Google

Amazing place to eat authentic Italian food. We had a variety of Italian cuisine and desserts and all were delicious!!!

site_logo

Sumukh Shankar Hegde . 2024-05-02

MORE AT Google

Great food! Attentive service! Amazing atmosphere!

site_logo

Matt Fradgley . 2024-04-30

MORE AT Google

Do not go, the food was very very poor. The ribs were stone cold with a bit of warm sauce, the steak was ok, the chips looked like they came from the chippy, the bolognaise was distinctly average and the rolled pizza, well that was a joke. To be very fair the staff did replace the ribs and pizza promptly and without fuss but if you are out for some good food it isn’t cibo you should be heading for. The restaurant looks great but very much style over substance in this instance. I won’t be returning, there are many many better places to go locally.

site_logo

Mark Phillips . 2024-04-28

MORE AT Google

Overall we had a nice first trip to Cibo. The ambience and the food were lovely but it could have done without being served with a side order of superiority complex from some of the staff (rolling your eyes because I asked for a drink without lemon wasn't necessary).

site_logo

Stephen Dykes . 2024-04-28

MORE AT Google

Wonderful food in a lovely contemporary restaurant, really excellent value, we have re booked already

site_logo

Nigel Mark Westwood . 2024-04-24

MORE AT Google

Pricey but lovely food. Beautiful place and would definitely recommend.

site_logo

Wayne Millington . 2024-04-21

MORE AT Google

The food tastes great. Worth a visit.

site_logo

Rajesh “Banerjee” #TravelwithRajesh . 2024-04-20

MORE AT Google

Hospitality, atmosphere service was first class. All the staff are lovely and super friendly. The food was lovely and priced fairly. Bar area is a delight, I would dine here again, would recommend.

site_logo

Fuzz Sharif . 2024-04-13

MORE AT Google

Amazing steak! Top quality service and generally very nice experience.

site_logo

Simon . 2024-04-09

MORE AT Google

Gorgeous restaurant, gorgeous food ,brilliant staff 😋😍

site_logo

Yvonne Delaney . 2024-03-13

MORE AT Google

Family meal. Really good food, brilliant choice of wines. Best Italian in tge area

site_logo

Dot Littler . 2024-03-07

MORE AT Google

Great food - tasty, good quality and great service and vibe!

site_logo

Neeraj Nayar . 2024-03-03

MORE AT Google

I had eggs and mushrooms with smoked salmon and sweet potato fries. Fantastic food, service was great......could not find fault. We don't often visit wilmslow, but we will definitely come back to Cibo.

site_logo

Mark S . 2024-02-28

MORE AT Google

Why would you have the most unhelpful person answer your telephone? I had a table booked for eight people the woman on the phone refused to even entertain the fact that one of my party had a dietary requirement. I understand a lot of customers are rude which can be draining, but you should really should treat each customer like a brand new one. 👌 Reviewing some of the other reviews, it doesn't seem like customer service is a priority. Food looks great though.

site_logo

James Steel . 2024-02-28

MORE AT Google

Best spot in Wilmslow! Super tasty food, friendly staff and great place to be.

site_logo

Beck Phillips . 2024-02-27

MORE AT Google

Great setting, perfect for a romantic dinner or a family meet. Food is great and the menu varied.

site_logo

frederic houinato . 2024-02-21

MORE AT Google

Good food + nice and efficient service, I recommend it.

site_logo

DAMIAN Stepinski . 2024-02-18

MORE AT Google

Fantastic food, it was incredibly busy but the staff still worked well together under pressure and went above and beyond to make our family evening special. Thank you

site_logo

Haley Richardson . 2024-02-15

MORE AT Google

I prefer a good old Derbyshire fire lit friendly locals country historical restaurant pub. Not a room full of fakes and no atmosphere!

site_logo

G GILES . 2024-02-14

MORE AT Google

Great pizza. Super soft dough and a few veggie options.

site_logo

Kane Bennett . 2024-02-11

MORE AT Google

Fantastic experience with excellent food and atmosphere.

site_logo

Ashley Booth . 2024-02-10

MORE AT Google

First time visiting Cibo last night and was looking forward to dining there. On arrival we were told to wait in the bar until our table was ready even though we arrived on time. We made our way to the bar area which was busy and it took about 15 minutes to get served a drink and there was no available seating due to how busy the bar area was. The bar was full of dirty glasses at one end and only one bar staff serving at the bar. Eventually got a drink and then we were taken to our table. Ordered calamari’s which wasn’t great and I couldn’t finish it so left most of it and when my main course arrived (Ceaser salad) the lettuce was soggy, drowned in sauce and very salty. Overall quite disappointing.

site_logo

The Beautiful Eyelash Company . 2024-02-10

MORE AT Google

Steak was one of the driest I’ve ever eaten. Sent it back, the replacement was even worse. They did nothing to rectify the situation. Next time cook one of your dads boots it will be less chewy

site_logo

Face Book . 2024-01-27

MORE AT Google

Decided to try cibo wilmslow as we had such a lovely experience in Hale. Was the complete opposite. Staff were arrogant. Staff were blunt and rude. Service was terrible. Definitely sticking to cibo hale as Staff were wonderful.

site_logo

Syra Ahmad . 2024-01-27

MORE AT Google

Went thurs night, was good atmosphere, food good and didn't wait too long, we took friends and they enjoyed it.

site_logo

Sandra B . 2024-01-26

MORE AT Google

Excellent service as always. Immaculate staff. Great food and a lovely atmosphere.

site_logo

Jon Barnes . 2024-01-25

MORE AT Google

Every thing was perfect food service all

site_logo

Agron Lela . 2024-01-22

MORE AT Google

Great restaurant with brilliant food. Staff are attentive and make you feel welcome. Can highly recommend.

site_logo

Angela . 2024-01-13

MORE AT Google

A firm favourite for many in the area. Perfect place to wind down and enjoy time with friends. Grazie

site_logo

Mel Spencer . 2024-01-13

MORE AT Google

Great food, great service and nice decor!

site_logo

Tony Hughes . 2024-01-13

MORE AT Google

Very good overall and the service from nearly everyone was great, apart from one lady who let the team down - a younger dark haired lady was very brusque and didn’t smile once, let alone have any conversation. She also pushed past us once and when I was on the way to the bathroom with my son, I stood aside to let her past and she didn’t even acknowledge us, certainly no thank you either. Came across as very rude. What a shame that’s what stuck in our head more than the rest of the evening. We’ll be back as it’s still very good, but Cibo should have a word with her about it really.

site_logo

K Lear . 2024-01-08

MORE AT Google

My husband and friend had halibut which was excellent, I had veal fungi which was very tough, the sides zucchini were over cooked as were the fries, also the sides were really small compared to Cibo in hale. Good night though but disappointed in food.

site_logo

Simone Grosberg . 2024-01-07

MORE AT Google

Always good nice food nice ambience weloming staff

site_logo

Tony Davies . 2024-01-05

MORE AT Google

We got a last minute table here on New Year’s Eve and sat right by the door. Wasn’t a problem. Fantastic evening, amazing food, excellent service. Couldn’t fault it. The restaurant was rammed all night, and we were never short of a drink, the food was brought out quickly, and it was delicious. We had steaks, ribs, pasta, king prawns. All perfectly cooked. Great choice of wines too. Lots of different waiters and waitresses were very attentive. Great team effort. Also met Scott Mctominay, lovely fella who had a photo with my son! Some Love island chap was in there too, and some Leicester players. Will definitely go back. Not cheap but you get what you pay for, top quality atmosphere, food and service, so worth every penny. Well done Cibo, best restaurant in Wilmslow.

site_logo

Mr G . 2024-01-03

MORE AT Google

Superb all round. Thank you! It was a great place to take my daughter out for her 21st.

site_logo

Mark Hoyland . 2023-12-27

MORE AT Google

Food very good helpful and polite staff.

site_logo

Mark Robinson . 2023-12-26

MORE AT Google

Good food and ambience, but portions left a lot to be desired. We ordered costine di maiale ribS for starters, and I emphasise the S in ribS as we received just one rib at a cost of £13.

site_logo

Patrick Ryan . 2023-12-22

MORE AT Google

I’m sure the food is lovely but I experienced such terrible service from the guy on the door that we ended up going elsewhere instead

site_logo

TimC10 . 2023-12-21

MORE AT TripAdvisor

Went for brunch, nice atmosphere not too busy and nice

site_logo

Stacey Holt . 2023-12-21

MORE AT Google

Disappointing, we booked a table and stated that we had prams, we arrived there was no ramp and other guests helped us to get the prams inside, we were squeezed into a small space that wasn’t really practical. Ordered drinks 3 out of 4 were incorrect, food came quickly but 1 out of 4 were incorrect. The food is expensive for what it is. Overall not what I expected.

site_logo

Panda_eyes2 . 2023-12-17

MORE AT TripAdvisor

Whilst the food was really nice the hospitality was very poor. We were left waiting in between orders and meals for quite some time, had to ask for drinks and the bill a few times as it was so long. Waitress seemed to be in her own little world. No one asked about dietary requirements until I raised it and turns out they don't have a gluten free menu but do have pasta so that's all I had. Has potential but sadly I was a bit disappointed.

site_logo

Joanne B . 2023-12-17

MORE AT TripAdvisor

Beautiful restaurant let down by very poor service. One of our starters was stone cold and had to be sent back… no apology. A replacement came out with our main course which ofcourse we declined. There was simply no attention paid to our table all night. None asked if our food was ok and we had to refill our own wine glasses as no-one paid any attention to what was going on and the restaurant was relatively quiet when we got there. One other really annoying point for such a fancy restaurant was that nobody offered to hang our coats. Whilst the food was good the service is shocking.

site_logo

HFPITT . 2023-12-12

MORE AT TripAdvisor

Went for brunch today with family. Gorgeous food and great service, definitely going back

site_logo

cameron craigie . 2023-12-08

MORE AT Google

Very busy Saturday night but great atmosphere and well looked after

site_logo

Becky Kelly . 2023-12-07

MORE AT Google

Could not fault food or staff, well worth going again, the service was exceptional, maitre de a great host , as was head waitress who served us

site_logo

Graham F . 2023-11-29

MORE AT TripAdvisor

This is a great restraunt I’m going back 10 December

site_logo

IAN KAVANAGH . 2023-11-28

MORE AT Google

Amazing atmosphere always buzzing lovely team and delicious food

site_logo

Sami Majzoub . 2023-11-28

MORE AT Google

Coffee not good Food ok but expensive Service poor Noisy with lots of hard surfaces making conversation difficult. This place likes to think it is a great recreation of Italian high café culture but it falls short on every aspect except the prices.

site_logo

Mark Schaefer (Spectrum Plant) . 2023-11-28

MORE AT Google

Similary restaurants in North West

restaurant_img
4.0

44 Opinions

location-icon70-72 Crewe road
Italian
outdoor_seating_318895takeaway_318895delivery_318895

Visited Valentine night warmly welcomed and duly seated. The venue was nicely appointed and warm. Drink orders taken and duly arrived. A set menu for the night was the only option and items were chosen. A 3 course meal was £34:!! Plus the steak was an additional £10. The meals arrived starters very nice but the steak arrived in the centre of the plate and a side portion of chips. Not a garden pea,tomatoes or a single mushroom as all these were again extras. The steak was very tender but one undercooked. The sweet we chose the supposedly a”Tiramisu” but it arrived nothing like it at all. In fact I believe it was wrong to call it that. The only relevance to a Tiramasu was “the lady finger sponges” 3 covered in a lemon flavoured coloured cream. The waitress service was excellent very pleasant and polite young ladies. At the time we ate there were several empty tables that I am sure if prices had been reasonable would have been taken ( personal opinion)

restaurant_img
4.0

660 Opinions

location-icon
Italian
outdoor_seating_218219takeaway_218219delivery_218219

Menu was subpar for the price. Many wines were out of stock when we asked. Not value for money and the tiramisu was awful! Tasted like Marzipan!

restaurant_img
3.9

1998 Opinions

location-iconBolton Road
Italian
outdoor_seating_92312takeaway_92312delivery_92312

Dog friendly restaurant . Fabulous food, friendly staff and very dog friendly . We sit in the bar area which is very comfortable, nice chairs and tables. Great menu and the dog can get chicken as well. Dog bowls of water, all brilliant.

restaurant_img
3.9

454 Opinions

location-icon41/43 Park Lane
Italian
outdoor_seating_228698takeaway_228698delivery_228698

Had a lovely evening for my husbands birthday, the staff were very attentive, my husband enjoyed his evening here, we will be back. Thank you Ben and team.

restaurant_img
4.2

1768 Opinions

location-icon75 London Road
Italian
outdoor_seating_175775takeaway_175775delivery_175775

Arrived for a Saturday early tea — restaurant very quiet —-Greated as normal —always good chose our perfect table Ordered our food Then the problems — very disappointed with the lasagna hardly any meat — or pasta for that matter just sauce It was the worst I had had anywhere I used points I had gained from previous visits -& a voucher I bought —Black Friday — they are gone now Won’t be returning Very poor really gone down a grade