GastroRanking-logo
whatsappWhatsapp
phoneCall
desktopWebsite
menuMenu
bookingBooking
4.0

Based on 454 opinions finded in 1 websites

site_photo3

Nº 199 in 422 in Winchester

Nº 10 of 13 Asian in Winchester

CUSTOMERS TALK ABOUT DISHES WITH..duckchickenramenchillispicypayprawnprawnsnoodlesmustcurryricesoupcookedsquid
Score
OpinionsNoteTripAdvisor4544.0

comment_iconOpinions

Thought this would be an excellent choice for lunch,but unfortunately this was not the case. From the moment we arrived the greeter tried to explain how things worked but we could not understand him nor did he want to repeat himself. He just kept scribbling on the paper on our table. Despite asking for large drinks they seemed to be small glasses. The food we ordered was well cooked, good quality and enjoyable.overall disappointing service and drinks and unlikely to comeback to this particular restaurant.

site_logo

Paul L . 2024-10-27

MORE AT TripAdvisor

The waitress seemed as though she didn’t want to be there. They only had a choice of two red wines and the one I ordered for myself and my wife they didn’t have. The duck donburi was tasty but had very little duck for £19 each. Our friends had to wait another 10 minutes for their food which was thrown onto our side of the table while we were eating. I will not be going back to this restaurant ever.

site_logo

Marvin1234 . 2024-10-24

MORE AT TripAdvisor

Myself and the family came in for lunch on Wednesday 18th September and were served by Ryan. Food was as good as always and the service was excellent. Very cheerful, and knowledgeable about the food he serves. Even recommended a new side dish for us to try which was the highlight of our visit 👍👍

site_logo

Liam . 2024-09-18

MORE AT TripAdvisor

Went for my young son's birthday. Was really busy but they still provided amazing service and made him feel special (especially a team member called Raphael).

site_logo

lizzieb303 . 2024-09-18

MORE AT TripAdvisor

Disappointed. Used to love Wagamama’s and their expansive plant-based menu, but since they changed that I was hesitant to visit. For good reason apparently. This was my first time back in over a year, and the quality and options for food are abysmal. No longer offer any of their plant based meat options which were iconic and delicious I.e, the ribs, squid and teriyaki chi*ken ramen. Basically if you don’t like mushrooms don’t bother eating here if you’re veggie or vegan. The salted edamame was soggy and covered in your standard table salt (this used to be fresh sea salt), an obvious cost cut. For my main I opted for the saku saku shiitake. It was way too sweet, noodles were crunchy almost all over and the mushroom was inedible. They were simply lumps of fried mush. Didn’t even look like mushrooms and had to question if I’d received the duck version instead. Shouldn’t be considered a main dish, maybe a side at best, and to charge £14.50 for what is essentially noodles and veg is astounding. Overall, the prices have skyrocketed and the quality had plummeted. Really used to highly regard Wagamamas, but not anymore. If you’re looking for really great Asian food in whiteley (with many delicious plant-based options), opt for Dim T instead. Far better service, food, and value.

site_logo

Morgan H . 2024-08-26

MORE AT TripAdvisor

AMAZING! This was my first visit to Wagamama, and I will definitely be back! Super friendly staff, clean restaurant. I have a peanut allergy, I was reassured and made to feel at ease knowing there aren't any dishes cooked on the premises containing nuts. Quick service, food was piping hot and extremely tasty! 10/10!!

site_logo

LJ789 . 2024-08-17

MORE AT TripAdvisor

We always come to wagamamas for lunch or dinner and we always have 5star service and lovely food. The waiters are lovely and are happy to accommodate any needs. We have never had any faults and will continue to return happy

site_logo

anynomous . 2024-08-05

MORE AT TripAdvisor

Just love Wagamama - love the variety and choice for vegan and veggie options .. spicy tasty - combined with friendly welcoming staff ! Thank you

site_logo

Fussy0nes . 2024-08-03

MORE AT TripAdvisor

We often visit this restaurant and up until this occasion we have always had a positive experience. We entered the restaurant around 11.15am, just after it had opened. We ordered our food and whilst we were waiting my wife paid a visit to the bathroom. When she returned she was dismayed. She informed me that she had spotted an employee from Rentokil at the back of the building. When we looked around the area adjacent to our table, we noticed that there were crumbs all over the tables, chairs and the floor. To be honest the combination of these observations put us off our food. We considered leaving but decided against it. To be fair the food was fine but we had lost our appetite for it and just wanted to pay and leave. We reported our dissatisfaction to our waiter. He was very polite and apologetic regarding the mess. He immediately cleaned up the crumbs around us. However our overall feeling was one of disappointment so I decided to submit a formal complaint. Their response was provided the following day both in writing and by way of a telephone call. The nameless Supervisor apologised and provided me with an unconvincing explanation regarding the presence of the rentokil employee. Her actions did not reassure us or change our view that the poor standards of hygiene we witnessed, at this restaurant, were completely unacceptable. As a result of this expereince we have lost confidence in the Wagamama brand and will think twice about returning again.

site_logo

Mark N . 2024-05-30

MORE AT TripAdvisor

Large party - looked after by Charlotte from start to end on Mother’s Day 😀. Great atmosphere. Freshly prepared Japanese style food ?. Menu choice throughout - A1. No hassle , friendly , helpful & efficient team service. Value - acceptable & as expected. Re - visit ? - four families ; undoubtedly.

site_logo

christophers8888 . 2024-03-10

MORE AT TripAdvisor

It's just a rushed, not very personal like being on a conveyor in food out no relax no personal service just a cog in the works, but I guess that's just the style of service,

site_logo

Curiosity691211 . 2024-02-10

MORE AT TripAdvisor

Great visit for lunch on a very busy Saturday, finally persuaded husband to try and went down very well. Food and customer service great, thank you to Ben, really welcoming, friendly good service.

site_logo

AlexS20182018 . 2023-11-13

MORE AT TripAdvisor

First time staying local to here. Solo business traveller. Went to Whitley for food. Love a wagas anyway….so ordered takeaway. Grace looked after me. And she was just lovely. Food was fit…two sides and an udon. Buzzing.

site_logo

Peter A . 2023-09-25

MORE AT TripAdvisor

So impressed with the staff at Wagamama’s tonight, they went out their way despite being super busy to accommodate a family with a few additional needs. They relocated us numerous times to enable my youngest with sensory issues to find a quieter space and totally looked after my oldest and his sesame allergy. Outstanding service throughout with very tasty food- everyone was happy. Big thank you to Phoebe, Paddy and Ryan who did a great job of looking after us.

site_logo

AlibalibeeP . 2023-08-30

MORE AT TripAdvisor

Great food as usual. Really efficient service. Big shout out to Max who was our server; funny chap, very charismatic who clearly enjoys interacting with customers. Seeing him talk to other tables (not just us) he remembered bits about their day and was making jokes that got people laughing. An asset to the team in my opinion.

site_logo

mr_gjt97 . 2023-08-03

MORE AT TripAdvisor

Not the first time we’ve been to this restaurant and certainly not the last. Very good experience from start to finish with speedy service throughout and varied cuisine all very nicely cooked. Waitress couldn’t have been nicer and extremely efficient

site_logo

Dave M . 2023-06-20

MORE AT TripAdvisor

I had never been to Wagamama’s before and a waitress called rhian was very helpful and polite and recommended what i should have. She made me feel very welcome.

site_logo

Ella P . 2023-06-07

MORE AT TripAdvisor

Very good food, excellent service. I will go back more often. I am really happy that I found this restaurant .

site_logo

Gyuláné P . 2023-05-27

MORE AT TripAdvisor

If you luv ramen, katsu, and everything in between, ghen expect consistency every time you enjoy it here. As far as chains go, well, this is the reason you make an exception if you aren’t into them, but if you are (which honestly what a silly thing to say, your local market is a chain, just saying!) …you can expect a high quality of food, level of service, and wonderful overall experience! Ev, Emily, Maddie and Leire are always available, friendly, and take pride in their job, clearly! This is an amazing business model that the employees respect, as the symmetry in service and chefs ability to consistently deliver should all be acknowledged applauded!

site_logo

biglbee . 2023-05-11

MORE AT TripAdvisor

Food is always fresh, tasty and well presented. But the real thing about this restaurant is the staff. They are pretty consistent everywhere and every time, but this particular branch is right up there and a real credit to the company. Had a great meal and the staff went above and beyond…. there is a touch of the “Hilton Hotels” approach where staff have the discretion to do things in order to ensure they deliver best in class. Thank you!

site_logo

MrBond67 . 2023-05-08

MORE AT TripAdvisor

I got greeted at the door by a friendly manger and seated very quickly. Informed that I have a limited time for lunch and he recommended a food and the dish came quickly. This is my first visit and enjoyed thoroughly. Your katsu curry was delicious. Great recommendation sorry forgot the name of the manger. Definitely will be visiting again based on last visit.

site_logo

FHaxh . 2023-02-27

MORE AT TripAdvisor

Have ordered from wagamama many times all being great. However this time it was awful. Opened my chicken ramen (from deliveroo) and everything was flooded in the broth. After draining a bit out I started eating the chicken and found the noodles. What the hell, the noodles had turned into a paste and was disgusting. Poor care this time ordering from deliveroo. Very disappointed, mabye more care would go in at the restaurant.

site_logo

Happiness48981146172 . 2023-02-09

MORE AT TripAdvisor

The restaurant was busy and service was a bit sloppy - my partner had to ask for her kimchi 3 times. The gyozas were burnt and crunchy and my katsu curry was average. We left and no staff said goodbye or thank you. Felt very impersonal, hectic and food wasn’t great.

site_logo

dougswift . 2023-01-29

MORE AT TripAdvisor

Great experience, server was informative and the restaurant although busy was quick and delicious! Special mention to Jess and Gracie who really made a quick lunch special

site_logo

Lawrence K . 2023-01-17

MORE AT TripAdvisor

Upon my visit it took a waiter around 20 minutes before seeing to us regarding ordering however I appreciate there was only a few members of staff working so didn’t think too munch into it , however once both my partners and my own food arrived it was very bland and lack any type of flavour , we always get these meals and it was just disappointing at how bland our meals were I complained where a waiter said if u have any problems in the future let us know , however my issue was at that time as a returning customer I was highly disappointed and after having to pay £55 I felt very disappointed

site_logo

saintem2023 . 2023-01-08

MORE AT TripAdvisor

This was our first visit to the restaurant. The meal was very tasty and the Scottish waiter, Greg gave fantastic service. We will definitely be returning next year.

site_logo

Lynne F . 2022-12-17

MORE AT TripAdvisor

Really lovely friends meal which was only made more enjoyable by the lovely Greg and Nicky! Food is always on point with Wagamamas but the amazing duo who served our food this evening were brilliant.

site_logo

889mollyn . 2022-12-11

MORE AT TripAdvisor

Visited on Thursday evening with parents and sister after we had sadly had to attend a funeral several hours away. Never been before so hadn’t known what to expect but the others had been. Greeted by Gregor?gregory? He did say we could refer to him...

site_logo

682kathrynj . 2022-12-09

MORE AT TripAdvisor

We have never eaten at Wagamamas before, but decided to give it a go. Firstly, the staff were welcoming, friendly and SO helpful .. one of the reasons we will definitely be back. They helped us through the menu; listened; smiled and our food and...

site_logo

SilverWeddingUk . 2022-12-07

MORE AT TripAdvisor

Wagamamas never fail to disappoint, especially this visit when hosted by Freya. Always my go to restaurant

site_logo

MeganSc02 . 2022-12-05

MORE AT TripAdvisor

I go to this restaurant often with friends and family and love the meals. However, I visited recently and didn't enjoy my meal. Not wishing to be rude I mentioned to the lovely staff members that, unusually, I did not enjoy my meal. To my...

site_logo

Jan A . 2022-11-13

MORE AT TripAdvisor

Me and my friend had a lovely meal here tonight at Wagamamas Whiteley, we were served by Gregor and Joe who were both great! Thankyou

site_logo

Ellscooperxxx . 2022-11-02

MORE AT TripAdvisor

I have no idea why our food today in Fareham was so flippin good, but it was. Literally everything we had was the best it could be and honestly, Sandy served us the best food we've ever eaten at a Wagga's in the last 15...

site_logo

Barry O . 2022-10-29

MORE AT TripAdvisor

The restaurant was almost full at c.8.30pm on Thursday; we were greeted enthusiastically and there was a really good vibe in the restaurant. Every single person we came into contact with showed outstanding hospitality and guest service. Well done to the entire team. Additionally our...

site_logo

jameslgodwin . 2022-10-14

MORE AT TripAdvisor

Please can someone explain to me what is enjoyable about each person in your group getting thier food at different times? We were a party of 3. All ordered a drink each, a starter and a main. Here is the sequence it arrived Main 1...

site_logo

John B . 2022-10-06

MORE AT TripAdvisor

Very enjoyable experience, had the pad Thai with a few sides and couldn't fault it at all. My daughter especially loved her crispy fish and rice.

site_logo

U3584EQdevonshire . 2022-09-07

MORE AT TripAdvisor

we visit here often as we enjoy the food so much, nothing changed today food was 10/10 and the staff were all so friendly and welcoming. my friend i visited with has an allergy to egg, the staff are always very accommodating to this, we...

site_logo

meggyh98 . 2022-08-02

MORE AT TripAdvisor

Always wanted to try Wagamama . Food was tasty but if you want to eat as a family together, forget it .my main course came 1st with no sign of any cutlery, sent it back as the meal went cold before I could alert a...

site_logo

kevraquet . 2022-07-29

MORE AT TripAdvisor

We were so pleased we chose Wagamama today... we enjoyed a delicious, freshly cooked meal, made even more special by the fantastic service of the staff. The ‘Yaki Udon’ was like nothing I’ve ever come across before with its bonito flakes adding another dimension as...

site_logo

Sandra H . 2022-04-20

MORE AT TripAdvisor

Delightful evening out at Whitely Wagamama. Busy but found us a table for six in a few minutes. Waiter ( Noah) training but attentive and cheerful and staff all helpful. Assistant Manager took and personally delivered allergy order. Kids ate everything and we ordered more...

site_logo

Escape465265 . 2022-02-12

MORE AT TripAdvisor

We had a gorgoeus meal sampling the new Veganuary f-ish dish! The restaurant was very busy but the attention to detail from our server, Mackenzie, and the speed at which the food arrived was impressive! The vegan menu is delicious and so fresh and flavoursome!...

site_logo

ElishaL_12 . 2022-01-14

MORE AT TripAdvisor

I haven't been to Wagas for a couple of years (due to the obvious). My son wanted to go as a 16th birthday treat, so 6 of us decided to visit the Whitely restaurant as we have been before and know it well. Nothing wrong...

site_logo

Emdogpurr . 2021-11-18

MORE AT TripAdvisor

- Food came at at different times (starter came before drinks, then one main meal) - Waiter wasn’t attentive - spent a lot of time playing around with the staff eating at their own table, throwing bits of food at the back of their heads...

site_logo

2BoatyMcBoatface . 2021-10-17

MORE AT TripAdvisor

We had a delightful meal at Wagamama Whitely - celebrating the new plant pledge menu! Natasha was an excellent host and guided us through all of the new dishes - very friendly and attentive! All food was fresh, hot & tasty!!! We especially loved the...

site_logo

ElishaL_12 . 2021-10-06

MORE AT TripAdvisor

Haven’t been here for two years due to lockdown etc. Food really quick and piping hot. It’s very noisy at 1730 on a Sunday and a bit of a crèche. Probably better to go later but it did quieten down by 1830. Serving staff super...

site_logo

spencerallen . 2021-09-26

MORE AT TripAdvisor

Brilliant place!. Lovely and attentive staff, and the food was amazing!! Am going back this week. SO good to have somewhere that does vegan - and not just a spicy burger 🙄😴 Highly recommended 👌

site_logo

Michelle P . 2021-08-26

MORE AT TripAdvisor

Service just isn’t up to par here there are many better restaurants around in Whiteley where better service is provided. Will be looking for a new alternative after this experience as i feel as though the experience is just as important as the food.

site_logo

C5326WYjohnm . 2021-07-29

MORE AT TripAdvisor

We visited this Wagamama in Whitely in July and received excellent service, and care for our group of three adults and two children, particularly from Michael . The food was lovely and the warm evening most enjoyable as we sat outside. We hope to be...

site_logo

Madbeaglerthethird . 2021-07-20

MORE AT TripAdvisor

Server not very attentive. When we asked for advice he said that info on other side of menu quite bluntly. Our food was delicious. I know food comes out as it is ready but we had all finished our food when deep fried vegetables came...

site_logo

family186299 . 2021-07-14

MORE AT TripAdvisor

Made a visit on a Thursday evening, unable to book so had to stand in line… Glad it was not raining! A table came up so we 4 sat… Menu on the table and drinks ordered …. Mmmmhhh what yo have! I went for the...

site_logo

Peter M . 2021-07-11

MORE AT TripAdvisor

Shocking service, somehow burnt the food and managed to serve it cold. Didn’t check how our food was, waiter was too busy chatting to two drunk girls the whole time. When we asked for the bill he then proceeded to serve three more people and...

site_logo

Lukewestmorland94 . 2021-07-06

MORE AT TripAdvisor

Visited this waggas today and it was honestly the best waggamammas/udon I have had in years. The food was awsome the drinks where cold fast and delicious. Couldn't have asked for a better service all round totally satisfied in every respect.

site_logo

chrisvI8061MC . 2021-06-14

MORE AT TripAdvisor

As a coeliac it’s important for me to feel confident ordering gluten free from a restaurant. The service was excellent and the waitress informed us that the manager would take my order. I understand that they take allergies seriously- and do all they possibly can...

site_logo

CarolB248 . 2021-05-31

MORE AT TripAdvisor

Wagamamas is the best and this branch in particular. They are really good with service and food is excellent as expected

site_logo

andrewroke . 2021-04-28

MORE AT TripAdvisor

Great food & great service. Ordered for collection and the food was perfect timed and ready for collection. Staff are friendly and the food never disappoints. Can’t wait for restrictions to be lifted and be able to sit inside for a family meal.

site_logo

FamilyInspiredTravel . 2021-03-21

MORE AT TripAdvisor

As per the title you get what you expect from a chain, the staff are very nice and the food is good.

site_logo

aarontownsend . 2021-03-10

MORE AT TripAdvisor

Hands down the best Wagamama’s I’ve ever had. And I’ve eaten a lot of Wagamama’s over the years. It was busy but we sat on a high bench out the way. Love the new way you pay, so much easier. Staff were wonderful. Fantastic.

site_logo

Foodiemother7316 . 2020-11-15

MORE AT TripAdvisor

We had such a lovely evening, largely because the staff were so friendly, helpful and efficient. It’s so refreshing in these weird times to have friendly staff who still treat you with respect and kindness, rather than treating you like a leper, as some places do! Well done Wagamama! ❤️

site_logo

rachelnorthover80 . 2020-11-12

MORE AT TripAdvisor

Great new queuing system and very COVID-safe, all our servers including Rhiannon were really attentive and helpful in explaining the new procedures.

site_logo

georgepH2613CU . 2020-10-10

MORE AT TripAdvisor

I was super impressed at how efficient the entire experience at Wagamama has been. From clearly explaining their COVID policies and procedures, to the convenience of an electronic queue and payment, this visit has been safe, well organised and delicious. The food was warm, tasty and incredibly quickly served, and the service was phenomenal. Special shout out to Corinne and Rhiannon for making the whole experience so wonderful.

site_logo

DanJ2198 . 2020-10-10

MORE AT TripAdvisor

First time at wagamamas, amazing food, amazing service, lovely friendly staff. Shout out to Corrine and Rhiannon Refreshing experience, covid guidance clearly explained on sitting to eat, making everything clear and feel safe and very well done. Virtual queuing saved queuing for ages to be turned away at the door as seems to be the standard since covid.All in all lovely meal and lovely atmosphere.

site_logo

GeorgiaBoulding . 2020-10-10

MORE AT TripAdvisor

What excellent service. Delicious food all round and crayons etc for the kids. Really impressed. Defo recommend the Gin and tonic....

site_logo

Carterishandsome . 2020-09-30

MORE AT TripAdvisor

We had a great experience here, service was spot on with friendly and helpful staff, food menu really extensive with plenty of options, food came really quick, served hot and flavours were fab! Payment options really good with contactless or payment app available. Everything was awesome, thanks team Waga!

site_logo

OurExp-CM . 2020-09-23

MORE AT TripAdvisor

We visited Wagamama so that we didn’t have to eat in the Solent Spa Hotel, where the menu was really poor. Fantastic experience. Absolutely spotless and great food.

site_logo

Hiphopholty . 2020-09-03

MORE AT TripAdvisor

We went for my mum and partners birthday the food was amazing and service corinne gave us was amazing would 100% recommend

site_logo

Staylor7771 . 2020-09-02

MORE AT TripAdvisor

First time here since lockdown, first time with my boys they loved it! food was amazing, service was fab can’t wait to come back again

site_logo

MelG1512 . 2020-08-28

MORE AT TripAdvisor

First time visiting Wagamamas after many recommendations from our friends. Food was very tasty and there was a decent variety. Staff very friendly, didn’t catch our waitresses name but she looked after us well. Restaurant also kept up with government safety measure.

site_logo

Johnandemily28 . 2020-08-27

MORE AT TripAdvisor

We decided to take advantage of the eat out to help out at Wagamamas, I tried to book at the weekend but was told that they weren’t taking any bookings anymore. After standing in the queue for well over an hour on a crazy hot summers day a group just stroll straight past the line and walk in......because they had booked a table! Not far behind us in the queue was a heavily pregnant lady! Not cool Wagamamas whiteley. Apart from the bad start the food was as always amazing and our server Lucy definitely made the evening more enjoyable with her wonderful smile.

site_logo

Daveeats909 . 2020-08-13

MORE AT TripAdvisor

Once again the front of house staff were so accommodating and friendly from our arrival to our departure. As well as receiving amazing customer service, the whole experience is topped off with delicious flavoursome food. Charlotte (the lady looking after our table) was very helpful with the choices of our dishes, as we wanted to try new side dishes. She was very delightful and definitely made our evening. There is a Wagamama close to us but we prefer to travel to the Whitley branch as the whole experience is exceptional.

site_logo

kristycP2446HR . 2020-08-10

MORE AT TripAdvisor

Lovely service from everyone, food was lovely like everytime. 5/5 experience from the second we turned up. Absolute transparency with the wait time, more than happy. Charlotte was amazing and accommodated for every request we had. Thank you

site_logo

oscar00s . 2020-08-10

MORE AT TripAdvisor

Very tasty fresh food and Covid safety measures in place. Really polite staff too. Loved my pad thai.

site_logo

Elmo1989_03 . 2020-08-07

MORE AT TripAdvisor

Me and my partner arrived for what we thought would be a bog standard meal but were quickly (and surprisingly) encouraged to make sweet love on the table.. ever the exhibitionist I spread her cheeks and ate my starter from her sweet pussoire. The baby sitter called shortly after this so we didn’t get to stay for a main but we shall return. Highly recommended.

site_logo

Adamandchan . 2020-07-11

MORE AT TripAdvisor

Literally cannot wait for you to reopen ... When, when, when will I be able to get my fix of chilli squid???

site_logo

Richardandmichelle1 . 2020-06-17

MORE AT TripAdvisor

visited this wagamama branch for a nice hot soup, on a very cold day. Was crowded as it was around lunch time on weekend, so it was expected a bit of waiting time. The food was good but we couldn't help to notice, that the starters didn't come at the same time. Other than that, we had the mains together and were able to enjoy a nice meal

site_logo

_walesmejones . 2020-02-25

MORE AT TripAdvisor

Been coming here for years , never had a bad meal , MY no.1 choice in Whiteley. If you've not been then go you won't be disappointed

site_logo

Sunshine4456 . 2020-02-16

MORE AT TripAdvisor

Exactly what I needed. Great vegan menu too. Friendly, quick and efficient service. Perfect lunchtime bite. I’ll definitely go back

site_logo

tomcweaver . 2020-01-28

MORE AT TripAdvisor

I love the food at Wagamama and the staff at Whiteley are really good.I have been a regular for takeaways for sometime, but most recent visits have put me off and I will only be eating in the restaurant rather than getting take out.Last visit 2 days ago, ordered online for a 730pm collection.Arrived on time, first food was ready at 740pm, with the rest following bit at a time with the complete order not ready until 8pm.Most of it was completely cold when I got home, really dissapointing.Staff were really apologetic, offered me “some drink” to take with me which I declined, all I wanted was a nice hot dinner at the end of the week!

site_logo

Richbsgd . 2020-01-19

MORE AT TripAdvisor

Came here with friends and family, 4 adults 3 kids. Service was fast and friendly. Food was as you'd expect fro wagamama, very tasty. Will definitely come back again.

site_logo

bigga86 . 2020-01-09

MORE AT TripAdvisor

Good food and friendly staff BUT once again food service all over the place.Sides came as starters and we had to eat them otherwise they would have been stone cold, even then my wife's meal come 10 min later and mine 15 min after that, so much for eating a meal together.....I uderstand this way is the 'company way' but when the orders taken at the same time and the restaurant is only a quarter full, if that, surely the chefs can coordinate like a normal kitchen? Its the only downside to this company.....

site_logo

gom906 . 2019-11-30

MORE AT TripAdvisor

We stopped here for a bite to eat after some Christmas shopping I was given a gluten free menu and decided to try the new nikko curry. The manager took my order and I had the sea bream & white rice. As I didn’t want it too spicy I asked for less chilli. It was perfect with pak Choi, mange tout, bean sprouts- delicious My partner had the mid glazed cod ramen which was also very good & spicy). The staff were very friendly and helpful and attentive. We were quickly shown to a table and served drinks despite it being busy.

site_logo

CarolB248 . 2019-11-17

MORE AT TripAdvisor

Corrine and Charlotte were super amazing. Great food recommendations.Food was lovely. Looking forward to coming back!

site_logo

Happiness222668 . 2019-11-14

MORE AT TripAdvisor

I'm not a big noodle fan so I didn't have noodles so they may be incredible. I went for the chicken katsu which was really nice, but the rice to sauce ratio was a bit out so it can be a little claggy. Also had some little duck dumpling things which were lovely.Generally it is a nice place for a meal, it's not anything special and it's quite expensive.

site_logo

Loncat . 2019-11-07

MORE AT TripAdvisor

Lovely atmosphere. Lovely waitress. Food was fast, hot and tasty. We had a person with a nut allergy and order was taken by Manager. Felt safe and looked after. Dessert difficult with allergies.

site_logo

Jo8ie . 2019-10-21

MORE AT TripAdvisor

Having holidayed in Japan was interested in seeing what food was available here being gluten free.

site_logo

Margery P . 2019-10-14

MORE AT TripAdvisor

Can’t fault Wagamama. Decided this time to order sides first to have as a starter, pancakes and chilli squid - perfect portion size.

site_logo

LeSaintly . 2019-10-05

MORE AT TripAdvisor

The waitress was brilliant she put up with all of our tricky requests and was very attentive too! Great fresh quick food. We had a lovely night - thank you wagas Whitely!!

site_logo

Trek695728 . 2019-09-30

MORE AT TripAdvisor

Can’t say this any better than just OK. 8 yo Grandson enjoyed it though. Very similar menu in restaurant in Frankfurt airport at least ten times better than this. First and last time unless Grandson chooses it again.

site_logo

michaeltQ7479YF . 2019-09-16

MORE AT TripAdvisor

Overall disappointed with our first trip to Wagamamas - Saturday evening at 7pm, so we had to wait around 10 mins before being seated, but at least we'd had a menu so could order straight away when seated, or so we thought - 5 minutes later (literally) our server actually turned up at the table and that set the tone for the evening - we saw our server 5 times in the hour we were there, twice to take our order (mains then desert), twice to bring our food and once with the bill - that isn't service, its the bare minimum for a restaurant! What was annoying was the table opposite of 6 she was continually back and forth - they were seated after us, ordered before us, received their food 10 minutes before us and left 15 minutes before us - all because the server was waiting on them hand and foot! We asked for the desert menu, decided within a minute and then waited 10 minutes to actually order desert, being completely blanked half a dozen times during that 10 minutes. I guess the servers favour bigger parties as they think the tips will be better - too right, the service we received warranted a tip of zero! With a more attentive server we could have finished at least 15 minutes earlier too, instead of sitting around waited to be attended to.

site_logo

Russ D . 2019-09-08

MORE AT TripAdvisor

Really lovely food thoroughly enjoyed by all of us there was a party of 12 excellent service very friendly and pleasant waitress Will be going back in two weeks time!!!!!

site_logo

russellm841 . 2019-09-01

MORE AT TripAdvisor

Ordered no prawns in pad Thai after eating half of it I then discovered prawns in it! I was put off as I can’t stand prawns, so I told the waitress she was very polite and helpful. Anyway we then waited half an hour for our steamed buns in the end we just gave up and asked for the bill instead of waiting any longer! I had no problem until they tried to charge me for the half eaten pad Thai which they put prawns in! Again the waitress apologised and went and spoke to the so called junior manager.. (which is apt for the childish behaviour)

site_logo

Keith Newman N . 2019-08-31

MORE AT TripAdvisor

Absolute waste of time. People say t if you don't like the wagamama way don't go, well i certainly wish I had reviewed this establishment before going. On arrival chefs were leaving in their full chefs whites (which were not white after a shift) via the entrance, very off putting. 5 meals ordered and 4 of which arrived at different times. Apparently the food is cooked by highly qualified expert chefs. We dined off peak so restaurant was quiet and 14 chefs were unable to produce 5 meals at least approximately the same time. The first meal had been eaten before the second one arrived.

site_logo

Linda F . 2019-08-30

MORE AT TripAdvisor

Love the range and that everything is fresh and tasty. Always good value and a regular haunt for me.

site_logo

CNKM13 . 2019-08-17

MORE AT TripAdvisor

Myself and my mum visited after work on a week day and the service was just how you'd want every restaurant to be which is brilliant and not to mention the tasty food. All members of staff are helpful and happy to help .

site_logo

lucy5871 . 2019-08-08

MORE AT TripAdvisor

Usually this is a great place to eat. Today the steak ramen was ok but the steak was very chewy. Other than that it was ok.

site_logo

430kate . 2019-08-06

MORE AT TripAdvisor

After visiting multiple Wagamama’s around the country i can’t honestly say Whiteley is the best around. The food was and always is divine. To top that off the staff are very attentive and friendly. Charlotte, our waitress, was very friendly, chatty and all round amazing! Thankyou lots

site_logo

CalamitySwain . 2019-07-29

MORE AT TripAdvisor

I regularly visit Wagamama and love it. Whiteley’s my favourite restaurant around as the staff are all so friendly and helpful, particularly the new manager, Jess, who despite being fairly new was extremely informative and generally very friendly! Some of my favourites are the teriyaki donburis and the yaki sobas. The new chocolate layer cake on the dessert menu is divine!! Highly recommend everyone gives this place a try, there’s no where else like it!

site_logo

lauratT1989EU . 2019-07-18

MORE AT TripAdvisor

Wagamama is located just opposite M & S and has plenty of parking just minutes away including plenty of disabled parking.

site_logo

John A . 2019-07-08

MORE AT TripAdvisor

Have been to Wagamamas countless amount of times and you really can't beat it. The food is always beyond amazing and the service is just second to none. Without a doubt you are always faced with the most professional, caring and friendly team members who really create an experience. You can tell they all clearly love their jobs and are proud to work there.

site_logo

SGreen125 . 2019-07-05

MORE AT TripAdvisor

We found the food excellent with plenty of choice, we have also visited the Wagamama Restaurant in West Quay and Gun Wharf Quays and found them as good as Whiteley. We will most certainly be going again.

site_logo

martynbulpitt . 2019-07-04

MORE AT TripAdvisor

good quick service and one course is enough as ample servings.Good quality noodles and fresh veg.I find wagamamas consistently good and know that it is a good standby if there is a choice of unknown eateries.

site_logo

jocelynhooton . 2019-07-03

MORE AT TripAdvisor

Similary restaurants in South East

restaurant_img
4.0

645 Opinions

location-icon8-9 Jewry Street
Asian
outdoor_seating_143696takeaway_143696delivery_143696

First time visiting. Nice venue and a very good atmosphere Staff v friendly . Food was very average . Wouldn’t rush back.

restaurant_img
3.9

167 Opinions

location-iconBank Street
Asian
outdoor_seating_141353takeaway_141353delivery_141353

Best Indian but don't no if it's still open 😞

restaurant_img
4.5

26 Opinions

location-icon21 Broad Street, Alresford SO24 9AR England
Asian
outdoor_seating_252304takeaway_252304delivery_252304

First time take away from Aroy! Wow! Best Satay I’ve ever had! Everything was fresh, succulent and super tasty! They really know how to cook. We will be going back many times! Thank you.

restaurant_img
4.6

1486 Opinions

location-icon17 City Road
Asian
outdoor_seating_144530takeaway_144530delivery_144530

One of the best curry house in town. Awesome food and familiar environment.. Everyone should try..you don't regret...

restaurant_img
5.0

14 Opinions

location-iconUnit 30, The Brooks, Middle Brook Street Unit 30, The Brooks
Asian
outdoor_seating_319196takeaway_319196delivery_319196

Looking for a light bite at lunch time and found Marse. We all had the combo bowl, every different item was delicious and we all struggled to find a favourite. On balance mine was the summer roll. We managed to sit outside and the service was with a smile. We will return next time we are in Winchester, it was a real flavour treat.