GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
3.9

Based on 777 opinions finded in 3 websites

site_photo4

Nº 168 in 266 in Kettering

Nº 4 of 7 American in Kettering

CUSTOMERS TALK ABOUT DISHES WITH..oldribcoffeeonionfilletpaygarlicsteaksteaksmeatchickenolivessaladribscookedbutterround

comment_iconOpinions

Decent grub, all your beef needs. Clean, tidy and comfortable 👌

site_logo

Chris Mc . 2024-11-16

MORE AT Google

Amazing food my favorite restaurant The all you can eat ribs are amazing but they used to let you take home what you don't eat now there is alot of rules

site_logo

RYANJJLIFTS FITNESS_CABIN . 2024-11-03

MORE AT Google

Always good Never Disappointed Rump, fat chips. Mushrooms and salad

site_logo

Hayley Cole . 2024-10-16

MORE AT Google

Have come here twice now for special occasions, it's 10/10. The staff are very friendly, one waiter even offered and took a picture of our table as we wanted a group photo which was very nice of them. The food is also amazingly presented and cooked to perfection

site_logo

Luke . 2024-10-04

MORE AT Google

The food was absolutely delectable, and the portions were very generous. The staff there is professional and quite helpful. I would recommend making a reservation in advance, especially over the weekend.

site_logo

Ileana TS . 2024-10-01

MORE AT Google

Food is good quality and tasty, although a bit expensive. Only go here as a treat.

site_logo

john foley . 2024-09-17

MORE AT Google

The steak was fantastic. The ribs were meaty, and the chicken was great.

site_logo

Robert Hillyard . 2024-09-10

MORE AT Google

Another excellent meal with family and friends for the unlimited ribs night. Great service and quality of food was to die for. Won't leave it so long next time.

site_logo

Sean Connolly . 2024-08-20

MORE AT Google

Very good food. Acceptable service and pleasant staff.

site_logo

PaulY M . 2024-08-17

MORE AT Google

Lovely experience, great service, chilled ambience, and amazing food. We totally enjoyed the Tuesday ribs deal.

site_logo

Jovita Vieira . 2024-08-14

MORE AT Google

Moved away years ago but will always be the best steak house absolutely perfect steaks just as ordered great friendly service

site_logo

Belinda Speakman . 2024-08-13

MORE AT Google

Great food, service all over the place with wrong food

site_logo

Peter Letts . 2024-08-05

MORE AT Google

Been wanting to try this place for over a year and had a family member visit so we gave it a try! Service was great the food was out of this world! Can’t wait to return!

site_logo

Jay Cowan . 2024-07-07

MORE AT Google

Wow we had spare rib and nacho starters the ribs fell off the bone, then we had steaks I had jacket potato was so nice to have instead of chips a proper jacket potato just delicious sauces lovely massive amount of food. faultless

site_logo

k webb . 2024-06-30

MORE AT Google

Stunning steak and ribs! Best I've had since moving here from NZ.

site_logo

Murphy Hill . 2024-06-28

MORE AT Google

Book ahead, lovely food, well priced, good potions, friendly staff.

site_logo

Stephen Raven . 2024-06-12

MORE AT Google

Went here with a party of 5 we didn't book a table and they managed to fit us in food was amazing I had the steak and ribs highly recommended

site_logo

Mattc _82 . 2024-06-12

MORE AT Google

Great restaurant, lovely food. Highly recommend the unlimited ribs on a Tuesday evening, absolutely delicious! Parking at the restaurant is on the road outside or there is a large car park by the church about 3-5 minutes walk away.

site_logo

Jed W . 2024-05-18

MORE AT Google

Not very good atmosphere staff didn't make you feel welcome Drinks very expensive

site_logo

Madeline Roberts . 2024-05-15

MORE AT Google

Tuesday is busy.... Pre-book as it's all you can eat Ribs night.... Good food all round.... Couldn't manage dessert!... Bill for two inc drinks £57..... Well worth a visit...

site_logo

Andy Sillence . 2024-05-11

MORE AT Google

Although the food was presented well abd they would do anything to please the customer. The T-bone steak my husband ordered was chewy. They cooked it to medium rare and returned it, but it was still a little chewy in places. I had surf and turf, and the steak was OK, but the prawns were grilled too much that they had shrunk to not worth eating. The sweet potato fries were really nice. For what we paid, we should have gone to Miller and Carter!

site_logo

Tracy Slade . 2024-05-07

MORE AT Google

We went there as a family with two kids. The kids portions were big and looked nice… step son enjoyed the steak. Not very much choice on the kids menu, 3 things and for my daughter she just ate chips as she didn’t like the burger. I know it’s a steak house, but if you’re going with someone who can’t eat beef, you’re not going to be overwhelmed with choices and if you’re a vegetarian then you’re stuffed. I can’t eat beef but my partner loves it, so we went. But I had to have two starters and chips as there was nothing else I could eat. Overpriced calamari (in rubbery rings, which I hate for that price) and three king prawns with hardly any meat on them, drenched in a sauce so I couldn’t see if I was eating the head or legs. Service was odd as well. Ordered a lager and the waiter poured it straight into the glass and was then surprised when it overflowed onto the table… I needed a flake in it the head was half the glass. I think definitely trying to be something it’s not so not a great experience for me I’m afraid.

site_logo

Bondess007GAL . 2024-05-06

MORE AT TripAdvisor

Pretty confusing steak restaurant. Food is pretty decent, but almost everything else is uninspiring. Drinks are limited and very expensive, service is pretty poor like nobody has ever had any training on even the basics of food service which is the biggest let down here. Otherwise it feels like a chintzy Indian restaurant with no atmosphere. Not worth a second visit for me which is a shame, I really wanted to love it.

site_logo

Philip Walker . 2024-05-05

MORE AT Google

The stake was bad , ordered £28 stake medium Cook it came rare ive asked the to take it back and cook it a bit more they bring it well done and dry so our experience with food was terrible

site_logo

Mahmoud Alshekeri . 2024-05-04

MORE AT Google

We were a group of twelve celebrating a birthday and seated at all large round table which was perfectly sized for us. We all ordered drinks which were delivered quite promptly, the only reason I dropped a star overall was due to the draught beer choice which was limited and I would say below par for the quality of food being served up. I'd like one of the choices to be a more premium lager. A couple of the guys ordered starters and these looked and smelled great! Upon recieving the mains all the plates looked great, I ordered the mixed grill and enjoyed every bit of it. Top quality meat and all cooked really well. We didn't stay for dessert, one of our group was gluten intolerant and there were no options on the desert menu to satisfy him so we ended our meal there. Over all very enjoyable and would definitely book in again!

site_logo

Lawrence Marshall . 2024-04-16

MORE AT Google

Great food, good portions, staff were very friendly. If I'm ever in the area again I will be back!

site_logo

Ryan Parle . 2024-03-13

MORE AT Google

Good portions, well cooked. Good value and service.

site_logo

Rab Anderson . 2024-03-09

MORE AT Google

Attentive staff .. exceptional food.. truly exceeded our expectations.

site_logo

Yvonne Edwards . 2024-03-02

MORE AT Google

Amazing place we enjoyed everything ♥️

site_logo

Andreea Iulia . 2024-03-01

MORE AT Google

We have visited Toro many times over the years and can honestly say we’ve never had a bad meal. It is a steakhouse, so not the cheapest but I can honestly say that when we visited last night, my fillet steak was the best steak I’ve EVER had. (And we do like eating out - LOL) Hidden gem in my opinion - if you’re in the area and fancy steak, give it a go! Thank you to all the staff!

site_logo

Lauzgoodi . 2024-02-24

MORE AT TripAdvisor

Food was amazing and for a steak restaurant I thought the food was a fair price. The service was really good, I only knocked off a star because we had to ask for another round of drinks (it's something that bugs me a bit but seems to be happening everywhere lately). If you're in the area and want a really nice dinner, the pop to Toro, I doubt you'll be disappointed (well unless you're a vegan).

site_logo

Higham and Rushden Judo Club . 2024-02-22

MORE AT Google

Staff welcoming food was excellent service excellent

site_logo

stacey kirkwood . 2024-02-17

MORE AT Google

We booked this restaurant for my Dads 60th. Unfortunately got seated upstairs which doesn’t have the same atmosphere as downstairs. Starters were fine although the server seemed to be very uninterested. The main course for most was okay nothing to shout about my sister had ordered a Medium steak it came out well done it then got sent back and came back again well done by this point we complained and it got taken off the bill. If you can’t cook a steak in a steakhouse then what’s the point. The vegetarian fajitas could have done with some halloumi/protein.

site_logo

blueeyes582 . 2024-02-05

MORE AT TripAdvisor

Booked in for the Tuesday ribs and wasn't disappointed. Had this booked for quite a while after visiting before and hearing about the unlimited ribs on a tuesday. I ended up being the only one who went for the ribs in our party of 4 but wasn't disappointed at all. The ribs are top quality with loads of meat on the bone. There are two options of ribs I went for a mixed plate to start with. The other people went for a mixed grill that was amazing, and two other excellent steaks.

site_logo

Chris Nichols . 2024-02-05

MORE AT Google

Good food, nice atmosphere. Some improvement required on the service side of things. Overall good place to eat

site_logo

Billy Gande . 2024-02-01

MORE AT Google

Mahmud and all the other staff were very kind and helpful and the food was amazing I would highly recommend and I will be going back for the ribs next time

site_logo

Jamie Rose . 2024-01-17

MORE AT Google

First class service waiters were polite well mannered nothing to much trouble for them highly recommended this place

site_logo

Trisha Stimson . 2024-01-06

MORE AT Google

We were suppose to be a party of 4 but 2 didn't turn up there loss we were moved to a table for 2 which i totally understand as they were very busy i ordered a fillet steak medium and my friend ordered a pasta dish both meals were excellent we hade a gin and tonic and pepsi also had coffee afterwards food was great service was great my 3rd time going and each time was great

site_logo

Joan Bromage . 2023-12-26

MORE AT Google

Fantastic food, the best steak I've had in years! Worth every penny

site_logo

Adam Perry . 2023-11-18

MORE AT Google

Absolutely amazing food cooked perfectly

site_logo

Rob deG . 2023-11-15

MORE AT Google

Had a lovely meal and staff were amazing...unfortunately the group at the next table were rude and obnoxious refusing to pay after eating everything and abusing the staff.....felt really sorry for staff and they handled everything extremely well

site_logo

Bernadette Kane . 2023-11-14

MORE AT Google

Great menu and fantastic tasting food, first time I have been and won't be the last.

site_logo

Neil Bonnell . 2023-11-10

MORE AT Google

Very tasty food indeed, the steak and ribs are delicious..

site_logo

Peter Bailey . 2023-11-07

MORE AT Google

Really excellent food and service. Thanks for making our visit such a special night out!

site_logo

Gale McQuillan . 2023-10-21

MORE AT Google

It was infinite ribs Tuesday. Probably some of the best ribs I have eaten in a very long time! Succulent, melt in the mouth, fall off the bone....perfect! Service and atmosphere were absolutely spot on. Whilst I indulged in ribs and chips. Other food on different tables looked equally as good. I would definitely recommend 100%! I will be returning to sample the steak menu too. Lost one star on service as I ordered a Pepsi, which on its own cost nearly £5!!! I find that quite unreasonable.

site_logo

Robert Dunlop . 2023-09-13

MORE AT Google

Good but expensive. waited over a hour for our meal.

site_logo

Sean Finnegan . 2023-09-01

MORE AT Google

A vast selection of meat dishes in this grill, Something for everyone here, Only please note this is a bookable restaurant Rather than just turn up and be seated like we did. Polite staff £20 all eat rack of ribs Was nice 👌

site_logo

Chris SeaDog Dixon . 2023-08-31

MORE AT Google

Was very busy, had to wait a long time to get served. Unlimited Ribs on a Tuesday so I'm thinking that's why it was so busy when we visited. Got the Chilli burger, not very good, very dry. The steaks and ribs that others in our party ordered all looked good. I will give it another try and order something else....

site_logo

Alan Longley . 2023-08-01

MORE AT Google

Excellent service and great food, highly recommend 👍

site_logo

steve kenny . 2023-07-30

MORE AT Google

Always enjoy getting our meat on at Torros Food is always good and staff aver always helpful

site_logo

Ashley Nicholas . 2023-07-30

MORE AT Google

Had a very nice evening . Food excellent will definitely go back .

site_logo

Karen Correau . 2023-07-29

MORE AT Google

A recent refurb has made the place brighter, but the food continues to be top class. Not the cheapest, but value-wise very good.

site_logo

Zane Cole . 2023-07-24

MORE AT Google

5 of us Came for meal Saturday night lively and very busy, but did not wait long to be served a drink and orders taken. The boys raved over their steak saying was the best they ever had. Ribs were good as well but could have done with more sauce, will order next time. Yes we will be back. Thank you

site_logo

Denise Wagstaff . 2023-07-16

MORE AT Google

Excellent food and service best ribs I've ever had just fell off the bone perfect. Only problem too much food.

site_logo

Geoff Savage . 2023-07-09

MORE AT Google

Returned to Toro tonight, for the first time in ages. What a fantastic meal, had the mixed grill, all the meat was cooked really well, and the sides were good. Staff were super helpful, and made it a pleasant experience. The restaurant was busy but not full, however I'd strongly recommend advance booking for a Friday or Saturday. Also the ribs are excellent, plenty of meat and falling off the bone.

site_logo

Giles Batchelor . 2023-06-23

MORE AT Google

Very helpful with my husband who is in a wheelchair. Food was lovely and service really good. Will definitely go again.

site_logo

Jude Cornwell . 2023-06-21

MORE AT Google

Unreal food and unreal staff, best food I’ve had in a very long time!

site_logo

Kai Brown . 2023-06-20

MORE AT Google

Treat for fathers day, food good, service ok & considering it was fathers day it was quite empty.

site_logo

Tony Cornwell . 2023-06-20

MORE AT Google

My like good place! Recommend max

site_logo

Gatis Steinbergs . 2023-06-18

MORE AT Google

Spot on Loved it ....Great food

site_logo

k “oneoff666” oakes . 2023-06-13

MORE AT Google

All you can eat ribs Tuesday!!!! Fantastic 😀

site_logo

BRP Electrical . 2023-06-12

MORE AT Google

We went on a Tuesday evening and it's all you can eat ribs. My partner was whacked, the ribs are so meaty and tasty. I had a Brazilian burger, the best burger I've had. Will deffo be going back.

site_logo

sarah Cooper . 2023-06-11

MORE AT Google

Perfect great steak friendly staff

site_logo

Evelyn Croot . 2023-06-10

MORE AT Google

Fantastic steak house. Love it every time we go. The steak is one of the best steaks I have ever had.

site_logo

Róisín . 2023-06-06

MORE AT Google

Lovely food. Can't beat the bottomless ribs!!

site_logo

TJ Pearce . 2023-06-02

MORE AT Google

Fantastic food service and price very large portions can't wait to return

site_logo

Susie Rogers . 2023-06-01

MORE AT Google

Make sure you are hungry when you go there. Otherwise, you won't finish your plate lol. One of the best meat you can have around Kettering/Corby

site_logo

Alexandru Dragoi . 2023-05-28

MORE AT Google

Special family meal. Not rushed food perfect even younger family.members enjoyed . Only drawback I couldn't have a desert as my meal was so lovely I ate every scrap and couldn't manage anything else .

site_logo

Frances Dickens . 2023-05-28

MORE AT Google

Very nice steak, cooked perfectly, by this I mean if you ask for rare it will be rare. Check proper steak cooking guidelines before ordering. If you're used to medium not having any pink, then ask the staff etc. Great decor, good price, steak was tasty, large portion of fries, and friendly staff. Better than a well known expensive chain, we will be visiting again.

site_logo

Sean . 2023-05-11

MORE AT Google

Outstanding, staff were very polite and helpful, was a perfect experience , prices were good and food was amazing. I genuinely can not find any fault . Will be back many times more

site_logo

Paul . 2023-04-26

MORE AT Google

Great place with amazing steaks and really good service which is so rare these days. Can't wait to go back

site_logo

Natalie Turner . 2023-04-09

MORE AT Google

This is a good local restaurant. Lovely tasty food. I haven't been for a while but will go again this year. Think more marinade on the steaks would make the steaks more flavoursome. Also sauce options like bone marrow sauce / lemon butter and garlic sauce would enhance this (I've been to a few steak restaurants in South Africa) and this is what they do. Makes a big difference to flavour.

site_logo

Michael A . 2023-04-05

MORE AT Google

This is our go to steakhouse despite living half an hour away. We’ve been here many times and never been disappointed. Always on top form and the decor looks cool and trendy too!

site_logo

Nicholas bichener . 2023-04-04

MORE AT Google

Had one of the best steaks i've had in my life here, Great waiter, Amazing quality meat, Modern decoration, And reasonably priced food. Totally recommended.

site_logo

Ellie . 2023-03-27

MORE AT Google

Ordered for halal steak pre order meat for us. It was lovely. Everything was perfect.

site_logo

Dr Salmaan Arif . 2023-03-18

MORE AT Google

Fabulous food Fabulous service , great night

site_logo

Tracey Kilbane . 2023-03-18

MORE AT Google

This is tge Perfect place for the Perfect Steaks. Having top class staff just adds ti this perfection. I can't wait to visit there again.

site_logo

Paul Collyer . 2023-03-09

MORE AT Google

Valentines meal food was delicious. Will definitely go back again. Only draw back was finding somewhere to park

site_logo

Billy Ling . 2023-02-22

MORE AT Google

Had to wait for about 10 minutes to get our chips after the steak was put in front of us. I have had better rump at this place before. The piece was the shape of a large burger, with no fat on the edge whatsoever, hence the rather bland taste. The others that had ribs enjoyed them. Good prices and nice atmosphere.

site_logo

Stephen Spivey . 2023-02-20

MORE AT Google

Absolutely fantastic Quick service and food was spot on

site_logo

Sarah Ling . 2023-02-15

MORE AT Google

Great service, lovely staff and just amazing food , great venue all round

site_logo

Steve Knight . 2023-02-13

MORE AT Google

Food is absolutely delicious, staff could not be more helpful. A great experience, will definitely be back again.

site_logo

Tracy Shannon . 2023-02-10

MORE AT Google

Went with my partner. We are small eaters so when we saw the advertised portion of ribs we went for 1 portion to share and a starter to share, a glass of wine and a pint of coke. We were them told we can’t share because that’s what 1 person would usually have- we just paid for our drinks and left and got better customer service elsewhere

site_logo

Valencia Lavia . 2023-02-09

MORE AT Google

Great value for your money and great food 👌🏾

site_logo

Lloyd Alexander . 2023-02-08

MORE AT Google

Food was amazing the only reason I didn't give a 5☆ was the puddings was rubbish

site_logo

sammy broom . 2023-02-06

MORE AT Google

1st time visitor for a birthday meal and the food did not disappoint. Hot and beautifully cooked steak (unlike Miller & Carter) and good value too. Will definitely be back.

site_logo

Matt Usher . 2023-02-03

MORE AT Google

Arranged a birthday party for 24 people. We were offered the upstairs. It was perfect. The food was delicious and cooked to perfection. Everything went so smoothly. Will definitely be returning.

site_logo

Jill Jacobi . 2023-01-31

MORE AT Google

The hosts are very friendly and attentive. The food is really good taste & value for money. The calamari and onion rings specifically were great.

site_logo

esther m . 2023-01-30

MORE AT Google

Guter Service, gutes Essen und ein guter Preis. Vielen Dank und gerne wieder!

site_logo

Silvan Maderer . 2023-01-20

MORE AT Google

Great food and atmosphere. The ribs are very meaty and the bbq sauce was amazing.

site_logo

Trevor Hackett . 2023-01-10

MORE AT Google

Byłem 3 razy i mogę polecić. Za każdym razem byłem zadowolony. Żeberka, stek i łosoś bardzo smaczne, świeże i ładnie podane na talerzu Na wyróżnienie zasługują żeberka. W każdy wtorek all you can eat. Kiedy będę wybierał się do restauracji to znowu wybiorę Toro w Rothwell

site_logo

Matiz B . 2022-12-18

MORE AT Google

Ribs are amazing but I went for the t-bone. It did not disappoint. Quite busy as expected, so definitely book.

site_logo

Jordan James . 2022-12-07

MORE AT Google

Spotlessly clean. Massive portions of unlimited ribs with salad and excellent chips cant wait to go again

site_logo

Anne Forbes . 2022-12-07

MORE AT Google

Always a great place to eat. Food is amazing and the staff are very friendly. The food is affordable!

site_logo

Kellie Hughes . 2022-12-03

MORE AT Google

Best T-bone in Northamptonshire

site_logo

James Hyde . 2022-11-29

MORE AT Google

Excellent food great value and portions

site_logo

dave barton . 2022-11-16

MORE AT Google

The last time I visited was 8 years ago (wow didn't realise time passed so quick). I pushed the boat out and went for the mixed grill for me and the New York for the missus. Both dishes were delicious and well cooked, for afters we went for the profiteroles which were amongst the best I've ever had (and I've had a few in my time). Tables were clean and the waitress friendly. Only regret was ordering a pot of peppercorn sauce for the stakes which was not good at all and cost a fiver. I also had a side, and a double liqueur to finish. The bill came to nearly £80. I know what you are thinking, however we both came out stuffed and the food was decent quality, personally I save up and eat well once in a while. Car park is free on Sat nights in town centre 2 min walk from the restaurant.

site_logo

ColMoschin96 . 2022-11-12

MORE AT TripAdvisor

Lovely food. Fabulous eating experience. Great for fans of Meat

site_logo

Karl Garrett . 2022-10-06

MORE AT Google

My ribs were so well done they were mush, the fillet steak was poorly seasoned and tasteless, we normally go to millers and carter for steak, but wanted to try toro….won’t be going back. 2 stars cos the beer was decent.

site_logo

Chris Ruddock . 2022-09-06

MORE AT Google

Delicious food. I can only recommend them. Also very nice and polite service 👌

site_logo

PJK . 2022-07-18

MORE AT Google

Similary restaurants in East Midlands

restaurant_img
4.3

4347 Opinions

location-iconWeekley Wood Avenue
American
outdoor_seating_233075takeaway_233075delivery_233075

Brilliant evening with food to die for! Ray our host was excellent. Fast, efficient, polite, funny, and nothing was a problem. If you go for food ask for Ray to serve you

restaurant_img
2.8

4133 Opinions

location-iconKettering Business Park Pegasus Court
American
outdoor_seating_93421takeaway_93421delivery_93421

The order took a significant amount of time to arrive, and when it did it was all stone cold and inedible

restaurant_img
2.5

6 Opinions

location-icon71 Gold Street
American
outdoor_seating_333945takeaway_333945delivery_333945