GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
3.8

Based on 1.402 opinions finded in 4 websites

site_photo4

Nº 512 in 703 in Cambridge

Nº 29 of 42 Chinese in Cambridge

CUSTOMERS TALK ABOUT DISHES WITH..ricecookedduckporkchickenprawnsspicychillimeatfriedpeppernoodles

comment_iconOpinions

Great service, frequented by locals.

site_logo

Vivian Bombycilla . 2024-12-04

MORE AT Google

The dishes were unexpected good, not kind of American Chinese style food. Comparing to other Chinese restaurants nearby or in the US, the price is not expensive at all.

site_logo

Wang Justin . 2024-11-29

MORE AT Google

Very traditional Chinese food. Yummy

site_logo

Rui Cheng . 2024-11-29

MORE AT Google

had a nice chinese new year dinner here - the eggplant was especially nice dragon eggplant - 9/10, very good la zi ji - 5/10, give it a miss, diced breast meat cumin lamb - 8/10, great twice cooked pork - 8/10

site_logo

Drish . 2024-11-28

MORE AT Google

Good value for money, we really liked the aubergine and the beans. Excellent kung po chicken as well

site_logo

Riley McMahon . 2024-11-23

MORE AT Google

Excellent food - if you need a Chinese in Cambridge you won't be disappointed with this!

site_logo

orange . 2024-11-21

MORE AT Google

The portion size and taste are okay, and the price is not cheap.

site_logo

Esther Tan . 2024-11-16

MORE AT Google

Didn't take much photos. But the food are very typical Chinese style and good tasty. I recommend here for the Chinese taste. My choice of Chinese food in city centre. Thank you for the service. I feel so warmth greeting and served with my language.

site_logo

anna uk . 2024-11-03

MORE AT Google

Amazing food! Just what I wanted !

site_logo

Mathiya . 2024-10-27

MORE AT Just Eat

Some of the staff members are super rude and not at all welcoming. Asked to remove the pork from dish and served me beef instead without asking my permission and got angry when i asked to remove it. They still charged service charges for extremely poor service

site_logo

Komal Sood . 2024-10-25

MORE AT Google

Delicious noodle soup, friendly owners and reasonable prices, what's not to like

site_logo

James Merrigan . 2024-10-23

MORE AT Google

That was so amazing chinese restaurant ! you guys need to try if you have time.I recommend the Peking dumplings and sour sweet chicken.

site_logo

Duan . 2024-10-23

MORE AT Google

Must have been the most bland tasting Chinese ever. Soup tasted like water.

site_logo

Warren . 2024-10-21

MORE AT Just Eat

Driver was very quick, good communication. Food was also delicious.

site_logo

Alan . 2024-10-20

MORE AT Just Eat

One of the worst kung po i had so far. so much oil, barely any taste.

site_logo

Vilmos . 2024-10-18

MORE AT Just Eat

Taste overall 8.5/10 the taste is definitely good and authentic; Portion with price 8/10 it is nice in general but +1 for unlimited rice; Service 7/10 the service is nice but not easy to get attention, free wifi; Cleanness 9/10; vibe 6/10 the restaurant atmosphere is okay, nothing special, I can imagine the chinese vibe when there are a lot of people talking across restaurants(I didnt experience it, if i did, it might be 8/10)

site_logo

Nut S. . 2024-10-11

MORE AT Google

Was excited to try this place. However, the food we had ordered (Seafood Fried Rice, Black Pepper Chicken) were extremely salty.

site_logo

Ai Luan . 2024-10-07

MORE AT Google

I went there with my friends for a nice lunch but we were really disappointed by the chicken fried noodles as it was very cold and not proper taste of any spice, the chicken fried with garlic was really oily that I had experienced bad stomach and also the chicken wings taste awful. Never experienced such bad service from the staff As he was very rude towards us. I wouldn’t recommend this place .

site_logo

Shital Bashyal . 2024-10-05

MORE AT Google

Great stuff and great price. Owners sound angry but i think its just their accent

site_logo

User 1 . 2024-10-02

MORE AT Google

One of the previous reviewers got this place spot on with its lack of kerb appeal amongst some of the other eateries in the area but as they also said at least you could walk in when a lot of those other places are fully booked. Yes it’s a bit rough round the edges but the food was fine and although I’ve never been to China I’d imagine the food here is closer to how you might get it there. I found the waiter to be cheerful and friendly so seemingly different from those encountered on the negative reviews. Not Michelin starred but hit the spot for a quick eat and would certainly return.

site_logo

Nos6 . 2024-09-24

MORE AT TripAdvisor

The best authentic Chinese food in town, love the Chili Pork and Aubergine.

site_logo

Vansh Agarwal . 2024-09-10

MORE AT Google

Food have no taste:/ Chinese kitchen supposed to be full of flavors not bland, I needed salt and pepper from my kitchen

site_logo

Scrooge . 2024-08-30

MORE AT Just Eat

Very sad. Been here several times and food was great. Sadly,today was terrible. Staff were inattentive. Service was slow and there were only two tables. We were served dishes five minutes between each other and when we revived pur main dishes, they were cold in some places as if they'd been in the microwave. Very sad. Will not co.e back again as it seems to have gone downhill

site_logo

Harry . 2024-08-23

MORE AT Google

Foods are too oily, taste bland, portion is ok.

site_logo

Chan Keat Ying . 2024-08-20

MORE AT Google

Quality of food was poor, sweet and sour pork seemed like scraps and was inedible, and chicken with black bean sauce had no flavour. Portion sizes were small and dry with very little sauce. Even the drink, a picture of bottle of coke and received a can, price was £3.50 for a can of coke!!

site_logo

Martin . 2024-08-17

MORE AT Just Eat

The worst Chinese restaurant I’ve ever been to. Service was awful, dirty, decor lacking and cleanliness below average. Food was Grim.

site_logo

K H . 2024-08-12

MORE AT TripAdvisor

Qianqi is not good at eating sweet and sour pork Sweet and Sour Pork without any leftover meat is considered Gulu The rest of the food is fine in portions, expensive, and not particularly delicious.

site_logo

icecream white冰淇白 . 2024-08-03

MORE AT Google

Totally unhygienic unworthy and unprofessional

site_logo

Taimoor Tariq . 2024-08-02

MORE AT Google

We had the food delivered so we don't know what the restaurant is like. We ordered fried rice with chicken and 2 times plain rice. We got 3 portions of fried rice with chicken. Not so great when it has to be mixed with the other filling We got. Dumplings were sticky and not tasty at all. The wonton soup tasted of cabbage. The bucket with soy was in the bag instead of in the bucket. So all in all not the best experience. The meat tasted lovely and was tender.

site_logo

Mette Kiilerich . 2024-07-18

MORE AT Google

Salt and pepper tofu was average, did not really taste of salt and pepper and had no crispy coating. Atmosphere was chaotic.

site_logo

Anish S . 2024-07-15

MORE AT Google

Could not in good conscience recommend this restaurant. The service and atmosphere were without question terrible. Others who chose different menu items might have had better food but the sweet and sour pork was hard, dry, thin and very chewy. It also left a very unpleasant artificial sweetness in the mouth after eating. The Tiger beer was good.

site_logo

M J . 2024-07-11

MORE AT Google

Very small portion for take-out !

site_logo

JC. . 2024-07-05

MORE AT Google

solid authentic chinese food - large portions, cooking done right! noodles were made with the right type of flour, meat was perfect texture 👍👍

site_logo

Jessie Cho . 2024-06-23

MORE AT Google

The cup was broken and the Taste of de bubble tea is not that good. The ice was meldet.

site_logo

Tina . 2024-06-21

MORE AT Just Eat

The place is ok, not the best, but they do fine.

site_logo

Felipe Covolam . 2024-06-18

MORE AT Google

Chinese food in Cambridge looks delicious but is not halal

site_logo

المدينه عشقي . 2024-06-01

MORE AT Google

A very decent and (if I'm allowed to use the word) authentic Chinese restaurant, excellently located on Bridge Street. Upstairs has the normal 'daytime' seating you'd expect and downstairs larger round tables with lazy Susans. The toilets are also downstairs, next to the kitchen (which seems busy); small but clean enough. The food was very good, indeed, though service can be a bit hit and miss. The decor is basic but it all does the trick. Prices are ok, too, as are the portions. I know there are other, possibly better, Chinese restaurants in Cambridge but this one definitely hit the spot and all things considered we'll probably be back.

site_logo

JP . 2024-05-31

MORE AT Google

Visited this weekend whilst in Cambridge, great food but be careful as the portion sizes are larger than most, did take doggy bags home though so got to have it again next day, recommended!

site_logo

137nigel1965 . 2024-05-28

MORE AT TripAdvisor

The food was excellent so much to choose from and the portions were large the service was also great we asked for slight change to our choice and they changed it no problem it was very well frequented would definitely recommend

site_logo

Carol Armstrong . 2024-05-26

MORE AT Google

Singapore noodles were over cooked and tasteless, beef ho fan was just one big lump of noodles and lacked flavour and the ribs and dumpling were mediocre. Won't be ordering from here again.

site_logo

Guy . 2024-05-12

MORE AT Just Eat

If I could give zero stars I would, we waited 40 minutes, and she forgot to put the order through. The restaurant is so dirty with stains on the table and chairs. They are racist, just avoid this place and don’t waste your money here, many places further down instead.

site_logo

Natasha Vistas . 2024-05-04

MORE AT Google

Delicious restaurant recommendations

site_logo

Hui Guo . 2024-04-22

MORE AT Google

Recomend chinese canteen very good food, specially wok cooked pork.Szechuan food all good,sweet sour food all good.spccial fried rice very good.

site_logo

匆匆 d . 2024-04-22

MORE AT TripAdvisor

I came to Cambridge today and found a gourmet restaurant. The Chinese canteen has good service and authentic food. I will go there again next time.

site_logo

刘凤兰 . 2024-04-18

MORE AT Google

It was super cold today while boating with my friends. When I saw a Chinese restaurant, I immediately walked in and ordered some steaming meals. The portions were generous and the taste was authentic. It was very delicious. The service attitude was super good because I wanted to eat Guobao Pork, but My friend doesn't eat pork, so the waiter recommended that we try the pot fish🐟. We accepted it and the taste did not disappoint us. It was a very satisfying lunch and worth recommending.

site_logo

duan匆匆 . 2024-04-17

MORE AT Google

Nice place to eat authentic Chinese food .

site_logo

Wang Zijing . 2024-04-17

MORE AT Google

Very friendly staff, makes me feel right at home, the dishes are well prepared and the unlimited rice refills are great! Overall a great Chinese place.

site_logo

Rhys Ho . 2024-04-02

MORE AT Google

Yummy, authentic Chinese. Collection order ready on time.

site_logo

Charlotte . 2024-03-31

MORE AT Just Eat

The food is bad, very high in MSG. The waiter insists that the 10% service charge is not optional and is a must to chinese customers unless they pay by wechat or cash to help them evade tax. Must report them!

site_logo

R N . 2024-03-30

MORE AT Google

chicken satay like rubber and sauce wasn't peanut at all dry noodles very disappointed 😞

site_logo

Jake . 2024-03-28

MORE AT Just Eat

Poor quality food - convinced its high is MSG, long wait time between plates, terrible decor. Will not return.

site_logo

India Harding . 2024-03-15

MORE AT Google

I really love Chinese Canteen. They make the best quality foods, and I especially love their foods with aubergine. :) Thank you, Guys! :)

site_logo

Katalin . 2024-03-15

MORE AT Just Eat

Food was...edible. When I've been here before, the Singapore noodles were great. But this time, the prawns are what stood out, they didn’t taste like prawns but overly fishy. Not much flavour in the chicken or the sauce. just in the fresh ginger

site_logo

Elliot . 2024-01-30

MORE AT Just Eat

Their food is scrumptious 👌👌👌 without any hesitation feel free to go for it. I have not had tastier Chinese food than this in the UK. I discovered this on my first day trip to Cambridge in one summer and since then sometimes I travel from South London to Cambridge just for their lovely food, and last but not least their service is lovely and friendly bunch of people. Deserves full on 5 star.

site_logo

Shuvo Amin . 2024-01-18

MORE AT Google

Brilliant delivery time. Food was excellent

site_logo

Anthony . 2024-01-11

MORE AT Just Eat

The sweet and sour sea bass was sensational. Stir fried mixed vegetables were the best I’ve ever had. Friendly and helpful service.

site_logo

Cecily123 . 2024-01-07

MORE AT TripAdvisor

Recommended by a Japanese friend :3 it’s indeed better than I expected. A solid 4.5 at this price range. Tianjin bun looks to be handmade. It’s different from the fluffy yeast dough common in northern China and appears similar to a more robust xiaolong. I’ve never been to Tianjin so I can’t comment on the authenticity. Perhaps they do have the particular variety. The dough has an enjoyable thickness. The meatball filling is tender and bouncy, not too fatty. It’s seasoned with soy sauce and slightly sweet unlike the Shanghainese version. Mapo tofu is brilliant even without minced pork. The seasoning is just right and the tofu retains its shape. It’s a very common and simple dish, but it isn’t easy to make a good one. Huiguorou is flavorful. The pork has about 30%-50% fat, but traditionally it was quite fatty. Black fungus can have a little more vinegar in the sauce but is otherwise a crispy starter. The problem with almost all Chinese restaurants out is that the food are too oily (western cuisines arguably has hidden oil in the food anyways). The people at the restaurant are friendly and efficient. It wasn’t too busy when we visited in the festive week. Vibe wise, there’s no background music and the place does give a canteen-like feeling.

site_logo

X . 2023-12-28

MORE AT Google

The worst is the sweet and sour pork, all of it is fried rice noodles, and the noodles are meatless! Ask the boss. He talks so sharply. Dog food, steal of money

site_logo

Neil Cheung . 2023-12-25

MORE AT Google

Excellent Chinese food. Very tasty and home made. I definitely recommend

site_logo

nordon clementine . 2023-12-15

MORE AT Google

Not only late but bag very mixed up meaning that a lot of sauce and liquid was all over the rest. Very dissappointing.

site_logo

Jan . 2023-12-08

MORE AT Just Eat

Hi, The food is delicious, however I am a bit disappointed that the main dish was delivered without rice. If rice is purchased extra, I would at least expect that this would be highlighted somewhere throughout the ordering process. This way I feel a bit cheated, because I received a sauce and nothing to eat it with.

site_logo

Ema . 2023-12-03

MORE AT Just Eat

Absolutely delicious! Definitely recommend it.

site_logo

Mihaela Cracana . 2023-11-14

MORE AT Google

i never received my food but it says delivered??

site_logo

Suvitha . 2023-11-09

MORE AT Just Eat

Food has no flavour, very disappointing

site_logo

Jack . 2023-11-03

MORE AT Just Eat

Poor quality pork for my sweet and sour pork dish. Not proper pieces of meat. Seems to be scrap or discarded meat cooked and served to me.

site_logo

Xian . 2023-10-15

MORE AT Just Eat

Ordered my food at 17:30 and given estimated time of delivery for 18:25. Message saying my food was delivered at 19:18 when it hadn't and called the restaurant to be told it was on it's way. Called again at 19:50 as food still hasn't arrived, staff was rude and told me to sort it out myself and ended my call. After waiting for nearly 2 and half hours, no food and money taken out of my account. If I could give a minus, I would.

site_logo

Ginny . 2023-10-01

MORE AT Just Eat

Great food. Delicious!! Would go again.

site_logo

Kripa Saji . 2023-09-04

MORE AT Google

Had the chicken fried rice, tofu n soup.. tasty and good portions..well done guys

site_logo

asim ghosh . 2023-08-29

MORE AT Google

Good food, but we had to wait a long time to order it. We ordered a cola that did not arrive, but they deducted it from the bill when we told them.

site_logo

Les Bell . 2023-08-09

MORE AT Google

My favourite Chinese restaurant --- great food and very friendly service

site_logo

Jacob Haddo . 2023-08-08

MORE AT Google

We sat for 15 minutes whilst the waiter passed us by and served people who arrived later. When I called him he said bye bye...blatant racism

site_logo

JackieBridget2 . 2023-08-04

MORE AT TripAdvisor

Good portion sizes and flavour. Delivered 30 minutes after we ordered on a Saturday evening. Would have been better if there were more pancakes with the crispy duck.

site_logo

Graeme . 2023-07-29

MORE AT Just Eat

Nice place but unbearably hot in summer, no ventilation. They seem to have AC but don't turn it on

site_logo

Suf Amichay . 2023-07-08

MORE AT Google

Given 5 stars for the food and value for money. We've been here a few times now and really like it. It's a bit quirky and has a canteen feel to it... Basic furniture etc. And the 'artwork' on the wall is.... A little 'thrown together' Each time we've been there seems to be lots of people speaking Cantonese to the waiter, and the menu is transkated for this which we take as a good sign. Its also well located among the colleges and near one of the two main punting rental locations.

site_logo

Pete Mc . 2023-07-02

MORE AT Google

Return to the canteen whenever we need a quick and tasty lunch in Cambridge. Located by Bridge street just as it passes over the River Cam. The restaurant may be called the canteen, but, it is far more than that. A good and comprehensive menu also a midweek lunch menu. Great tastes and flavours, Cambridge has many Chinese Restaurants but most are hit or miss. The Canteen is consistently good. It can be busy if a coach load of trippers arrive ,but ,is still worth the visit.

site_logo

valtojos . 2023-06-26

MORE AT TripAdvisor

Had a lunch with my wife there while we were touring Cambridge today. Authentic Chinese food, good service, very reasonable price. Considering it is in such a busy touristy area, the quality of food and its price are very pleasant surprise to us.

site_logo

Mike Hao . 2023-06-18

MORE AT Google

The Yuxiang Aubergine has to be the best aubergine I have ever had in my life. I have had this dish multiple times from Chinese Canteen to ensure that it wasn’t a fluke and it has never disappointed. The restaurant deserves 5 stars for that dish alone

site_logo

Shershah (TheShersh) . 2023-05-27

MORE AT Google

4.5! Tasty food, really enjoyed it. Staff were helpful and polite. One of the better Chinese restaurants in Cambridge. Would recommend.

site_logo

R . 2023-05-08

MORE AT Google

Tasty and very good in quality and size.

site_logo

Annie An . 2023-05-02

MORE AT Google

Wow. Very nice, authentic Chinese food. Would go back anytime!

site_logo

joaquimspeck . 2023-05-01

MORE AT Google

Would highly recommend visiting whilst in Cambridge. The food was amazing and the staff were kind and lively

site_logo

smit malvankar . 2023-04-29

MORE AT Google

Really nice meal delivered with an efficient and friendly service. Highly competitive delivery rates too!

site_logo

Chris . 2023-04-17

MORE AT Just Eat

I was here for a couple of hours during my Cambridge trip and oh my god!! the food was so amazing. We had special fried rice and beef noodles but the rice was so good we ate it All up before we remembered to take pictures 😂😂. will definitely be back, great service and food 👌

site_logo

Jennifer . 2023-04-03

MORE AT Google

Great food! The service is fast but expect it to be Asian style you get your dishes in a more or less chaotic sequence. More vegetarian options would be nice.

site_logo

Allard Mosk . 2023-03-22

MORE AT Google

One of the Best Chinese food in Cambridge. Authentic and good price. Very clean and friendly environment.

site_logo

Yue Li . 2023-02-04

MORE AT Google

My absolute favorite Chinese restaurant in cambridge

site_logo

Maddie Haden . 2023-01-23

MORE AT Google

Thoroughly enjoyed our meal & good service from just eat

site_logo

Joanna . 2023-01-19

MORE AT Just Eat

Food way too salty. Over price. Overall average.

site_logo

Kiran Grg . 2023-01-15

MORE AT Google

My favourite restaurant in Cambridge for years!

site_logo

Abhimanyu Sharma . 2023-01-07

MORE AT Google

Tasty Kung Po Chicken with some heat. Very enjoyable.

site_logo

Steve . 2022-12-23

MORE AT Just Eat

A lovely blend of well cooked chicken bites with the texture of peanuts supported by chilli and other spices. Lovely. Will order again.

site_logo

Steve . 2022-12-20

MORE AT Just Eat

The food tasted stale. This was a large order and much of it was not edible. Sorry

site_logo

Lisa . 2022-12-16

MORE AT Just Eat

Amazing food. You can taste it is freshly made. Piping hot when delivered.

site_logo

Justyna . 2022-12-05

MORE AT Just Eat

Big thank you to the delivery man, appreciate your hard work in such poor weather!

site_logo

Judith . 2022-11-03

MORE AT Just Eat

Order cancelled at last minute! Regular client any very local. Always happy with their food but last order was abruptly cancelled whilst driver was collecting from restaurant. No explanation. Nothing.

site_logo

Gary . 2022-10-10

MORE AT Just Eat

the dumplings were all squished up and soya sauce was split all over the noodles had to throw them in the bin

site_logo

jennifer . 2022-09-26

MORE AT Just Eat

Overly gloopy MSG laced Chinese food for the undiscerning.

site_logo

Duncan Willis . 2022-09-25

MORE AT Google

If you love Chinese then this place is a must go. The food was flavourful, inexpensive and good portions. I was not disappointed at all. The service was also pleasant and helpful.

site_logo

Yanique GB . 2022-09-10

MORE AT Google

Really good service, meal was great, portions big.

site_logo

Adam Thompson . 2022-09-10

MORE AT Google

Loved it! Every time we go there food is excellent!

site_logo

Artur Myszka . 2022-08-19

MORE AT Google

Similary restaurants in East of England

restaurant_img
3.8

269 Opinions

location-icon57 Regent Street
Chinese
outdoor_seating_105755takeaway_105755delivery_105755

A hidden germ in Cambridge. Extremely satisfying and scrumptious experience. Outstanding stewed beef brisket casserole, Chinese cabbage stir fry with vinegar, Singapore fried rice noodle which my family all agree are even better than those in most of Hong Kong restaurants. The crispy pork belly and veg dumpling are nice They also offer a good choice of vegan dishes which are particularly appealing to me as a vegetarian. The ramen chef js not around unfortunately so my son went for shredded pork & preserved veg homemade thin rice noodle but he found yummy as well. They are offering 50% off for today and tomorrow another big surprise and bonus for us! Great staff with excellent service with nice atmosphere. Seating and layout are spacious. Chuhou Beef Brisket and Carrot Bao: Super high quality! ! ! Vinegar braised cabbage, Xingzhou fried rice: unexpected surprise, delicious! ! Pickled mustard pork rice noodles, tofu and leek dumplings, garlic rapeseed: delicious! Lots of vegetarian options! Another unexpected surprise: half price today and tomorrow👍🏻😃🙏

restaurant_img
3.8

82 Opinions

location-icon2 Arbury Court
Chinese
outdoor_seating_195334takeaway_195334delivery_195334

Best takeaway in Cambridge. Every dish is very tasty !

restaurant_img
3.8

1187 Opinions

location-iconNo.54 Mill Rd, Cambridge, Cambridge CB1 2AS England
Chinese
outdoor_seating_259210takeaway_259210delivery_259210

delicious food with a varied menu. super flavourful

restaurant_img
3.7

734 Opinions

location-icon66 Regent Street
Chinese
outdoor_seating_106302takeaway_106302delivery_106302

The food is hit and miss. We visited last week and the food was good so decided to go again. This time one of the two mains was inedible, absolutely dire. The place is mostly empty.

restaurant_img
3.9

300 Opinions

location-icon191 Histon Rd
Chinese
outdoor_seating_107013takeaway_107013delivery_107013

Our go to takeaway food is always delicious well cooked and hot when delivered