GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
3.4

Based on 5.022 opinions finded in 4 websites

site_photo4

Nº 5614 in 7028 in City of London, Westminster

Nº 220 of 253 Japanese in City of London, Westminster

CUSTOMERS TALK ABOUT DISHES WITH..noodlesoldramenfriedsaladspicyprawnmeatbrothsquidduckcookedcurrychickenricesoupchillipay

comment_iconOpinions

That area of London is quite busy on a Saturday evening, but the advantage of Wagamama is that you can’t book. We arrived and were able to go straight in. When we left there was a queue for the place. There was a wide range of choices on the menu, I had initially considered a Korean hotpot with tteokbokki, however it was quite a hot day and I wasn’t sure if I wanted a hot pot dish, also for me that ruled out a ramen as well. I did like the idea of a salad, but in the end I went with the yaki soba yasai with mushroom. This was soba noodles cooked with mushrooms, egg, peppers, beansprouts and white and spring onion. topped with crispy fried onions, pickled ginger and sesame seeds. It was really good. I love the combination of flavours and textures. It is probably my go to dish when visiting Wagamama. This dish had a good portion of mushrooms and I found it delicious. Though service was okay, we did have a long delay on the gluten-free dish for our table. When it did arrive it was very tasty I was told. I really don’t mind that Wagamama bring out the dishes when they’re ready, but we weren’t really expecting the difference to be nearly thirty minutes! As a result I had finished my food (as it was the first to arrive) by the time the gluten-free dish arrived on the table. That was disappointing.

site_logo

James Clay . 2025-05-14

MORE AT Google

The team here were so kind and thoughtful dealing with my daughter’s allergies, even when my other child accidentally cross-contaminated her dinner with an allergen. Nothing was too much trouble and they were happy to help, which was so delightful when a 10yo is learning to navigate the world with nut and shellfish allergies. Kudos to the whole team - we appreciate you.

site_logo

Penny Gosling . 2025-05-13

MORE AT Google

The food and service were really good. The one thing I do find quite strange is that all of the food arrives at completely different times. It was explained to us that different cooks prepared different meals, but what's the point of ordering appetisers if they arrive after your main course.

site_logo

Steve . 2025-05-11

MORE AT Google

My parents were visiting London and enjoyed their lunch here. We had great experience and taken care by Bhabuk - great customer service! Many thanks!

site_logo

H. J. . 2025-05-10

MORE AT Google

Good food with relaxed vibe but our server didn't seem sincere.

site_logo

Kelvin Campbell . 2025-05-07

MORE AT Google

Amazing service by Geetha. Excellent food. Accommodated us at short notice and late on a Friday night. Attention to detail and service was excellent 👌

site_logo

shashisunder udyawar . 2025-05-03

MORE AT Google

Food was great and was made aware of the soul club app by our lovely server Bhabuk so got some free sides as well! He was so helpful and attentive a credit to the company!

site_logo

Olivia B . 2025-05-03

MORE AT Google

Wagamama is always our fall back meal. We love it especially the Chilli Squid.

site_logo

Mark Sawyer . 2025-04-23

MORE AT Google

It was ok. The food was better in another location that i visited before.

site_logo

Brigitta . 2025-04-20

MORE AT Google

The ramens were awful! No taste in the broth or the noodles

site_logo

Mr.Viking 7 . 2025-04-20

MORE AT Google

Service was fine, it has a good atmosphere on par with the theme of the restaurant. My only complaint is concerning the quality of the food, the broth of almost each ramen on the menu was bland and had no richness to it. The gyozas weren't even cooked properly for them being obviously store bought frozen.

site_logo

Martin Bozhilov . 2025-04-20

MORE AT Google

During my visit to London, I visited you twice and I was not disappointed - very tasty dishes and nice options on the children's menu :-) I recommend it

site_logo

Agnieszka bucka . 2025-04-17

MORE AT Google

This was my first time here and the service was excellent. The servers were very conscious about dietary restrictions/allergies and made sure the member of my party who had allergies was taken care of. They even went the extra mile to help us celebrate my friend's birthday which made for such a lovely evening. The food was good too-though my udon dish was a tad dry. Lastly, our main server was a bit flirtatious which is unprofessional. Other than that, I would return here.

site_logo

Victoria Alston . 2025-04-16

MORE AT Google

Delicious food with very good taste and quality. Unfortunately, service was below average and the restaurant was very dark, loud and the seating was rather uncomfortable. The prices are relatively high for a chain. It used to be better.

site_logo

Jan Beyer . 2025-04-14

MORE AT Google

Good place to eat with only Asian specialties. Be careful, some menus are very spicy.

site_logo

Gîte les toits de turckheim Bentz . 2025-04-14

MORE AT Google

Long wait even though at least 40 people walked out. One group at a time seating so wait even longer. Men’s stall had no water!!!! Is this London?

site_logo

Omar Farooq . 2025-04-14

MORE AT Google

Very busy lunchtime today. Waited in a queue for about 15 minutes. The food was good.

site_logo

Audrey K . 2025-04-11

MORE AT Google

Bhabuk was the best wagamamas wait staff I’ve EVER had! He was so friendly and helpful he showed us through the sole club app and helped us claim our free small plates (edemame and crackers). We had a small issue where a our bao buns didn’t arrive and he had them taken off the bill and given to us in a takeaway container. He was super super lovely, helpful, efficient and just overall a great friendly guy. Go Bhabuk we love you!!!!!

site_logo

Phoebe Anne Hall . 2025-04-07

MORE AT Google

Service was good, food was not good. Paid extra for the salt and chili on the edamame but hardly had any. Got the pork bao bun, with just straight up mayo was so plain and the beef gyoza were average.

site_logo

Caitlin Carroll . 2025-04-06

MORE AT Google

Flavour Explosion Near Charing Cross: Wagamama Delivers! Okay, here's a concise review based on your experience: **A Flavourful Find Near Charing Cross** Recently enjoyed dinner with two friends at Wagamama near Charing Cross station and had a fantastic experience. The food was absolutely incredible – everything was tasty and packed with rich flavour. I ordered the chicken coconut kare, which was so delicious I'm already eager to go back for it again. The service was just right: attentive without being overbearing. Highly recommend this Wagamama for a flavourful meal and great service.

site_logo

Kristelle Kamini . 2025-04-05

MORE AT Google

Bhabuk served us and he was soooo lovely. My family and I had an excellent lunch and we enjoyed the food a lot. The portion sizes were great and the taste was also great. The service was very nice, Bhabuk helped us with the App and our meal choices and made great conversation. He was super nice !!! Overall 10/10 experience

site_logo

Nikita Natu . 2025-04-03

MORE AT Google

Great service and great hospitality, Thanks to Bhabuk. These kind of people make customers for a lifetime.

site_logo

Karan Ahluwalia . 2025-04-01

MORE AT Google

Big Wagamama fan but unfortunately all their Vegan options weren't available on that particular day , Disappointing, staff were very apologetic , the Vegan fryer was temporary out of action. Nice to know they do actually cook plant based food separately though.

site_logo

Jason Macgregor . 2025-03-29

MORE AT Google

As expected, the food was delicious my favorite 42😋 ! Bhabuk was a very nice waitress. Recipe 4622

site_logo

A. Duerr . 2025-03-22

MORE AT Google

From the moment my sister and I stepped inside, we were greeted by chaos. The staff appeared unprofessional, and a loud argument between the waiters filled the entire restaurant. The dishes arrived in an odd sequence—my sister had to wait a full 40 minutes for her main course, long after I had received mine. The waiter apologized but placed the blame on the kitchen, going on about how much pressure he had put on them—an unnecessary and inappropriate comment. When we finally asked for a discount as compensation for the poor service and long wait, we were simply told it wasn’t an option. We won’t be coming back.

site_logo

Mette Skeem . 2025-03-19

MORE AT Google

As soon as we stepped into the restaurant, the atmosphere was stressful and tense. They were understaffed, and therefore the servicing was tedious. The service was unprofessional. The dishes arrived in an odd sequence. I had to wait nearly forty minutes for my order, long after my sister had received hers. The people beside us were served cold food, because the waiters couldn’t manage to bring the orders in time. Our waiter was inappropriate and blamed it on the kitchen, but it was obvious, that the waiters were the cause. Inappropriate arguments broke out among the servants, which made the experience even more uncomfortable. We asked for a discount as a compensation for the poor service and the long wait, but we were simply told that it wasn’t an option. I’m disappointed, and I’m not going back.

site_logo

Marie Skeem . 2025-03-19

MORE AT Google

Very poor service here, they are clearly understaffed. Waited nearly an hour for water after asking multiple times. Told us one of the desserts we ordered was out of stock only when they were bringing everyone else’s desserts to the table - they asked if we wanted another one but we declined as we didn’t want to wait another half hour for it to arrive… Also the scan to pay option was not working so we had to go and get someone to pay our bill. Icing on the cherry was that the out of stock dessert had been included in the bill!! We were walk ins on a Friday night so expected it to be busy but not this bad, if it’s too busy then restaurants normally recognise that and don’t admit further customers. They are clearly catering to people visiting London here as it’s a tourist hotspot so probably don’t feel they need to provide good service for repeat custom.

site_logo

Tom Butler . 2025-03-01

MORE AT Google

Our server Bhabuk was a lovely chap, would definitely come back for him, he was so sweet and kind, very accommodating!! ♡

site_logo

Nicole du Casse . 2025-02-26

MORE AT Google

Uncomfortable stools, food as expected from Wagamamas.

site_logo

Tracy Shields . 2025-02-23

MORE AT Google

I love Wagamama's, sadly this was my worst experience for food and service, really bad. I have never had such a bad meal, or such a miserable waitress.

site_logo

Alison Thomson . 2025-02-23

MORE AT Google

The same Wagamama as found in Antwerp, Amsterdam, or Brussels; however, it provides an enhanced version of the restaurant experience.

site_logo

Nataliya G . 2025-02-22

MORE AT Google

Delicious food, friendly staff and decent atmosphere.

site_logo

Andrew Hazley . 2025-02-20

MORE AT Google

An amazing experience at Wagamama. Bhabuk, our server was brilliant with his friendly and attentive service. Food arrived very quick and was delicious. Thank you Bhabuk

site_logo

Sagar . 2025-02-16

MORE AT Google

Clean restaurant, a great selection for vegetarians and vegans, friendly staff, and excellent food.

site_logo

Natálie . 2025-02-14

MORE AT Google

Our server Bhabuk was so wonderful and helpful. Gave great advice for the menu <33

site_logo

gracie fay . 2025-02-12

MORE AT Google

Friendly and helpful staff good service even at busy times.

site_logo

Vanessa Binnie-Ritchie . 2025-02-12

MORE AT Google

Great atmosphere and excellent service from Bhabuk who gave me a lot of much appreciated menu advice when my usual order wasn't available!

site_logo

Mariana Fay . 2025-02-12

MORE AT Google

Don’t often leave reviews for big chains but shout out to Bhabuk our waiter! His service was top notch, very polite but personal service which is quite rare for Wagamama! If you come to this wag’s you’re in luck if you get Bhabuk as you waiter! 10/10 🌟

site_logo

Louis Lander Deacon . 2025-02-07

MORE AT Google

Visited Wagamama last Wednesday Everything was good Food , drinks, and especially our water Diana was amazing She advised the best food and drinks and was just amazing person to advise All best wishes and recommendations for her

site_logo

Maks Maks . 2025-02-05

MORE AT Google

Had a fantastic lunch at Wagamama Covent Garden today! The variety of Asian flavors—Korean, Malaysian, and more—was absolutely delicious. Every dish was packed with taste and freshness. The service was great, with friendly and attentive staff who made the experience even better. Definitely a place worth visiting again!

site_logo

موزه المنصوري . 2025-02-05

MORE AT Google

Perfect the food, the place, the atmosphere, the staff even the price. would come here again definitely.

site_logo

Media Branch . 2025-02-01

MORE AT Google

a special shout out to our waiter bhabuk who was so helpful and attentive, he made everyone feel welcome and everyone was pleased with this amazing service. ✨✨

site_logo

may mist . 2025-02-01

MORE AT Google

Geetha was amazing! Very accommodating. Give her a raise already

site_logo

Janhavi Barve . 2025-02-01

MORE AT Google

I really enjoyed our time there. The service was the best , Avaash was very nice and checked on our table and even guided us on how to sign up for the Wagamama club

site_logo

Keshia Philippe . 2025-01-29

MORE AT Google

Yummy food! Very nice staff, especially the Av guy! Nicee atmosphere

site_logo

Bradateanu Ana . 2025-01-28

MORE AT Google

The food was amazing!!! Such a nice place if you are looking for plant based food: soo many options that were SOO GOOD!!! Staff incredibly friendly!! I will come back for sure!! Thank you Av for being such a nice guy!!

site_logo

anna fraa . 2025-01-28

MORE AT Google

We arrived at 6pm and there was a queue and waited about 30mins with mostly people finishing work meetings with friends so the worst time to go from 5pm to 7pm. **AVOID THESE TIMES** Sadly the food was just about warm and not the best as it had obviously been sitting around for a while before being brought to the table... I've been to wagamama many many times but this had to be the worst for food on this occasion. Our server was beyond apologetic for the food and did everything he could to correct..... Lesson learned DON'T GO AFTER 5PM TO 7PM IF YOU WANT GOOD FOOD.

site_logo

pollard65 . 2025-01-23

MORE AT Google

We had a lovely meal last night at the Covent Garden branch and our waiter Bhabuk was attentive, efficient and friendly.

site_logo

Karen Vowles . 2025-01-23

MORE AT Google

I have been a Wagamama customer for a number of years and have always been happy with the food. The food at the Covent Garden branch is sub-standard quality - badly cooked, few vegetables and little meat or fish and, what is worst, the prawns were clearly not fresh. Every dish we had was too sweet, no balance in flavours. On the plus side, good service and helpful staff. Overall disappointing, will not be returning.

site_logo

Fran M8 . 2025-01-17

MORE AT Google

The poorest service I have ever seen. The restaurant was not too busy, although there were quite a few empty tables it took them about 10 mins or so to give us a seat. I Ordered tofu ramen but was given one without any noodles, I’m quite sure it is one of the key ingredient of it. I didn’t bother saying anything as I was really annoyed at the customer service and just wanted to get out of there. Overall very disappointing!

site_logo

Viren Rajput . 2025-01-16

MORE AT Google

Waitress brought the wrong order. Told my companion (who is very shy) they would like the wrong order more than the one they ordered so it wasn't worth changing it. They didn't like it actually. Had to go to the bar to pay as waitress gossiping too hard to attend to diners. A bit rubbish.

site_logo

Catherine . 2025-01-16

MORE AT Google

I went to the Covent Garden Wagamama's as I was shopping in the area. Service from the moment I walked in the door to the time I left was very friendly. It was a very cold day, but the temperature inside was nice and warm. Ordered a chicken katsu and it was perfect - not too dry and generous portions were served. My server, Bhabulc (aka BG), was wonderful: he looked after my orders and came to check in on me the perfect amount (not too often, and not too infrequent). Other staff were also very friendly and smiling. Overall, a great lunch break!

site_logo

Terence Smith . 2025-01-07

MORE AT Google

My son allergic to garlic so they made fresh noodle which was great. Great service tasty food coloring for kids fun.

site_logo

Tugsjargal Adiyadorj . 2025-01-07

MORE AT Google

Never been to Wagamamas before but popped it out of the blue after the restaurant we had booked was so awful we walked out…. So glad we did! Had a wonderful meal in convivial surroundings. Can thoroughly recommend this place and would not hesitate to visit other branches!

site_logo

K. Worthington . 2025-01-06

MORE AT Google

Bhanuk was brilliant such great service - thank you so much!

site_logo

Kate B . 2025-01-06

MORE AT Google

Take away was cold, despite waiting 15 minutes, arriving 5-10 minutes before pickup time. Great taste, but cold. Sad!

site_logo

tres stewart . 2025-01-04

MORE AT Google

We were very well attended by Oliver, the atmosphere is pleasant and the food is very good. Obs: n sabia que o lamen possuía tanta pimenta kkkk

site_logo

Eloir César Bólico Junior Bólico . 2025-01-02

MORE AT Google

Sunday night, 9pm was busy. Had to get up and ask a server for service. Who knows what they wrote down as it was not what we asked for. All the sharing plates were wrong, 2 of the mains were wrong and the drinks finally arrived just as 2 of us were finishing their mains while one of us still hadn’t had their mains brought to the table. Toilets were horrendous, water (?) all over the floor, no loo roll or hand towels. Never going back to Wagamamas.

site_logo

Matt Ford . 2024-12-30

MORE AT Google

Served by bhabulc, he was great! 🌟

site_logo

Madi Morphet . 2024-12-28

MORE AT Google

Food was far too oily, my Uncle had to return his! What a shame because I eat at Wagamama all the time. Too bad we had an over zealous chef:- my son's steak teriyaki soba was also swimming in oil. Thankfully the lady serving our area was understanding and nice.

site_logo

Natalya Silcott . 2024-12-22

MORE AT Google

We came across Wagamama while wandering around London. A very interesting menu, a large selection of dishes and, most importantly, very tasty and affordable

site_logo

Danuta Kowalska . 2024-12-21

MORE AT Google

Queued for a while as it was busy but once seated we were served quickly and the food also arrived quickly. All delicious.

site_logo

Chris Smith . 2024-12-20

MORE AT Google

Mixed bag when it came to staff. Ben was great but one of the other waitresses was super rude. Food was average and not as good as it used to be

site_logo

Nic . 2024-12-18

MORE AT Google

Perfect place for kids. The crayons and colouring paper is a win

site_logo

Philip Levine . 2024-12-17

MORE AT Google

Very nice but expensive. Repeated asked for cutlery before it was given to me though

site_logo

Zackariah Islam . 2024-12-12

MORE AT Google

I like the fact that it's not located on a main street. That means it's not awfully congested and packed during lunch hour. Food as always was 👍. I haven't been to Wagamama in a while and must say that the menu seemed to have significantly shrunk since I last dined here. Nonetheless, it's got a decent selection of Japanese fusion food and the wait staff is super attentive here. Definitely recommend it!

site_logo

Charles Chow . 2024-12-10

MORE AT Google

I had a wonderful dining experience at Wagamama thanks to servers Candy and Raluca. Their friendly, attentive service and thoughtful suggestions made me feel welcomed and valued, even while dining alone. They truly went the extra mile to ensure my meal was perfect. Kudos to the team for such an excellent experience!

site_logo

Paula Martins . 2024-12-10

MORE AT Google

Last night was a culinary caper! Raluca, the waitress extraordinaire, swooped in with the best dish recommendations while I was over there asking the menu if it spoke English. My belly is still celebrating like it just won the lottery!

site_logo

Alex Samkovs . 2024-12-10

MORE AT Google

⚠️ TERRIBLE SERVICE FOR DIETARY RESTRICTIONS Incredibly frustrating experience at Wagamama. My wife has a red meat allergy, and the staff were completely unhelpful. The manager: Refused to tell the chef my wife had allergies!!!!! Wouldn't provide an ingredients list!!!! Blocked her from ordering ANYTHING - even vegan options!!!! Gave zero apology!! How can a major restaurant chain in 2024 be so completely unable to accommodate a customer with a dietary restriction? The staff's attitude was incredibly dismissive and unwelcoming. Absolutely zero attempt to help or provide any alternative options. I'm stunned that a chain like Wagamama can operate with such a complete disregard for customer service. Absolutely will not recommend. Disappointing dining experience.

site_logo

David . 2024-12-09

MORE AT Google

The place is noisy, but it makes up for it with great food and excellent service.

site_logo

Nuno Amaral Frazão . 2024-12-06

MORE AT Google

No service provided. Wagamama better start using a cutlery expositor for self service cause it’s hard to wait half an hour for a fork after being served the food

site_logo

SoraiaTofu . 2024-11-30

MORE AT Google

Great food and helpful staff. Although we had a problem with some of our food, once aware the manager solved this immediately. Good customer service and a nice meal.

site_logo

Clover Elizabeth . 2024-11-29

MORE AT Google

There's always a queue, but does anyone really think it tastes good? 🤔🤔🤔anyway this is the least authentic Asian restaurant I have experienced.

site_logo

Ann Chang . 2024-11-25

MORE AT Google

We went in marts and we had a good time. We were there at dinner time so there was a rush and a bit of waiting but we weren’t in a hurry. The staff were nice and the food was good! we’re coming back again

site_logo

mette m . 2024-11-23

MORE AT Google

I normally love a wagamamas but the service here was non existent. Took multiple and increasingly pointed requests to get anything done, including seating at a table, getting an order and getting a bill. A glass of tap water came after all food had been brought out and all but one dish had been eaten, and after I pointed out that it was the 6th time of asking. Easier to cook your own food.

site_logo

Cameron Bashir . 2024-11-22

MORE AT Google

Wagamama Covent Garden: A Japanese-Inspired Culinary Haven Introduction Located at 17 Bedford Street in the heart of Covent Garden, Wagamama offers a dynamic and vibrant dining experience inspired by Japanese cuisine. Known for its fresh, flavorful dishes and communal dining setup, it’s a popular spot for both locals and tourists seeking a casual yet satisfying meal. Ambiance and Atmosphere Wagamama Covent Garden exudes a modern, minimalist vibe, with its signature communal seating that encourages a lively, social atmosphere. The open kitchen allows diners to witness the preparation of their meals, adding an interactive touch to the experience. While the setting is energetic and welcoming, it can get quite noisy during peak hours, so it’s best suited for those who enjoy a bustling environment. Menu and Cuisine The menu at Wagamama is a celebration of Japanese-inspired flavors, offering something for everyone. From their iconic Chicken Katsu Curry to warming bowls of Ramen, and sizzling Teppanyaki, the variety ensures there’s always something new to try. For those with dietary restrictions, Wagamama shines with an extensive range of vegan, vegetarian, and gluten-free options, such as the Vegan Yasai Katsu Curry or the Bang Bang Cauliflower. Seasonal specials and customizable dishes further add to the appeal, making it a versatile choice for diverse palates. Service and Experience The service at Wagamama Covent Garden is efficient and friendly, with staff known for their attentiveness and warm demeanor. One unique aspect of Wagamama’s service style is that dishes are brought to the table as soon as they’re prepared, ensuring maximum freshness. However, this means that meals for groups may arrive at different times, which could be a consideration for diners expecting synchronized service. The restaurant’s fast-paced nature makes it an excellent choice for a quick bite or a casual meal, but it may not be ideal for those seeking a quiet, leisurely dining experience. Location and Accessibility Conveniently located in Covent Garden, Wagamama is easily accessible by public transport, with the Covent Garden and Leicester Square Underground stations nearby. Its central location makes it a prime spot for shoppers, theatre-goers, or anyone exploring the vibrant Covent Garden area. Pricing Wagamama offers great value for its quality and portion sizes, with most dishes reasonably priced for central London. The affordability, combined with the diverse menu, makes it a solid choice for both solo diners and groups. Conclusion Wagamama Covent Garden delivers a lively and satisfying dining experience that blends fresh ingredients, bold flavors, and efficient service. Whether you’re stopping in for a quick meal or fueling up after a day exploring Covent Garden, this Wagamama location is a reliable choice for delicious Japanese-inspired cuisine in a fun, casual setting. Recommendation: Ideal for anyone seeking a vibrant atmosphere and a variety of tasty dishes in the heart of London.

site_logo

Tomasz H . 2024-11-19

MORE AT Google

Excellent meal and great service. I can recommend the chicken Katsu curry ! Only problem with this resteraunt ( Wagamama) is all the meals are not guaranteed to come out together. One of my party got their meal when everyone else was almost finished ! Nice though

site_logo

gary draper . 2024-11-18

MORE AT Google

We finished eating and then wished to have some drinks, the table was crowded with plates and glasses, she saw that we had put the dishes in a orderly way to the side to be taken away and she just kept cleaning tables that were already clean.

site_logo

Bns G25 . 2024-11-15

MORE AT Google

Absolutely fantastic experience at Wagamama! Joanna, our server, made our visit exceptional with her friendly and attentive service. She was incredibly knowledgeable about the menu and offered great recommendations that we thoroughly enjoyed. The food was fresh, flavorful, and arrived promptly, thanks to Joanna's care. She checked in on us at the perfect times and genuinely seemed invested in making sure we had a wonderful meal. Her warmth and professionalism elevated the entire experience. I highly recommend Wagamama, especially if you’re lucky enough to have Joanna as your server. Thank you, Joanna, for making our visit memorable.

site_logo

Moheet Pradhan . 2024-11-13

MORE AT Google

We tried Wagamama in Covent Garden, and the food was really good – totally worth it! The cherry blossom lemonade was a standout; seriously, one of the best soft drinks I’ve had in a restaurant. Highly recommend trying it. The only downside was the long queue; we ended up waiting over 30 minutes for a table. Service was good but could’ve been a bit more attentive, especially with the wait. On the plus side, the toilets were clean, which is always nice in a busy place. If you don’t mind the wait, it’s a great spot for a tasty meal and that awesome lemonade!

site_logo

E Kara . 2024-11-10

MORE AT Google

Food below average, tasteless. Service non existant, a guy dropped a DHL package in the middle of our table, we had to ask to order and get their attention. Glasses with our drinks were dirty. Unfortunately

site_logo

Guillaume de Spoelberch . 2024-11-10

MORE AT Google

Full of vibes, and spicy, filling entrees. Service is friendly, but was a bit hit or miss during our meal - we had some issues getting our drinks during our entire dinner

site_logo

Don Bernal . 2024-11-07

MORE AT Google

We had a bao which was okish to be fair but the Firecracker prawn rice was yummy. The atmosphere is cozy and the location is very easily accessible.

site_logo

satyaprakash samal . 2024-11-06

MORE AT Google

Perfect get together loved the food we will back very soon

site_logo

krishan kumar . 2024-11-04

MORE AT Google

What a great restaurant. Extremley kind and understanding workers.

site_logo

elif sag . 2024-11-03

MORE AT Google

Worst Wagamama. Refused to put a candle on our daughter's desert for her birthday. Every other Wagamama we have been to gladly did this on birthdays for us. Won't be coming back to this branch.

site_logo

Liam Hynes . 2024-10-30

MORE AT Google

If you can get into this meal metropolis early, there is plenty to savour and salivate over. We did a walk in at 5pm to beat the hordes and enjoyed delicious asian-fusion fare. Everything was well proportioned, nicely presented and very delectable. Love me some roti and it did not disappoint.

site_logo

Kylie Connell . 2024-10-30

MORE AT Google

Really good Katsu and a Yuzu Asashi Beer, the standout was the staff, really friendly and very on the ball, thanks guys

site_logo

Sarah Ayres . 2024-10-30

MORE AT Google

loved it! great food and attentive service. I could have that Ramen everyday

site_logo

Felizitas Mueller . 2024-10-28

MORE AT Google

Great location and a beautiful venue. The food and service were outstanding.

site_logo

Adeel Ahmed . 2024-10-27

MORE AT Google

Lovely place, great people's Food delicious 😋 I recommend 👌

site_logo

Aneta Korzekwa . 2024-10-26

MORE AT Google

Normally we love Wagamamas but the food here was off and very average.

site_logo

Shiba Shibs . 2024-10-26

MORE AT Google

A couple of staple dishes missing/run out, but food that we did have was very nice. Service pretty good.

site_logo

Carrie White . 2024-10-26

MORE AT Google

Taste of the food was mediocre. I had chicken and it was very tasteless. I added a lot of soy sauce. The food was served on a flat cold plate, so it quickly became lukewarm. Service was friendly, but the atmosphere of the place screamed "fast food". However, we had to wait a long time; they forgot our order and everyone seated after us had their food before us.

site_logo

Gemma van Dorst . 2024-10-20

MORE AT Google

Had a great time in Wagamama covent garden, we obviously had lots of choice in the area, but Wagamama never disapoints and this one certainly didn't. The decor is a little different to the many Wagas we have been to, almost taken to another level as this is a much larger restaraunt woth hogher ceilings. The food came surprisingly quick, despite how busy they were. All cooked to perfection. We ended up with 6 starters and 4 mains for the 4 of us. The staff were friendly and great with our children, making them laugh and offering colouring and crayons. Toilets were clean, and smelled fresh. I would go again and highly recommend.

site_logo

Kyle Keenan . 2024-10-20

MORE AT Google

My fav place of that kind in London.

site_logo

Barry . 2024-10-18

MORE AT Google

Chole was a revelation. A shining light on a wintery night. Truly 5 star service. We will be back with friends. Thank you

site_logo

Marlon James . 2024-10-18

MORE AT Google

Great food, we were 20 people and they handled it very well. Krystian our waiter was awesome, he clearly won our chili contest! Thank you very much for this amazing evening!

site_logo

myrtille danjou . 2024-10-17

MORE AT Google

Loved the food. Veg is surprisingly good too.

site_logo

Samir Kane . 2024-10-16

MORE AT Google

Waited twenty five minutes without my order being taken !!!😕 Decided to leave Didn’t receive any apologies Quick efficient service at Wagamama Holborn 😂

site_logo

Peter Vranch . 2024-10-12

MORE AT Google

Similary restaurants in London

restaurant_img
3.4

3209 Opinions

location-icon156 Marylebone Road
Japanese
outdoor_seating_111343takeaway_111343delivery_111343

Very disappointed to see what is on the card and what we receive..

restaurant_img
3.5

408 Opinions

location-iconTerminus Place
Japanese
outdoor_seating_78979takeaway_78979delivery_78979

Came to pick up a too good to go bag; the lady who served me was extremely friendly and so bubbly! Really made my morning! Food was hot and tasted great!

restaurant_img
3.5

385 Opinions

location-icon67-69 Weymouth Street Marylebone, London W1G 8NY England
Japanese
outdoor_seating_246687takeaway_246687delivery_246687

I don't understand the negative comments. Those might not be the best sushis in London, however at this price point it's definitely way better than most of the sushi takeaway chains in London. Regarding the staff, they have always been helpful and friendly, I really recommend this branch!

restaurant_img
3.5

3 Opinions

location-icon65a Great Titchfield Street
Japanese
outdoor_seating_110198takeaway_110198delivery_110198

Пришли сюда, соскучившись по японской кухне. Роллы оказались очень вкусными и большими, наелись, съев по порции. Интерьер приятный, персонал дружелюбный. В целом, место неплохое.

restaurant_img
3.5

243 Opinions

location-icon15 Woodstock Street
Japanese
outdoor_seating_88226takeaway_88226delivery_88226

Estábamos buscando un bocadillo por la tarde y probamos Yo! El servicio era muy atento (Sanu era muy servicial) y el chef estaba muy contento de hacernos comida caliente fresca.