GastroRanking-logo
whatsappWhatsapp
phoneCall
desktopWebsite
menuMenu
bookingBooking
4.1

Based on 783 opinions finded in 2 websites

site_photo4

Nº 1079 in 2408 in Camden

Nº 17 of 67 Chinese in Camden

CUSTOMERS TALK ABOUT DISHES WITH..noodleseggporkchickenriceprawnchillifriedpeppermeatcurrysesamecookedsquidduck

comment_iconOpinions

I am not sure about the claims that this is healthy cuisine... our dishes were very salty and below the standard you would get from a average chinese takeaway.

site_logo

Leo C . 2022-03-13

MORE AT TripAdvisor

Ordered on-line and the food took over 1.5 hrs to arrive. When it arrived it was very greasy, bland and not appetising at all. I would not recommend this place.

site_logo

Felicity H . 2022-03-12

MORE AT TripAdvisor

¡Comida increíble! ! Me encanta, me encanta el pollo con sésamo y los rollitos de primavera de plátano y Nutella eran para morirse

site_logo

Lucy B . 2020-09-02

MORE AT TripAdvisor

Decent great service and amazing food for a family run restaurant gets busy at times book tables ASAP jto

site_logo

Juan O . 2019-11-25

MORE AT TripAdvisor

Great place to have some Chinese food and amazing foods. Prices are good too and service is half decent

site_logo

Erickstark1 . 2019-11-16

MORE AT TripAdvisor

Ordered a chicken chow mein, was absolutely disgusting, dripping in soy sauce, overly salty was not enjoyable at all. Please avoid at all costs

site_logo

RJS-83 . 2019-11-15

MORE AT TripAdvisor

Intenté ordenar tres veces diferentes ahora sin éxito. Obtener ayuda por teléfono o Facebook es imposible. El sitio web ya no toma pedidos para mi código postal. Me dijeron que use Deliveroo, pero no puedo usar mis sellos de lealtad allí ni ganar más. La mujer en el teléfono, Jane, parecía no estar involucrada en el restaurante como si hubiera contestado el teléfono por error; ella estaba tan desinteresada. No hay gerente en el sitio para hablar. Jane no pudo (o no quiso) darme el número de teléfono de la oficina central. Experiencia realmente frustrante. Tenga la sensación de que ya tienen demasiados clientes para preocuparse o han vendido el negocio. Sorprendentemente malo.

site_logo

David Jonathan B . 2019-10-28

MORE AT TripAdvisor

I loved ordering from here. But tonight a number of vegan options (like black bean tofu) had disappeared from the menu and there was no plain rice (you used to be able to get plain brown rice) so I had to make my own. I used to deliver food so I always give drivers a good tip. My driver said he never sees the ‘optional tip’ that’s added to the bill - the restaurant keeps it. This above all really upsets me so unfortunately I’m not planning on ordering from Zing Zing again.

site_logo

RunningFool68 . 2019-09-26

MORE AT TripAdvisor

Have been waiting for an hour and a half already for my takeaway ( I live in Camden) have just called ten to be told my order has not even been started to be cooked yet and it will be another 30 minutes minimum. What is the point of having a website delivery service when you clearly cannot cope and have no customer service standards in place. Absolutely starving and it’s almost too late to be eating now. AVOID AVOID AVOID

site_logo

krispydog . 2019-09-22

MORE AT TripAdvisor

It can be tough to find good Chinese food if you're vegan and veggie, thankfully we found Zing Zing! The vegan and veggie take on classic dishes are simply incredible and we haven't found anything close to it. Great food, the service is always excellent and the price point is perfect!

site_logo

Stephen H . 2019-08-18

MORE AT TripAdvisor

Having spent 40 minutes trying to place an online order for delivery to a postcode they advertise as delivering to, I decided to telephone and see what was wrong . I was ordering a takeaway to the value of £150 and was greeted on the phone by the most obnoxious manager possible( obviously not someone with a financial interest in the business ), as she would have bent over backwards to help. Obviously would never now try this place and will go out of my way to tell everyone I know of my experience.

site_logo

bushpig1966 . 2019-08-11

MORE AT TripAdvisor

salty, crappy food, will never oreder there again, seaweed was burnt! embarrased to serve to friends got through deliveroo

site_logo

gatortravels24 . 2019-06-21

MORE AT TripAdvisor

Used to be good quality food, delivered with care. They have clearly gotten lazy, one recent order took 2 hours to arrive with no info, apology or compensation from staff despite having to make 3 phone calls. The last order I made they missed out the the pretty vital element of hoisin sauce from the duck and pancakes and wouldn’t deliver more for 45 mins. They have started padding out the meat dishes with vegetables but kept them the same price. The noodles were disgusting with stale vegetables in them. DO NOT BUY FOOD FROM HERE.

site_logo

Rachel N . 2019-05-19

MORE AT TripAdvisor

Have used them for a number of years, food turned up after being in the back of the scooter for 30mins. Was told it had come out of the packaging so no thanks. No refund or call as promised, 30 odd pounds and still hungry, lesson learned.

site_logo

Patrick D . 2019-04-21

MORE AT TripAdvisor

The Miso Aubergine was fantastic!

site_logo

Arianna . 2019-04-13

MORE AT Just Eat

It was honestly the worst chilli beef I’ve ever had from you guys. Usually food is amazing, my favourite take away but the beef was so chewy and fatty was major let down.

site_logo

Rebecca-Nora . 2019-04-02

MORE AT Just Eat

Amazing food, delivery guy was friendly too. Definitely recommend this restaurant

site_logo

Sam . 2019-03-03

MORE AT Just Eat

over All the food was pretty average the price to excess I have learned that I can cook anything I want myself good luck with business until people wise up and stop consuming for convenience

site_logo

Jay . 2019-02-20

MORE AT Just Eat

Food was wonderful, though the protein portion was a bit smaller then I would have liked for £10. I’ll order again for sure!

site_logo

Danielle . 2019-02-18

MORE AT Just Eat

Have had zing zing regularly in the past , unfortunately as they have grown the quality and customer service has dropped. They forgot part of my meal and apologised. The earliest delivery they could do was an hour away, which I felt was acceptable. It never arrived. I've had little response from the feedback.

site_logo

Akish L . 2019-02-04

MORE AT TripAdvisor

The green vegetable dish that was supposed to include broccoli, mange-tout and mushrooms had no mange-tout, one tiny piece of overcooked broccoli and one mushroom. The rest was all pak Choi stems. So nothing green... terrible dish that was falsely advertised.

site_logo

Laura . 2019-01-01

MORE AT Just Eat

Overall good. Flavour a bit artificial, surely overpriced.

site_logo

Luca . 2018-12-12

MORE AT Just Eat

I ordered here a few times and was always more or less okay. They forgot parts of the order several times or confused a chicken dish with a veggie dish, which is not ideal but they delivered the correct one as quickly as they could. Lately they have raised their prices for about 50p-1 Pound per dish. The quality, service and portion sizes did not improve.

site_logo

TheLadyJo . 2018-11-23

MORE AT TripAdvisor

Don’t order here, my order was 1.5 hours late and they never answer the phone.

site_logo

Michele . 2018-11-20

MORE AT Just Eat

Such yummy food (as always)! We can always trust zing zing to make delicious (vegan) Chinese food! 😍 honestly so good couldn’t recommend more!!

site_logo

Liv . 2018-10-21

MORE AT Just Eat

Food was amazing always is but no chopsticks or straw

site_logo

Paul . 2018-10-19

MORE AT Just Eat

Quality has gone downhill. Prawn toast was flavourless, crispy squid was okay but lacked salt. Spat out the bacon fried rice because the chicken was digusting - as if it was rotten meat.

site_logo

Veronique . 2018-10-14

MORE AT Just Eat

The delivery was late because of a power cut across Camden, so I felt for them having to deal with that on a Friday night. But I only found out about it after the delivery ETA when I called, and it then arrived later than I had been told. Was disappointed with the portion sizes relative to the cost - especially as we ordered a double crispy beef and it was the same size as the regular size skinny ginger chicken. Very tasty, but probably won't order from here again.

site_logo

Nuala . 2018-10-07

MORE AT Just Eat

Absolutely delicious. Different in a very good way. Will repeat soon

site_logo

Alicia . 2018-10-06

MORE AT Just Eat

don't bother, failed to send rice with the dish, which was incredibly expensive. Food tasted awful and the portion size was not worth it whatsoever.

site_logo

815nickye . 2018-10-05

MORE AT TripAdvisor

The Chunky Shredded Beef tasted like it went off this time I ordered it. Had to throw it away.

site_logo

Anissa . 2018-10-03

MORE AT Just Eat

food has gone down hill minimal chicken, everthing tasted like flour and was luke warm when it arrived

site_logo

Billy . 2018-09-24

MORE AT Just Eat

Awesome food, awesome people. Ordered from there heaps of times and have never been disappointed, will continue to order from there!

site_logo

Bronwen H . 2018-08-30

MORE AT TripAdvisor

Ordered a zing box with starter added and a soup. Order was over 30 mins late and when it did arrive the soup was missing. Tried to call them several times but the phone just rang and rang no one picked up. Was a shame as the food was good! But the main reason i ordered was the soup and could never get in touch with anyone to ask about it despite ringing several times. Would not return because of this spoiled the order.

site_logo

Matthew . 2018-08-29

MORE AT Just Eat

I do love the food I get from Zing Zing, and have a weak spot on those quiet nights in to order directly from them. The Pork Ribs, Bacon Special Fried Rice, and Chilli Beef Strips are outstanding each time.

site_logo

M4RKM . 2018-08-22

MORE AT TripAdvisor

The service is rapid, the food is excellent and well packaged. Definite stand out player in the Asian delivery scene in London

site_logo

Jonny D . 2018-08-22

MORE AT TripAdvisor

So I went for it as I had had offers and discount vouchers regularly in my inbox.

site_logo

KitKat558 . 2018-08-18

MORE AT TripAdvisor

I was sent the wrong dish — the bao instead of pancakes. Tasted good but wasn’t what I ordered.

site_logo

Geffen . 2018-08-16

MORE AT Just Eat

Pedí el resplandor resplandor para mi amigo y yo en el haberme quedado y, como vegetarianos, las opciones eran muy abundante y agradable. Las tostadas plato de hongos era genial y yo de verdad disfrutamos de la Berenjena salsa szechuan y black bean tofu para los platos principales. La entrega fue rápida y la comida estaba caliente! Yo llevar la orden como dos veces al año porque odio cosas tibia grasienta y no me decepcionó!

site_logo

Karen C . 2018-07-29

MORE AT TripAdvisor

Maybe the best East Asian food I've ever had.

site_logo

David . 2018-07-28

MORE AT Just Eat

Super delicious felt quite healthy and such a friendly delivery man so quick!!!

site_logo

Sarah . 2018-07-17

MORE AT Just Eat

Great food, a really nice selection of vegetarian options, & speedy service. Small mix up in that I received sweet potato pandang instead of the sweet potato dumplings I ordered, but I’m really not complaining :)

site_logo

Ellie . 2018-07-05

MORE AT Just Eat

Very bad there never delivered

site_logo

chris . 2018-06-22

MORE AT Just Eat

We’ve been coming here for a long time and it has previously been a bit hit and miss but it seems as though they have ironed out the chinks. Definitely back on our radar now! We ordered some of the new vegetarian dishes, in an attempt to be good, and they were delicious. Sweet Potatoe Rendang is a must! You won’t miss the meat.

site_logo

Ricky . 2018-06-04

MORE AT Just Eat

Heavy, sweet, over flavoured sauces leaving no room for the ingredients. Not my thing.

site_logo

Robert . 2018-05-28

MORE AT Just Eat

Completely drenched in soya source. Too salty. I had to bin all 3 take-aways

site_logo

Charles . 2018-05-07

MORE AT Just Eat

Terrible service. Order was supposed to take 50 minutes, I phoned after an hour and they had no record of my order despite having already paid. The staff were exceptionally rude leaving me on hold for ages for no reason and ignoring my number when calling back. I had to go through just eat helpline to get my food and it turned out they had delivered my order to the wrong address. I had to call back to confirm my details, they ignored my number on record (they picked up from a different number immediately) at which point they tried to tell me just eat had changed their order system. Food finally arrived 2 hours after ordering. As for the food chunky beef was ok but small portion sizes for the price, chow mein was greasy and bland, but banana and nutella spring rolls were lovely. However I'd save yourself the stress and order elsewhere or at least opt for cash payment.

site_logo

Erin . 2018-04-29

MORE AT Just Eat

45 minutes late, no answer on the phone. deeply unimpressed....

site_logo

Imants . 2018-04-08

MORE AT Just Eat

Pedí llevar el mes pasado y por primera vez desde ZZ siguiendo la recomendación de mi amigo. Era tan duro para elegir el menú, pero era más que contento con mi elección. Pedí el pollo y huevo frito limón arroz que sabían increíble. La comida no es grasa o zz gms laden. Totalmente recomendado. Deliciosa

site_logo

VegasBride_12 . 2018-03-12

MORE AT TripAdvisor

I have ordered from Zing Zing a few times and the food is brilliant. Customer service and delivery both flawless. Would highly recommend. Great to have a local Chinese that uses good quality ingredients and no MSG.

site_logo

N1Eats . 2018-03-06

MORE AT TripAdvisor

really good starters but pretty poor mains - sweet and sour chicken was fried but chewy and not good at all!

site_logo

Lucy . 2018-02-25

MORE AT Just Eat

Speedy delivery - really happy about that, since we were really hungry. Good portion sizes, good quality food.

site_logo

Vanessa . 2018-02-18

MORE AT Just Eat

We order from ZZ Kentish Town quite frequently, the service is always super quick (under 30 minutes but usually 20) even on NYE! The food is delicious, the ingredients are fresh and of a high quality, and it's guilt free. No grease and no MSG - you don't feel like you've eaten a takeaway afterwards more like a home cooked meal or restaurant quality experience. Granted, it is pricier than your average takeaway, but as a takeaway should be a treat not a regular thing - it's worth spending the extra. Highly recommend.

site_logo

DaisyRG . 2018-02-16

MORE AT TripAdvisor

My brother got me onto these as he also lives in the area, I had given up on Chinese food as its always the same old slop in a tray but these guys seem to have figured it out, it turns up quick and the packaging is good (No leaks!) and its not greasy (Like all the other places). Definitely worth a try, what have you got to lose.

site_logo

NWDK999 . 2018-02-15

MORE AT TripAdvisor

I have been going to Zing Zing for a couple of years now and have never had a bad experience! I have tried many dishes from the Kentish Town and Islington branches and they have all been amazing!! Try Zing Zing, you will not regret it!

site_logo

Poppy N . 2018-02-14

MORE AT TripAdvisor

Highly reccommend ZZ! With out a doubt the best Chinese food around. The food is delicious and tastes so clean and healthy with a fanastic range on the menu. We love both the meat dishes especially sticky beef and the new vegan specials like the cauliflower. Good delivery time and friendly service. Im not surprised you are expanding as the marketing and branding is so catchy and pun-tastic! Give it a go...you wont regret it...AND its chinese new year this weekend so there's the perfect excuse!!!! Keep up the good work.

site_logo

SIMJ18 . 2018-02-13

MORE AT TripAdvisor

Taste & quality is superb! This is my second time to order and it always deliver great quality food. Also it was delivered 15min early. Brilliant! Super happy customer me... 😊😊😊

site_logo

Brenda . 2018-02-09

MORE AT Just Eat

Sometimes all you need is a top quality takeaway meal, delivered at an acceptable temperature & at a reasonable price!

site_logo

Ash G . 2018-01-31

MORE AT TripAdvisor

We have ordered from Zing Zing countless times now. From their good-value Zing Zing boxes to the delicious array of vegan dishes, the food has been nothing short of excellent. You can certainly tell that the food is made from a far higher standard of ingredients than a regular Chinese, and it is also far less greasy and simply tastes more fresh. I particularly LOVE the Mushroom Bao whilst my carnivorous other half goes for the Char Siu. It's a little more pricey than your normal Chinese takeaway but worth every penny. Highly recommended!

site_logo

H L . 2018-01-29

MORE AT TripAdvisor

Despite the order showing the correct address, delivery driver went somewhere completely different Food was also 20 minutes late. Highly unimpressed with this service.

site_logo

Natalie . 2018-01-27

MORE AT Just Eat

Disappointing. Food completely cold, and did not live up to description on menu at all. Crispy duck wasn't, only came with a minuscule amount of sauce and pointless sprinkle of wilted cucumber and spring onion.

site_logo

Sophie . 2018-01-22

MORE AT Just Eat

I've ordered from Zing Zing numerous times and their food never fails to satisfy me! It's quick and easy to order on their website, and the delivery is very fast. I'd definitely recommend ordering from here. The best Chinese I ever had!

site_logo

RobelSeyoum . 2018-01-22

MORE AT TripAdvisor

He pedido comida de resplandor resplandor - sucursal de Kentish town para mi novio y yo. Yo estaba buscando algo sabroso y no demasiado grasiento. La comida es sin duda preciosa, NO GMS (lo que es raro hoy en día) y hasta tienen arroz marrón del lado de quinoa (Qué delicia! ) Recomiendo encarecidamente este lugar mientras es un llevar no es un típico llevar. Sin duda la orden de nuevo.

site_logo

Aistė L . 2018-01-15

MORE AT TripAdvisor

Call to explain a missing component, then missing component was found but order would take longer due to 'defrosting'. Swapped for something else. Order then arrived worryingly quickly. However, Incredible flavour, very well presented and organised. No cutlery required at all. Unfortunately even though it had arrived quickly it was tepid/cold.

site_logo

Darren . 2018-01-05

MORE AT Just Eat

good food but arrived an hour earlier than delivery time.

site_logo

Gozde . 2017-12-24

MORE AT Just Eat

Delicious food but over priced. Overall a happy customer :)

site_logo

Fadwa . 2017-12-22

MORE AT Just Eat

Have ordered from here many times and consistently arrives in good time, is hot, and tastes great

site_logo

Sarah . 2017-12-16

MORE AT Just Eat

This is my third order. Portion size is horrifying. I this is definitely half the portion of what i previously ordered. What a rip off!!!

site_logo

Charles . 2017-12-15

MORE AT Just Eat

Decent quality food, but once the order was confirmed the restaurant added an extra 15 minutes to the delivery time and then it arrived 20 minutes later than that. One hour and 20 minutes is an excessive amount of waiting time, busy or not.

site_logo

David . 2017-12-03

MORE AT Just Eat

Great service... great food too

site_logo

Charles . 2017-11-13

MORE AT Just Eat

15 min but delivery time was 1 hour so I received my food 1:15min after I ordered it. And this was on a Wednesday, imagine on the weekend

site_logo

Rita . 2017-11-01

MORE AT Just Eat

Deviated from our usual choice of food from this restaurant and regretted it. the coconut dish was OK and the Banana and Nutella spring rolls needed more filling as it just seemed like rolled up filo pastry!

site_logo

Asma . 2017-11-01

MORE AT Just Eat

have ordered from this restaurant many times and we generally tend to stick to our usual dishes so are always very happy with them. starter - Sesame chicken wings and main - Chunky Shredded Beef with Edamame egg fried rice (Zing Box). Have ordered the banana and Nutella spring rolls in the past but did not really think much of them- too much pastry and not enough filling.

site_logo

Asma . 2017-11-01

MORE AT Just Eat

food arrived quickly, but 'vegan' sweet potato rendang had beef in it. I would rather receive food a bit late rather than wrong. Zing zing fixed the problem quickly, but I probably won't order again. for somewhere that advertises so much vegetarian and vegan food, they should be much more considerate.

site_logo

Peter . 2017-10-28

MORE AT Just Eat

food arrived quickly, but 'vegan' sweet potato rendang had beef in it. I would rather receive food a bit late rather than wrong. Zing zing fixed the problem quickly, but I probably won't order again. for somewhere that advertises so much vegetarian and vegan food, they should be much more considerate.

site_logo

Peter . 2017-10-28

MORE AT Just Eat

Lovely flavours: but more chilli heat needed!

site_logo

Lizzy . 2017-10-12

MORE AT Just Eat

Lovely flavours: but more chilli heat needed!

site_logo

Lizzy . 2017-10-11

MORE AT Just Eat

Food was absolutely delicious and very filling. Kinda pricey so I wouldn't get it too often. Collection time was short enough. Staff in the restaurant could've been a bit more friendly but it didn't matter to me!

site_logo

Samuel . 2017-10-09

MORE AT Just Eat

Food was absolutely delicious and very filling. Kinda pricey so I wouldn't get it too often. Collection time was short enough. Staff in the restaurant could've been a bit more friendly but it didn't matter to me!

site_logo

Samuel . 2017-10-09

MORE AT Just Eat

Satisfied with food quality, it’s one of the better Oriental takeaways around NW3 area. But food was late! I was offered complimentary starter/mains on my next order....I will be looking forward to that.

site_logo

cherryl . 2017-10-06

MORE AT Just Eat

Satisfied with food quality, it’s one of the better Oriental takeaways around NW3 area. But food was late! I was offered complimentary starter/mains on my next order....I will be looking forward to that.

site_logo

Cherryl . 2017-10-05

MORE AT Just Eat

Visité la casa de mi amigo para una fiesta, y nos recibieron con unos fantásticos comida china recogio de resplandor resplandor en Kentish Town. El embalaje era genial - fácil de comer, e incluso más fácil de limpiar. No sólo me impresionó el envase, pero la comida era deliciosa, yo tenía pollo Chow Mien y bolas de pato que eran fantásticos. La relación calidad-precio era impecable y mi amigo dijo que la comida estaba lista increíblemente rápido y se vio reunido con gente entusiasta y sonriente cuando llegó en Zing Zing. En general, no podría recomendar resplandor resplandor más.

site_logo

Gabriel L . 2017-09-17

MORE AT TripAdvisor

Amazing food! Portions were plentiful and served neatly.

site_logo

Zaman . 2017-09-09

MORE AT Just Eat

Amazing food! Portions were plentiful and served neatly.

site_logo

Zaman . 2017-09-09

MORE AT Just Eat

I can't tell if the beef tasted just horrible or it was off and unsafe to eat. I won't trust this place again.

site_logo

Amir . 2017-08-23

MORE AT Just Eat

I can't tell if the beef tasted just horrible or it was off and unsafe to eat. I won't trust this place again.

site_logo

Amir . 2017-08-22

MORE AT Just Eat

Food was 15 mins late and when I caller the restaurant they couldn't find my order. Eventually the guy on the phone mumled that it would be another 15 mins and then just hung up. Very disappointing service. Dumplings were also very overcooked

site_logo

Pullmayra . 2017-08-19

MORE AT Just Eat

Food was 15 mins late and when I caller the restaurant they couldn't find my order. Eventually the guy on the phone mumled that it would be another 15 mins and then just hung up. Very disappointing service. Dumplings were also very overcooked

site_logo

Pullmayra . 2017-08-18

MORE AT Just Eat

Pad Thai had awesome flavour but way too saucy for what it should be. Prawns were small. Sesame chicken wings also amazing flavour but not crispy how they're meant to be. Green vegetables were swimming in a pool of "light soya sauce" was more like a soup.

site_logo

Damaris . 2017-08-15

MORE AT Just Eat

everything i asked for was completely discarded.

site_logo

Ty . 2017-08-13

MORE AT Just Eat

everything i asked for was completely discarded.

site_logo

Ty . 2017-08-13

MORE AT Just Eat

Fue recomendado resplandor resplandor por un amigo y no puedo esperar para pedir de nuevo! Mejor crujiente de pollo en salsa de alubias negras que he probado y los rollitos primavera eran adecuadas. Gran relación calidad-precio, entregado en buen tiempo 5 estrellas

site_logo

Cesar N . 2017-08-06

MORE AT TripAdvisor

My delivery was incomplete. restaurant sent the missing items. Steve, the delivery man had great customer service.

site_logo

James . 2017-08-06

MORE AT Just Eat

Really disappointed with this food. They seem to have spent all their money on branding and fancy containers but none on the actual food quality. The Korean 'buns' were too dry to eat and weren't really buns at all, both noodle dishes were exceptionally salty and poor quality and it was just genuinely rubbish food packaged nicely!

site_logo

Nicola . 2017-08-06

MORE AT Just Eat

Steve was great. Food was amazing 😊

site_logo

amal . 2017-08-05

MORE AT Just Eat

Steve was great. Food was amazing 😊

site_logo

Amal . 2017-08-05

MORE AT Just Eat

Steve the delivery guy was lovely!

site_logo

Devika . 2017-08-03

MORE AT Just Eat

Steve the delivery guy was lovely!

site_logo

Devika . 2017-08-03

MORE AT Just Eat

Cómo alguien puede pensar que este es un buen chino no sé. . . En primer lugar, tomó un largo tiempo para ser entregado - 75 minutos. Los rollos de primavera estaban aguados y muy aceitosas, el chow mein era apenas mejor que un fideo pot y el green curry tailandés era sosa y pareciera una salsa cubierto pila de calle las barreduras. Todavía estaba bebiendo agua después barbaridad de un día estaba tan salado. He oído el turds del universo Goldman Sachs están interesados en comprar esta compañía. . Parece colocar aves. de plumas, etc. Evitar, zanahorias y Daikon en la ciudad de kentish es mucho mejor.

site_logo

JoJo2810 . 2017-07-31

MORE AT TripAdvisor

Me entristece mucho que escribir un comentario como este como Zing Zing solía ser genial, cuando empezamos a salir.

site_logo

Rebecca S . 2017-07-28

MORE AT TripAdvisor

Similary restaurants in London

restaurant_img
4.1

637 Opinions

location-icon5-6 New College Parade Finchley Road, Swiss Cottage, London NW3 5EP England
Chinese
outdoor_seating_268867takeaway_268867delivery_268867

I tried the dim sum menu, and it was okay. It was a bit overpriced compared to Chinatown and my only issue is that I wished the savoury croquettes had a bit more filling inside as I like croquettes. 👍 I really enjoyed the chicken with jellyfish; it was exceptionally delicious and fresh. I would recommend trying it. The interior is quite clean, and I didn't expect to see fish tanks with live lobsters and crabs. The service was average and quiet when I was here, though it was the start of dinner time.

restaurant_img
4.0

1709 Opinions

location-icon15 Prince Albert Road
Chinese
outdoor_seating_75520takeaway_75520delivery_75520

Absolutely fantastic thank you great staff great food x

restaurant_img
4.0

30 Opinions

location-icon40 Doric Way
Chinese
outdoor_seating_113787takeaway_113787delivery_113787

Food was amazing!!a really nice surprise away from conventional Chinese food. Will definitely try it again!

restaurant_img
4.0

78 Opinions

location-icon328 - 332 West End Lane
Chinese
outdoor_seating_82247takeaway_82247delivery_82247

Los aperitivos de sopa ganó ton bang bang y pollo eran buenas.El problema surgió cuando los principales campos como uno, un plato de pescado a la parrilla, a la izquierda la degustación de pescado y un poco duras, quizás demasiado cocido. El otro plato era carne frita con cebolla de primavera que estaba bien, pero necesitaba un poco de salsa de soja para darle algunos oomph.El servicio era amable.

restaurant_img
4.0

87 Opinions

location-icon28 Chalk Farm Road
Chinese
outdoor_seating_76403takeaway_76403delivery_76403

Visited three times since October and it's been boarded up! Tried calling for a table today and no answer! Why? Why?Why?Why?Why? Why?Why?Why?