GastroRanking-logo
whatsappWhatsapp
phoneCall
desktopWebsite
menuMenu
bookingBooking
4.5

Based on 193 opinions finded in 1 websites

site_photo4

Nº 162 in 770 in Wolverhampton

Nº 18 of 57 Indian in Wolverhampton

CUSTOMERS TALK ABOUT DISHES WITH..spicylambcurryfishcookedprawnsricechillimeatpaysalmonchickenmust
Score
OpinionsNoteTripAdvisor1934.5

comment_iconOpinions

Went first time for a family weekend dining based on reviews provided but it was utter disappointment. No proper cutlery served we had to ask twice, drinking glasses felt not properly dishwashed - stain and marks on the glass , soft drinks ordered without ice was completely warm no even refrigerated. Meat platter Starters ordered were just lightly lukewarm not even piping hot and was very dry served without chutney which is not a common gesture. I was hugely disappointed for my spending on not to the mark expectations...

site_logo

jayshri15 . 2020-08-16

MORE AT TripAdvisor

the food was lovely the staff was top class service due to this tough time it was nice to come to a lovely restaurant

site_logo

David_19580000000 . 2020-07-27

MORE AT TripAdvisor

Fantastic meal carnt fault anything lamb chops were amazing we even took a portion home with us .staff were fantastic and professional in the strange time of social distancing all handled very well . Carnt wait to eat here again .

site_logo

389mintc . 2020-07-06

MORE AT TripAdvisor

We were visiting the Ramada hotel and this restaurant was very convenient for us. We were delighted with the service and food. The lamb chops and Rogan Josh were both superb! Good value as well!!

site_logo

StevoCat . 2020-03-22

MORE AT TripAdvisor

I had been working all day so just needed a decent meal. Had a great meal here and very tasty and fresh.

site_logo

Dip17 . 2020-03-06

MORE AT TripAdvisor

My friends booked Anju’s for dinner. We are all mums and it can be difficult to meet up so when we do it is a treat.We were greeted and shown to our seats by our waiter.Our starter came out i must say wasn’t the best the chicken was soo rubbery, nonetheless we ordered our main which took around 25-30mins to come. The waiter was so uninterested in his job plonked the food and left. There were no utensils on the table they were removed with our starter plates, we had to take them off the empty table next to us.No one came to check if everything was ok with a meal. Plates were removed but then no one came to ask if we wanted dessert. We waited for ages eventually I had to get up and ask to be served.The waiter came to our table and asked what we wanted we had to tell him we needed dessert menus to choose which he went and got.Desserts ordered (which by the way weren’t much of an option).Rupen rai (Oriental chap) came and gave us our bill but we were left sat there for ages, which i had to get up again and ask if someone could come and take payment from us.I asked the lady taking payments if i could speak to the manager.There wasn’t a manager on shift instead the supervisor who was our supposedly waiter Rupen - I advised we wasn’t happy with the service we received tonight, if there was anything he could do that would salvage the night for us, as expected without hesitation he said no nothing he could do. His only explanation was it was a busy night for them, my friend who had been before advised Rupen it was not busy as she has been previously and she has seen it busier. There were tables around us that were empty... which he seemed to accept and report he could only apologise. I stated I would be making a complaint to his manager. Asked him for the managers details which he then stated there was not a manager. I chose not to believe that he then went on to say he is currently on leave. I asked for the managers name and email but he advised he did not know it only that his name is Vinith (didn’t know surname- can you believe that? How do you not know your managers full name). He gave me his own email address and stated he would pass it on to the manager. Given he had lied about there not being a manager initially i cannot trust he will actually pass the email on.This was a very disappointing night for us especially as mums we look forward to these rare nights out.I have been to many restaurants this is by far the worst service i have ever recieved!I would not recommend anyone to eat here, they do not deserve your hard earn’t money.

site_logo

G-K-Bansal . 2020-02-09

MORE AT TripAdvisor

We were treated to dinner at Anju by relatives we were visiting in the area. Quite simply, the best Indian cuisine my wife and I have ever tasted. We went back on our own a few nights later it was so good.

site_logo

BillySinclair . 2020-01-22

MORE AT TripAdvisor

Attend New Years Eve dinner at Anjus's Restaurant 2019, we have been coming here for a very long time and have always recommended our friends to the restaurant. Food as always is of a very high standard however I would like to point out a few things that spoilt the evening.Firstly, in the gents toilet the mixer tap had been broken off therefore unable to use, unfortunately before I realised this I had used the soap on my hands. Unable to use the tap as there is only one wash basin I had to walk downstairs through the restaurant back outside and into reception and use the gents there to wash my hands before heading back to the restaurant. Secondly I always find the restaurant too cold, looking around I could see another couple with a coat on and my wife had to do the same.Thirdly the music is to load it should be background music.Overall food was excellent spoilt by a few major issues which will put customer's off attending as there are far more reasonably priced Indian restaurants available. Charging £35 per head before 9.30pm & £40.00 after 9.30 think was a mistake as the restaurant was empty. Anjus's is not the cheapest and it won't be long before you price out the locals, charging £5.75 for a pint of lager is scandalous, I am a loyal customer however if I don't share my experience then nothing will change and you will carry on thinking all is well.

site_logo

easyfoods . 2020-01-02

MORE AT TripAdvisor

Attended recently for a family bday meal with over 10 people. I've been a customer since this place was called Kavis, and Kumar always took care of things to a tee. I have to say, whilst the food was amazing as always, service was not as on par with a few loyal customer benefits lacking due to change of management. Management style is not quite suited to the type of customer that walks through the door here but maybe in time this will get better. I might not find out though, as we might not be back to be honest, which is a shame because in my opinion this is otherwise the best Indian restaurant in Wolverhampton by far.

site_logo

Bunny K . 2019-12-01

MORE AT TripAdvisor

On approaching restaurant we thought it was shut as rooms next door were dark! Had looked for elegant up-market interior for celebration supper but found everything tired and the Asian inspired decor shabby. Staff - apart from one oriental chap - were utterly dis-interested in their customers. I asked for a beer and simply received a bottle plonked on table but offered no glass. Chose duck in a spicy 'orange and onion' sauce. Foul. The onions or garlic tasted burnt, the sauce bitter and not a sign of the orange! Couldn't eat it. We were asked by the oriental waiter if anything was wrong - I explained. He was most helpful and apologised warmly. He asked the Manageress to waive the cost of the one meal but she offered 50% off the one meal instead. What was worse was there was no apology at all from the Manageress, who seemed utterly focused on checking the till receipts. And all of this set against the appalling noise from a giant Bollywood filled screen. Never again and not what we are used to in Wolverhampton which has superb Asian restaurants. Wish I'd gone to Penn Tandoori!

site_logo

Jacqueline S . 2019-11-13

MORE AT TripAdvisor

I don’t even know where to start!The surroundings and decor are lovely, shame about the rest of it!! We were a party of 10 there for my husband’s birthday on a Saturday night. The restaurant was not particularly busy as it was early evening.The waiter seated us and came to get a drinks order and then disappeared. The drinks took over 20 minutes to arrive. One of the diners had ordered a lemonade which was flat, we asked for this to be replaced only for it to be replaced with another flat drink. On asking they said it was a new bottle so could not be flat. They didn’t bother replacing it.We ordered a variety of curries (8 different ones) on arrival they looked identical, it looks as if one sauce is used, they then throw in chicken, prawns, vegetables….take your pick!!!Not only did they look the same they tasted the same!! All the vegetarian curries were very sweet and rather bland. Not authentic at all and certainly don’t live up to the menu description. I’ve never been out for an Indian meal where the waiter doesn’t know what curry he is serving. He had to use a spoon to try and figure out what he was giving us. To make matters worse he stood at one end of the table and asked us to pass the food down to the right person rather than actually putting it down in front of the person who ordered it. Service was really sloppy with them forgetting to bring naan breads and then not bringing the amount we ordered. We expected a better level of service particularly as they lead you to believe this restaurant is more upmarket. Service was slow and really for the prices they charge we expected a more upmarket experience. I wasn’t actually going to write this review as I did write to the hotel initially, several weeks have gone by and I haven’t heard a word from them. I understand things go wrong however sometimes how a complaint is dealt is important, in this instance they choose to ignore my email which really doesn't say much about their customer service.I would not eat here again, food, service and customer service made it a very poor experience.There are far better eateries serving authentic Indian food less than a mile away, I would opt for one of those.

site_logo

Nicki K . 2019-10-17

MORE AT TripAdvisor

Just eaten here again, 1st time in 3 years and yet again the place was stunning. From the moment Partha greeted us and showed us our table and took our order in a pleasant but professional manner, to the excellent table service and friendliness of Alex. The food was amazing just like the last time, cannot recommend Anju's highly enough. Excellent

site_logo

Scott C . 2019-09-23

MORE AT TripAdvisor

We were staying at the hotel and were advised to eat here so we ate both nights great food and good service a very pleasant evening. Krish was top class and always had a smile.

site_logo

BarryHobson . 2019-09-11

MORE AT TripAdvisor

Good food, generous portions. Restaurant was very busy so sat in the bar area and had the meal which shows its popular. Small menu with some different options to normal Indian restaurants. Good portions Limited choice

site_logo

CymroGreg . 2019-09-04

MORE AT TripAdvisor

Great service, friendly staff and brilliant tasty and well presented food at affordable prices for a group of friends night out to celebrate multiple birthdays. Anjus food never disappoints. Good choice for both veg and non-veg menus. Very comfortable atmosphere and great decor. Ample parking.

site_logo

Prab2001 . 2019-09-04

MORE AT TripAdvisor

The dinner in the Anju's restaurant could have more variety for dinner within price for the hotel accommodation as it had very limited starters and main course.

site_logo

19sana21 . 2019-08-29

MORE AT TripAdvisor

Wow 1. The food is very very good. But.....and I don’t like doing this but needs to said.

site_logo

bloopster . 2019-08-26

MORE AT TripAdvisor

Ok, so I booked a table online for the Orangery Restaurant that was at the Ramada hotel. However there was a wedding party tonight so couldn't go.

site_logo

cliftonjonny . 2019-08-09

MORE AT TripAdvisor

We have been to Anju's a few times and always had a good experience but when we went on Sunday 30th June for my sons birthday with my family i was left disappointed the service was poor the staff only seamed to be interested in looking after a large party which was happening in the lower section.

site_logo

TJP1965 . 2019-07-03

MORE AT TripAdvisor

I felt I had to write to say just how lovely this wonderful restaurant is , we arrived far to early for our meal , but we were seated straight away , the service is second to none , after a few hellos we ordered our meal , the quality was exceptional as always , we were never rushed which is important to my husband and myself ,, we couldn't order a desert as we were far to full , the portions are a good size , we try to come here at least once a month , its our treat , and I would recommend anyone that this is just the best place to eat , thank you again for a great night and see you soon

site_logo

jean190762 . 2019-06-29

MORE AT TripAdvisor

Had my 50th birthday at Anjus. Jasmine the mangers made everything perfect for the day. Great service. And all my family and friends enjoyed the meal. Can't recommend jasmine enough 5***** all the way.

site_logo

Jasbinder C . 2019-06-16

MORE AT TripAdvisor

I have dined in here few times now and the food is always top notch. You can sit in the restaurant looking at th fish and waterfall and relax with a few drinks from the bar after a hard day at the office

site_logo

Davidlockwood16 . 2019-06-13

MORE AT TripAdvisor

Stayed at the hotel over a period of 6 months. Usually ate at Anju. The quality was exceptional every time consistently good. Jasmine the manager has good leadership skills and shows her staff how to be the best. Previously stayed near Southall for six month this place is much better.

site_logo

Louisesy . 2019-05-27

MORE AT TripAdvisor

Had a lovely meal here recently while staying at the hotel. Exceptional quality which exceeded expectations served by friendly staff all well presented and who obviously have a pride in working there. Highly recommended

site_logo

omahony . 2019-03-20

MORE AT TripAdvisor

Great food and interior. Highly recommend as good quality Indian food and reasonably priced. Also seemed to have the option of having indian food In the restaurant or in our room as the hotel we stayed in is attached. Service was mixed. Initially we were seated on our own downstairs under bright lights which unfortunately was a bit of a mood killer and also hurt my eyes (my issue only). We were kindly moved to another part of the restaurant. We asked for water which we didn’t get but other than that and a couple of other small things it was fine. They were polite and friendly there.

site_logo

Lorenzo558 . 2019-02-20

MORE AT TripAdvisor

What can we say,from start to finish,excellent,Kumar made you feel so welcoming,food was to die for,malai chicken just melted in your mouth,definitely will be back,thank you all for a great evening,special Kumar,thank you Bruv,

site_logo

scotsangha . 2019-02-18

MORE AT TripAdvisor

This is by far best Indian restaurant in Wolverhampton everything is freshly cooked and you can taste the difference from this restaurant to your Normal Indian

site_logo

lynch87 . 2019-01-22

MORE AT TripAdvisor

Given the good reviews I was really looking forward to having our New Year's Eve meal here. We left booking a bit late but struck lucky when we were told we could have their last table although I did notice that apart from one table, the bottom half of the restaurant was empty when we left.

site_logo

CurryholicDudley . 2019-01-01

MORE AT TripAdvisor

Nice location, plenty of parking. Welcomed by staff and taken to table. Friendly and helpful. Tasty food. Good selection of dishes including vegetarian. Been there several times as a couple and with extended family. Consistent service.

site_logo

Ash D . 2018-12-18

MORE AT TripAdvisor

I stayed at the Ramada hotel on a business trip and I was very excited to find there was an Indian restaurant attached to the hotel! We arrived at 9pm after a long drive and went straight there. Ordered some kingfishers and sat down. The staff was very welcoming.

site_logo

Lew216830095 . 2018-11-15

MORE AT TripAdvisor

Very impressed with this place - sophisticated decor, yummy food, but most of all customer service was amazing - very accommodating to my specific dietary requirements - thank you! Very polite team, thank you very much to Kumar and Rahul in particular :)

site_logo

aashnaramnani . 2018-10-21

MORE AT TripAdvisor

we couldn't think of anywhere better to go for my husbands birthday than here , we came with our two friends who just love this place , on arrival we were greeted with warm handshakes , the service from start to end was wonderful , the food was amazing as always , we were offered cocktails which were delicious ,, we will always recommend Anjus to everyone , thank you all for your hard work in making my husbands birthday such a special night x

site_logo

jean190762 . 2018-10-06

MORE AT TripAdvisor

Anju’s seems to have some of the best credentials needed to be a premium Indian restaurant. Four chefs, each claiming international experience with some of the most prestigious hotel groups in India, a very good location and a beautifully designed restaurant. It’s almost inconceivable that it could suffer any bad reviews or even negative comments yet it’s not perfect.

site_logo

Lewis S . 2018-08-19

MORE AT TripAdvisor

This is part of the Ramada park spa hotel.

site_logo

Telhussain . 2018-08-15

MORE AT TripAdvisor

The service wasn’t brilliant but I’ll forgive that for the absolutely fantastic food. Four of us had four different dishes and all were above our best expectations. So tasty. Tarka dahl was the best I’ve ever tasted. Both lamb signature dishes were beautiful. Nans we’re excellent, and above all, there was no oily residue on any of our plates at the end of the meal. Portions were plentiful and there was more than enough rice per portion. And that brings me to the first of my couple of minor complaints. I had vegetable rice. Well there was okra on the menu so I was looking forward to some interesting veg in my rice. I’m afraid I only got peas, diced carrots, and a single broad bean in it. I’d been expecting something more interesting. It was well cooked rice but the bland uninteresting (tinned mixed?) veg added nothing. My second minor niggle was that we had to ask a waiter for a jug of water twice and wait 10 minutes for it to arrive. Also, I’d finished my Kingfisher lager half way through my meal and I wasn’t offered another until the plates were cleared and I was ready to get the bill. Too late. That said, I would put up with the mediocre service and would go there again in a heartbeat for the fantastic food.

site_logo

600carly . 2018-07-28

MORE AT TripAdvisor

We booked a table for 12 people on a Saturday evening and 14 of us turned up, this was no trouble for them. Plenty of parking, lovely decor, staff very friendly. Drinks orders taken on arrival, starters and mains were all delivered to us correctly, food was delicious. Will definitely return here!

site_logo

sholea1 . 2018-07-22

MORE AT TripAdvisor

We come to this restaurant regularly and we recently had an event in their ballroom. It was a fantastic night! Whenever we eat at the restaurant the staff are friendly and the food is well priced and appetising. The only problem I have is that it gets really busy but you can’t really help that. The decor is amazing and the best indian restaurant in the area. There has never been a time where they have let their reputation slip. 5 STARS ⭐️

site_logo

hreview533 . 2018-07-19

MORE AT TripAdvisor

I really enjoy staying in the Ramada Hotel connected to this restaurant and the the quality of the food and service in Anjus is always excellent: It’s well worth a visit and a chance to try flavours outside the usual ‘comfort’ zone !

site_logo

Alan P . 2018-07-04

MORE AT TripAdvisor

One of the best Indian restaurants I have ever been too. Every dish superb especially the chilli paneer starter. Will be back!!

site_logo

JuliForrest . 2018-06-30

MORE AT TripAdvisor

Anjus is our favourite indian restaurant ever , we have been going there for just over 3 years and the customer service is second to none , it is wonderful , and the food is Amazing , , I usually stick to the same Chicken Tika masala , but my hubby has tried nearly every thing on the menu , he has never been disappointed , I would certainly recommend Anjus to everyone who likes curry ,

site_logo

jean190762 . 2018-06-30

MORE AT TripAdvisor

I booked this restaurant easily through my hotel and walked through an empty conference room to get there.

site_logo

Sugarfree_candy . 2018-06-21

MORE AT TripAdvisor

Extremely tasty food, me, my siblings and my mom loved it. The staff were helpful and approachable, Kumar was especially welcoming!

site_logo

nihalchanian . 2018-06-15

MORE AT TripAdvisor

The staff were friendly and welcoming. The decor was a welcome change from standard Indian restaurants - interesting fish tank in the floor. We have travelled around India extensively and stayed and eaten in many of the restaurants that were mentioned in the cvs of the chefs and the food was certainly up to the standards of the food. we have experienced there. The popadom basket was a mixture including toated black peppercorn ones that are not usually available. The basket was large and the mint dip made with fresh mint was a refreshing. We had a range of dishes that were all subtely spiced and different tasting. The biryani was done in a traditonal dum style in a sealed pot with pastry cover which seals in the flavour - it was aromatic and delicious . The chicken chettinand had a real kick and was not overpowered by coconut as sometimes it can be. The portions were generous and well presented. The main courses were reasonably priced but the starters seemed expensive. We were all too full have desserts. A great evening and will certainly be going again.

site_logo

sila60 . 2018-06-04

MORE AT TripAdvisor

My wife and I visited Anju's last Saturday evening, ( We were staying at the Ramada Hotel, for a Spa weekend). We received a very friendly welcome and were swiftly shown our seats. The decor and furnishings are very classy and atmosphere very amenable. After...

site_logo

Andyroo41 . 2018-05-15

MORE AT TripAdvisor

Visited here yesterday. Waiter came for order. I asked if there was anything on menu with lentils like a Dhansak as it wasnt on the menu. He replied ' no' abruptly and turned to my husband for his order. We ordered popadums which were cold...

site_logo

MelodyFawn . 2018-05-13

MORE AT TripAdvisor

I was delighted to find that the first thing the menu here did was to introduce the chef's to the diner. Everything else after this lived up to their repute. The meal my partner and I had was truly a delight and we were served...

site_logo

Meredic . 2018-03-28

MORE AT TripAdvisor

Not great. There are better Indian restaurants in Wolverhampton and it’s not even cheap. Lack of good food available at the hotel is a problem given location

site_logo

Sarah H . 2018-03-06

MORE AT TripAdvisor

We visited Anju’s whilst stopping at the adjoining hotel. The restaurant is nicely decorated and has a fish pond feature and videowall with Bollywood style music videos being shown; nice. The service was ultra efficient and attentive and the food was delicious. 2 types of...

site_logo

Tony C . 2018-03-01

MORE AT TripAdvisor

A superb dinner featuring a wide variety of traditional dishes presented beautifully. Prices were reasonable and we would highly recommend Anju's and will come back if in the area again. Great evening!

site_logo

Graham B . 2018-02-26

MORE AT TripAdvisor

Never tasted one so delicious. Found the restaurant by pure chance but will come again soon. Staff couldn't do enough for myself and fiance. Pure pleasure!!

site_logo

Kelly A . 2018-02-22

MORE AT TripAdvisor

Superb meal. Quality and great service. Décor and attention to detail made it so much more than the usual corporate 'meal for one' Highly recommend. Thank you !

site_logo

Rob M . 2018-02-14

MORE AT TripAdvisor

We booked a table for 14 of us. Arrived at 8pm to be told they didn’t have a booking, despite paying £140 deposit. The Hotel had taken the booking and hadn’t passed it on to restaurant. They said if we go to the bar we...

site_logo

David J . 2018-02-11

MORE AT TripAdvisor

I eat in Anjus 2 or 3 times a week and absolutely love it. The food is consistently superb and...

site_logo

Noel F . 2018-02-09

MORE AT TripAdvisor

Visited with a few friends on a Thursday evening recently. Beautiful meal excellent sized portions and couldn't complain about the...

site_logo

Patrick O . 2018-01-25

MORE AT TripAdvisor

We ate here as the Orangery restaurant was full. The food was excellent but the service was poor. Our poppadums...

site_logo

Leslie H . 2018-01-11

MORE AT TripAdvisor

Six of us visited here for the first time. Weve wanted to try it for a while now and im glad we did. Menu is limited so not much choice. My dish chicken biryani was ok. My husband had a lamb dish and he didnt enjoy it all. All the others in our group thought the food was mediocre. I wouldnt visir again as its quite expensive too.

site_logo

goaaddict2 . 2017-12-24

MORE AT TripAdvisor

Arrived early but our table was read, a little cold where we were sitting as the air con was blowing cool air. Service excellent starters range from £8 to £13each and mains from £10 to £20.

site_logo

224Clare . 2017-12-17

MORE AT TripAdvisor

I ate here on one night and the food was very nice.

site_logo

MrGeoffStewart . 2017-11-08

MORE AT TripAdvisor

We went for a family meal at this restaurant, the hospitality and service amazed us. Very fast, clean and understanding service with aromatic flavours to the dishes.

site_logo

P4LKK . 2017-10-22

MORE AT TripAdvisor

My friend and I enjoyed our meal, all our dishes were tasty and served quickly. The portions size of the side dishes are too small which is a real shame as the prices are at the high end for a curry so there is no need to serve small portions. Prawn starter was very good, just enough spice with out killing the prawn. the house special curry, Lamb with coriander was a different taste for me and it worked, I would like to eat it again Carrot cake desert was probably the best I have eaten in an India restaurant I would eat here again but it is a little expensive

site_logo

Kevin J . 2017-10-14

MORE AT TripAdvisor

My husband and I stayed at the ajoining hotel the ramada. We were pretty late getting to Anju as we'd been to a gig.we hadn't booked but even though it was very busy we were immediately found a table.nothing was too much trouble. The food was exquisite in our opinion. There was a lovely atmosphere. We're definitely going back again.

site_logo

Rebecca B . 2017-09-14

MORE AT TripAdvisor

We visited this restaurant one evening and were

site_logo

Atul P . 2017-09-01

MORE AT TripAdvisor

My hubby and I visited as we were staying at the Ramada Hotel, it was very conveniently located right next door. Huge tables, reasonable prices, food was lovely and very good portion sizes. Staff were very friendly, would definitely recommend.

site_logo

Lucy-Johnson . 2017-08-23

MORE AT TripAdvisor

We visited this restaurant yesterday and had a lovely meal. The food was delicious, absolutely no complaints regarding that, high end Indian cuisine presented in very modern and appealing manner.

site_logo

SKJ76 . 2017-08-23

MORE AT TripAdvisor

More than what you'd get in a normal curry house this is step above . My colleague and shared a starter and for main we had butter chicken and chicken chettinad both were absolutely lovely as was the roti and mushroom rice , the food is very good quality and the staff are all lovely.

site_logo

Peter Q . 2017-08-11

MORE AT TripAdvisor

It was a very important milestone for my father as he turned 80 years old so we as a family and his close friends wanted a relaxed, comfortable evening and by choosing Anju we thought we'd achieve this but I was left disappointed at the end of the evening which was very unfortunate. I will keep this factual by listing the particulars 1. I arrived at 530 to set up the tables for the event they had not made it clear to me that we could not have 2 tables of 10 adjacent to each other upstairs so we spend 30 mins deciding how to re-arrange the tables with staff who were not empowered. We finally gave in on speaking to a more senior member of staff and we decided to take a table on the lower floor despite 2 guests having mobility issue, which the hostess evidenced on the arrival of the guests2. Once we were seated the service during the whole night was sub standard. Drinks orders were not taken in a timely fashion and once taken didn't arrive or were incorrect. Not what we were expecting. 3. Despite being clear on the allergy requests for the table the salad arrived with cucumber in it so this was wasted as 3 guests had an allergy. 4. The next point perhaps is their policy but the sub standard staff (particularly the hostess name unknown) made no effort to try and accommodate us despite the fact that she knew we had already experienced issues during the night. We were refused point blank for any of the main course to be packed for take out for us, the potions were large and there was so much food left over so it was a reasonable request. Again disappointed in the way the message was delivered and dealt with. 5. With regards Desserts I asked for everyone's order to be taken despite us wanting to have the birthday cake as dessert our set meal included 20 covers. The guests that wanted the desserts of offer were given portions that were not complete or incorrect and we were chasing the orders. Effectively I felt this was contradictory to the policy they should have produced 20 covers ready for us as we were paying for them all as part of the agreement and they do not allow any food to be packed for take away. We paid the bill without dispute despite this experience. I feel very strongly about my disappointment as it was an important evening for us. Particular attention drawn the to the lack of accommodation for people with mobility issues and allergies To add injury to insult the story continued, the staff asked me for feedback after the event which I gave and they escalated the issue to the food and beverage manager of the ramada hotel. As a gesture they offered a compensatory dinner to me and my immediate family, I provided all my details for this said offer and they has been silence ever since. Overall I'm very disappointed with the poor service and the way they have dealt with my feedback

site_logo

sonsandhu . 2017-07-20

MORE AT TripAdvisor

Absolutely faultless. Sensational décor, wide ranging menu, exceptional food, great service. I just wish I lived closer and could visit more often.

site_logo

James P . 2017-07-10

MORE AT TripAdvisor

went last night had the best indian food I have had in ages staff were amazing cant wait to go back and try a few more dishes the mixed grill starter was out of this world the décor everything is just brilliant and the bill at the end we couldent believe it so much food for so little money

site_logo

trevor d . 2017-06-13

MORE AT TripAdvisor

We have dined at the restaurant several times and have never been disappointed. Lovely food and lovely atmosphere.

site_logo

nicolabrennan1987 . 2017-05-28

MORE AT TripAdvisor

We have been to Anju several times in the past but this time everything was just great. The food was excellent in its taste and presentation, the service was very good but not intrusive and the atmosphere perfect in terms of decor, lighting and background music. We felt we were in one of the top hotels in Mumbai or Delhi where we have been to recently. Would definitely recommend and hope to return at some time as we don't live in this area.

site_logo

Adil H . 2017-05-25

MORE AT TripAdvisor

Have to say we only booked because it was next door to The Ramada - but wow what a treat! You won't be disappointed. Staff were amazing, décor was very chic and food was just fabulous. Oh and value for money was great too! Couldn't fault anything - even left with a doggy bag because I couldn't eat all the food.

site_logo

Briege B . 2017-05-20

MORE AT TripAdvisor

A very dignified Indian restaurant next to large wedding/party orientated hotel. I think the food is about as good as I have had in similar. Proper thought into proper flavours. Try the mixed grill (salmon in the clay oven particularly good) and the roasted cauliflower. The tarka dhall is definitely the best I had ever had. Service discreet and charming. Not a riot but I was in early (again). It may be pricey for some but I think it worth the money.

site_logo

James L . 2017-05-15

MORE AT TripAdvisor

First time coming to Anju's after hearing all the good reviews from family members and boy were we impressed! Went with the wife for our wedding anniversary and everything was perfect. Was greeted by staff opening the door for us, our table was ready and drinks came within minutes. Weren't sure what to order so the waiter recommended some dishes and got the chef to make it how we like it (extra sauce and hot!!). Ordered 3 mains incase we didn't like one and got to say we polished them all off. Great food, exceptional service! Thank You Anju's for a lovely anniversary meal!

site_logo

MisterMVP . 2017-05-11

MORE AT TripAdvisor

Probably the best Indian meal we have ever had. We dined with a big group, the service was fantastic and the food just amazing! Would definitely recommend and visit again if ever in the area

site_logo

Conchin77 . 2017-05-07

MORE AT TripAdvisor

A wonderful setting attached to a terrific looking hotel, the restaurant looks impressive the moment you walk in, and the service is immediately up to that standard. It's an excellent atmosphere inside, whether eating alone, as I did, or in a larger group. There were a couple of larger groups and they seemed to be having a good time too. I had a fantastic salmon methi starter, which was tremendous. I don't think I've ever had a better starter in an Indian restaurant. The lamb rogan josh with mushroom rice to follow was sublime and I left feeling very full and very satisfied. I can heartily recommend this restaurant. The service throughout was top class and as a result I left a much larger tip than I would ordinarily. My bill (before tip) was a little over £44, which was a bit expensive considering I was on my own, however the quality of food and service was so good I didn't begrudge that amount. It's a shame I'm only here for one night!

site_logo

Martin W . 2017-05-07

MORE AT TripAdvisor

Me and my husband celebrated our wedding anniversary here last night. The staff really went out of their way to make it a special night for us. The food was fabulous, arrived very quick - soon after we had finished our starters and the service was the best service we have received at any restaurant. We have eaten at many restaurants up and down the UK and abroad, however the service we received here last night topped any of our experiences elsewhere and we will definitely be returning. Thank you for a fabulous evening and making our anniversary so special.

site_logo

westerly1 . 2017-05-06

MORE AT TripAdvisor

Visited with work colleagues due to good reviews on here. The food was top notch. Lots of flavors, good sized portions. My only gripe was the service was so slow. Waited almost an hour for our mains. We only had popadoms and pickle tray to start so was pretty hungry by the time the mains arrived. I would have rated 5/5 had the service been quicker. Seems like a lot of reviews on here mention the service. Added bonus is that they accept tastecard but one get one free on all courses (excluding side dishes)

site_logo

Markieb68 . 2017-05-03

MORE AT TripAdvisor

I am a very seasoned Indian restaurant critic having eaten all over uk and abroad however this restaurant is on another level the restaurant is warm and welcoming but then the food arrived well you cannot put into words how incredible the skill of the kitchen chefs the blend of spice and flavour was outstanding although I live 200 miles from here I will return just to eat here

site_logo

Petertc66 . 2017-05-01

MORE AT TripAdvisor

Amazing, best curry in Wolverhampton, the menu isn't as big as other curry houses but everything is absolutely amazing to eat, the staff are great and very polite. Will be going back again and again!

site_logo

Dickie H . 2017-04-12

MORE AT TripAdvisor

ate with colleague early on a Wednesday evening because we were staying at hotel. I thought it would be very average as it was attached to the hotel, i was wrong the service and food was excellent. Definitely worth a trip to enjoy the experience and both me and my coleague commented on how good the place was, i had the chicken chettinad which was awesome and full of flavour with just the right amount of kick to it without being to hot. We also had nan bread and pickles and a few Indian beers.If you live local and havent been then give it a go and you wont be disappointed

site_logo

john h . 2017-04-11

MORE AT TripAdvisor

My husband and I ate here twice while staying next door at The Ramada Park Hall. Both times food was great, service was good too. Mon-Fri 5-6:30pm they have an early bird special as well.

site_logo

Theresa K . 2017-04-10

MORE AT TripAdvisor

Staying at the Ramada Park Hotel with work at the minute and wow what amazing facilities. The highlight though has to be Anju's Indian Restaurant. Ate there tonight and what an amazing experience. The restaurant itself is beautifully decorated and interiorly designed giving it a superb ambience. The staff could not be more helpful and the food was out of this world. I like my Indian food and have tried some fab restaurants but this was far superior. I didnt want the flavours and tastes to end. Cannot wait to have another meal here before I leave on Friday. Thank you.

site_logo

Ian C . 2017-04-04

MORE AT TripAdvisor

Been here a few times for dinner and have enjoyed it each time. The food tastes amazing each time I've been. Staff all go the extra mile to make sure everthing is perfect for you. Last night a group of 30 of visited for a suprise birthday party and like always the staff where brilliant and food was amazing and all so tasty.

site_logo

Nil P . 2017-03-19

MORE AT TripAdvisor

Just had dinner tonight at Anjus with the Ramada package deal of Dinner Bed and breakfast.The package meant a there was a set menu instead of "a la carte", but the selection on the set was probably what I would have gone for anyway on the main menu.As for the food- it was exactly what I was looking for in an Indian restaurant. The curries had quite a few pieces of meat and lots of sauce, most importantly- not much veg bits. Now you might be reading this review and wondering how this is a good thing by being short changed. For me , I like the taste of peppers, onions etc when cooked into a dish, but don't actually like the physical item in the dish. I would typically eat round these items, but at Anju's, didn't need to do that at all.All the taste, all of the flavours , ate everything on the table. The hot hand towel "show" was a nice touch. Dessert was so so, but I rarely have desert at an Indian place- I had it as it was part of the set menu.Overall I would recommend this for sure, I can't comment about how authentic it is as I have yet to head to India- but it was certainly a good meal. Would definitely come back but seeing I am traveling up north from London, this was just a stop over which I probably won't be doing for a while. Really friendly staff and also the fish tank is a very nice touch- never seen that before !

site_logo

Sam K . 2017-03-16

MORE AT TripAdvisor

I come here quite often with my husband and I've never had a bad experience. The Restaurant is located within a Grade II listed building which use to be a grand house belonging to the Honourable John Ward (it's now a Ramada Hotel). The restaurant is set within a gated forecourt with plenty of free parking. The food is delicious, especially the lamb and chicken curry. The staff are professional and the decor is sophisticated, creating a tranquil atmosphere. We normally pay around £55 for starters, mains and drinks. I think that's reasonable for the quality of food, service and type of venue. I recommend this place to my family from London and they all love it.

site_logo

Nikkibains78 . 2017-03-08

MORE AT TripAdvisor

I came here because it is attached to the hotel I was staying in and I'm glad I did. Anju's manages to be classy as well as being welcoming and family oriented. There were more Asian diners than non-Asian including a charming, small wedding party. The décor is in marble and wood and the restaurant is on two levels. In the sunken session there's a huge screen showing black and white stills of Bollywood stars and the music is more apparent. At the higher entry level it's hardly noticeable. The staff are super-efficient and on a busy Thursday night (only two empty tables when I arrived after 9.30) kept things moving briskly without giving the impression of rushing. I had Mehti Machi (marinated Scottish salmon chunks cooked in a clay oven with fenugreek and a touch of mustard) a visual feast, delicate taste with a hint of heat and a large portion considering it was a starter. I also had a Chilli Paneer with peppers and served I an edible rice flour basket. This is the best paneer dish I've ever had - with a strong kick and very good texture. I then had Daal Mahani (black lentils simmered for hours until they become buttery) with potato filled kulcha. The daal had a smooth, creamy texture and needed a little more spice (or perhaps it just seemed too mild after the paneer dish). Karari Bhindi - crispy fried okra. This was thinly sliced rather than whole and very well cooked. Crisp and light, not oily. I would have preferred the okra served whole - it was good to try it this way though. The Kulcha was a non-event, light but nothing much else going on with it. The dishes I saw delivered to various tables around me all looked interesting. I'll definitely come here again.

site_logo

Nova F . 2017-03-02

MORE AT TripAdvisor

as per the title when 20 odd guests arrive at ten pm all the staff are just as happy to see you as if it were 7pm says an awful lot.

site_logo

Montydon . 2017-03-01

MORE AT TripAdvisor

My family and I had our family night at Anju's. The food was absolutely scrumptious. It was full of flavour and generous portions. The staff are so attentive and accommodating. Nothing was too much trouble for them. The decor is quite tasteful and upmarket without feeling cold and intimidating. A really nice atmosphere, delicious food, great service by the staff and we had a lovely evening.

site_logo

Sonia D . 2017-02-19

MORE AT TripAdvisor

So, you are out and you fancy some food and your girlfriend is Indian and picky about eating at Indian restaurants. As we all know, what you eat at an Indian home is hugely different to the radioactive, oil drenched weird pink and shocking orange food served at most Indian restaurants. So we went to Anju's without a reservation. The staff accommodated us even though fully booked as long as we could dine in 90 mins, a fair compromise. The service, food and general attention to detail was spot on. The food was very authentic and I'd eat again there in a heart beat. For what we had I thought it was very good value too. Well worth a look.

site_logo

john p . 2017-02-18

MORE AT TripAdvisor

We came here for a meal as we had booked a room in the hotel for our friends wedding and found it lovely , we have returned many times and have never been disappointed with the food or the fantastic service,the food was always piping hot and cooked how we liked it , there is a great starter choice , my favourite is the chillie chicken , main is always tika masala ,and a great range of lush deserts , would recommend Anjus to everyone , always great food and great service

site_logo

jean190762 . 2017-02-06

MORE AT TripAdvisor

Dined here as a party of four and we were most impressed with both food and service. When you write a lot of reviews, it is easy to get blasé and patronising; that said, this restaurant IS very good. It is well presented and not too cramped. Our servers were very friendly, with prompt but not rushed service. Our choices did not disappoint with good quality, presentation and portion size. Equally, and unlike some places, despite the restaurant being busy, we were not rushed to vacate our table.The place is worth travelling for - and you can always stay overnight at the adjoining hotel.......no worries!!!

site_logo

GOMS2013 . 2017-02-01

MORE AT TripAdvisor

Authentic and quality dishes. Have real taste and flavour in their food. Been many times and always looking forward to the next visit. Only downfall is they need more of a selection on the wines per glass.

site_logo

Jaz A . 2017-01-17

MORE AT TripAdvisor

The food was fresh, well presented, tasty and served with the most pleasant professionalism that we have encountered in a long time. Dinner from the set menu, bed and breakfast with all day spa access at the Park Hall Health Club and Spa from £115 for two people.A lovely, affordable and relaxing way to spend a Saturday night!

site_logo

customerserviceagent . 2017-01-08

MORE AT TripAdvisor

This is our first visit here, dave and myself have tried various curry houses, some fare, some ok-ish. read the reviews for Anju's restaurant which read excellent so we thought we would give it a try, result...... well service is excellent, waitress was very helpful in explaining the menu, which by the way, we never got any where else, the food, well what can i say, PERFECT, the whole meal from start to finish was, well absolutely noma nom. Very tasty, Will definately be coming again, great sevice, great food, what more can you ask for. A very happy and satisfied customers

site_logo

75bbs . 2017-01-01

MORE AT TripAdvisor

After many frustrating outings over many years at last there's a decent Indian restaurant, as opposed to curry house, in the Wolverhampton area to give Bilash a run for it's money.The Park Hall Hotel was somewhat neglected over many years but the current owners have clearly invested in all areas. The restaurant is no exception. Service is good and the food is better. I ordered Keema Chop Masala and will do at the next visit. It was excellent.If you want good quality food in a decent setting this is the only place to visit in the area..........

site_logo

Harpreet D . 2016-12-20

MORE AT TripAdvisor

Two samosasOne chicken curryOne lamb curryTwo riceOne half pint of larger£43What do you think?

site_logo

AlbertTattlock . 2016-12-12

MORE AT TripAdvisor

Recently ate at this restaurant as a group of 4. I would have said that the tables were only half full and there appeared to be more than enough waiting staff. First visit here and we were all impressed with the decor; modern, yet had a classy atmosphere, tastefull colour scheme and comfortable seats. There was plenty of room on the tables with modern cutlery and plates. The toilets upstairs were also modern ( with soap- see one of the previous reviews ). Everything appeared clean. We ordered various dishes and generally the food was decent and well presented, all meat was well cooked and tender though some items e.g. the saag aloo was ridiculously hot and the chicken tikka Masala very very mild. The relish accompaniments to the popadoms were so meagre it was a joke. However as stated the food overall was decent and of good quality. What lets this place down is the ridiculously slow service. As stated the restaurant was no way full or understaffed. We ended up being there over 2 and a half hours.We had to remind them on several things that we had ordered but still had not received ; drinks as well as food. We tried to call the staff over, they would see your attempts, look as if they were on their way to you then walk to a different table and ask if their meal was ok!!!!. So be warned , don't book to eat here if you are on a tight schedule or starving from the word go. The staff are pleasant but dynamic and attentive to orders certainly not. I wonder if they do takeaway.................?

site_logo

Daniela P . 2016-12-10

MORE AT TripAdvisor

The best Indian food I have ever eaten in a beautiful restaurant with very friendly staff and night thoroughly enjoyed and I will be looking to sort out when I can return. The food was plenty and very tasty.

site_logo

RJFWOLVES . 2016-11-26

MORE AT TripAdvisor

I'm not keen to eat out when it comes to Indian cuisine ( I prefer home made food), so i'm quite picky about where I go.However, I never hesitate to dine at Anju's. I've eaten there many times. The food is always fresh and tasty, and the service is reflective of the high standards of Park Hall Hotel. The prawns are great, the vegetarian dishes are delish esp the Tarka Dhal... and if you have the room for them, try their masala chips!! One my most recent visit I had a chicken dish, prawns and tandoori roti. The number is people in there on a week night speaks for itself, always busy... and yes there are Indian diners too, so the food has got to be good!!

site_logo

MissHBirmingham . 2016-11-13

MORE AT TripAdvisor

I came for dinner with my two daughters. A lovely high spec setting. The food excellent and friendly staff. A relaxed atmosphere. I can't wait to go again!

site_logo

robo12324 . 2016-11-13

MORE AT TripAdvisor

Similary restaurants in West Midlands

restaurant_img
4.5

496 Opinions

location-icon65 Regis Road
Indian
outdoor_seating_167015takeaway_167015delivery_167015

Lovely food, great customer service, always friendly towards us make you feel welcome would highly recommend this place

restaurant_img
4.5

2361 Opinions

location-iconClaverly Drive
Indian
outdoor_seating_169995takeaway_169995delivery_169995

Great food. Welcoming and accommodating staff. Will return!

restaurant_img
4.5

214 Opinions

location-icon35-37 School Street
Indian
outdoor_seating_169959takeaway_169959delivery_169959

I have been visiting this restaurant for 30 years and Joseph and his team have always been brilliant. I always had “balti chicken tikka rognee saucy” which isn’t on the menu. Always perfect. Sadly Joseph has retired and sold up so I won’t be able to go back to my fave restaurant. It’s now closed. I want to wish Joe and his team all the best. Martin F

restaurant_img
4.5

562 Opinions

location-icon252 Bilston Road
Indian
outdoor_seating_227008takeaway_227008delivery_227008

Food was warm not hot and popadoms were all broken, chicken balti wasn’t like a balti at all no flavor. expensive for food served over 80.00 pound for four meals

restaurant_img
4.5

309 Opinions

location-iconThe Swan Centre Bridgnorth Road, Wolverhampton WV6 8AE England
Indian
outdoor_seating_276418takeaway_276418delivery_276418

Very tasty, fresh, good portion size. Delivered on time.