GastroRanking-logo
whatsappWhatsapp
phoneCall
desktopWebsite
menuMenu
bookingBooking
3.4

Based on 1.010 opinions finded in 2 websites

site_photo4

Nº 538 in 636 in Dumfries & Galloway

Nº 118 of 134 Other cuisines in Dumfries & Galloway

CUSTOMERS TALK ABOUT DISHES WITH..cheesepotatoricesoupcoffeefishchickenhampaninisandwichleekladyrollcookedpiebacontomato

comment_iconOpinions

Good pitstop on the way to Scotland

site_logo

Jacqueline Douglas . 2025-02-14

MORE AT Google

£6.50 for a soup was quite expensive

site_logo

Roger Boyle . 2025-01-21

MORE AT Google

We called on what was quite a miserable January day yesterday and had a lovely meal . Our Baked Potato and Beans with a beautiful fresh Salad and Coleslaw was the best we have ever tasted. Accompanied by lovely hot pot of tea we couldn't have asked for more. Well done ladies we had excellent service and will definitely be back xx

site_logo

Sue Percival . 2025-01-14

MORE AT Google

Amazing food and the staff are always so lovely. Highly recommend their jacket potatoes!

site_logo

Craig Mann . 2024-12-26

MORE AT Google

Great food! Lovely wee breakfast

site_logo

Sophie Nicoll . 2024-11-30

MORE AT Google

29th november, Friday 2024. Me and my friend went there for few times now. One of the staff, she’s wearing square black glasses with red stripe, mini fan on her neck, grey shirt and jeans, short square cut -dirty blonde hair . I don’t know how this place got her hired, but she’s very rude. When I say rude, i mean RUDE AND VICIOUS. For your information, both me and my friend are Asian. She took out order in a very mean way,and thrown our receipt to us , nearly blown away 😅, whilst to other people, she handed to them properly. I literally don’t know what is wrong with her, but i will keep put review here about her everytime we going there. So she better change her attitude! If you hate Asian, do it outside your jobplace. We will come every week to see how she treating us again.

site_logo

Fanessha Herriott . 2024-11-29

MORE AT Google

Been here several times but won't be back. Toasties and chips cost £8.00 was overdone and counted 14 chips. Coffee served in tiny cup and lukewarm. Very disappointed not good value at all

site_logo

Caroline Gribbin . 2024-11-25

MORE AT Google

We visited yesterday and bought 3 meals which were all cold the pie was hot but the chips and veg were cold. I am sorry I didn’t take them all back. I won’t be going there ever again

site_logo

Wendy Micallef . 2024-11-21

MORE AT Google

All the staff were great and very helpful

site_logo

Jim Carter . 2024-11-18

MORE AT Google

If I could give zero stars I would. Cold food, bacon, lorne sausage over cooked and dry and as for the tattie scone I couldn't get the fork in to it not cut it with a knife. Avoid at all costs

site_logo

Rick Errett . 2024-11-07

MORE AT Google

Great to visit. Not been for a few year. Still the best in the area. Great selection of goodie. Friendly staff. Nice and clean. Good prices.

site_logo

Kevin Smith . 2024-11-06

MORE AT Google

Bit like a hospital canteen, couldn't sell chips and chilli together even though they could be sold separately 🤣

site_logo

G Mac . 2024-10-27

MORE AT Google

The breakfast was still on when we got to the outlet, so I had that. Was spot on. The restaurant was clean and cosy. Would recommend if you get hungry.

site_logo

Andrew . 2024-10-07

MORE AT Google

Been a few times before and was alright. Do thought as we had the dog would try a nice quiet early morning breakfast, place was rammed packed and queued for ages just to find they had no eggs, couldn’t do toast, no bacon, so just had to leave. Surely a restaurant can at least be a little preferred or warm people before the queue for ages that they can’t cope!

site_logo

Nigel Wilkins . 2024-09-30

MORE AT Google

Avoid the place like the plague. Literally still sitting in the restaurant while writing this. A review that is hot of the press. Like most other reviews talk about the negative staff members and the eye roll when you complain. Exactly what I got when I questioned why a jacket potato and kids chicken nuggets took over 30 minutes from placing the order to still not be delivered to the table. To be told potato went to the table, however the potato in question had come to the table but had red onion on it - not what we orders and no chicken nuggets accompanying it, so why would we accept the wrong order. The person making the order came to the table twice with different orders and kept saying “What did you orders, oh yeah your order is next. ” - well clearly it wasn’t since she still turned up with the wrong order for a second time. She kept blaming that the tickets “muddled”. Clearly no one can read tickets in sequence order. Never again. Regards ticket 32.

site_logo

Jonathan Batten-McCrae . 2024-09-16

MORE AT Google

The staff are absolutely fantastic

site_logo

Simon Cayne . 2024-09-14

MORE AT Google

Very expensive for what it is food not great ..good coffee

site_logo

stewart lang . 2024-08-28

MORE AT Google

Good restaurant, but busy and need to queue for a long time.

site_logo

Roni Ukken . 2024-08-16

MORE AT Google

Had some panini's here. They were 'ok' but very basic and took ages to prepare and served with school dinner type chips. Food is overpriced for what it is. Service was appalling. Not rude but just no care, no please or thank you. The restaurant itself was busy and noisy.

site_logo

Alan Fowle . 2024-08-09

MORE AT Google

If you want a quick snack or a proper meal I would recommend this place

site_logo

Shiela Macgregor . 2024-07-21

MORE AT Google

Great choice of food and friendly staff very clean

site_logo

Amanda Macnab . 2024-07-18

MORE AT Google

Terrible, waited 30 minutes for my food after paying, it was busy but still far too long a wait and food was average

site_logo

Freddy Kenney . 2024-07-15

MORE AT Google

Rude staff, awful hygiene and food just as bad. Was given milk for tea which was full of black floating specks. Took it back to politely ask for a replacement only to be greeted by an eye roll and a huff and rudely told "well it's only bits of coffee, but fine" and handed a new one (staff member with a blonde bob). Obviously I should have been happy to have "only coffee" in the milk intended for my tea, silly me! The cup was also dirty but I didn't dare go back after that. We were sat close to the counter and heard her barking at other customers, she really needs a lesson in customer service. We waited over half an hour for our food, during which we nearly left as we could see the waitress (dark red hair) balancing plates by resting her breast on top of the food. Saw her do this multiple times. Disgusting! Serving people food she'd had just had resting against her dirty shirt, squashed by her breast. Then the same waitress started wiping up bits of food off the floor with her hands, went straight behind the counter and started serving people their food without washing her hands. The food behind the counter is congealed, so we chose toasties thinking at least they'd be fresh. When they eventually arrived they were soggy and barely warm, and the chips had obviously been sat under a heat lamp for a long time. They were also full of black bits which needed to be picked off - why plate these? £28 for two toasties and chips, two teas and a J20. Daylight robbery, topped with a side of snark and a breast in your food. Lovely!

site_logo

Hayley Logan . 2024-07-15

MORE AT Google

The worst breakfast I have ever had cold and been cooked some time and over priced coffee was good staff ok but not interested

site_logo

roy martin . 2024-07-15

MORE AT Google

Came to this place today with a friend. We both had soup and a roll and the rolls were so dry! My friends roll was also so dry. When speaking to a staff member about this they had said that they were just cooked and put out 10 mins ago. I said that they didn’t seem like they where ans she said to me are you calling me a liar. We were so polite about it she the staff member warmer Soup was nice it’s a shame about the roll with the soup and the member of staff who was rude. We come once a week today, and never had a problem. But today we did and it’s now resulting in us to not be back. Very disappointed.

site_logo

Emma T . 2024-06-27

MORE AT TripAdvisor

Recently refurbished under new management well worth a visit.

site_logo

Davie Groves . 2024-06-17

MORE AT Google

Spacious space and plenty of seats The food is delicious I hope the waiter can use tongs to hold the sandwich and heat it up It would be better to grab it with your hands instead...

site_logo

Jessy Liao . 2024-06-16

MORE AT Google

Good plate of food at a fair price

site_logo

Steven Mullins . 2024-06-14

MORE AT Google

Never use again Poor food rude staff

site_logo

Thomas Gill . 2024-05-27

MORE AT Google

Fod is standard cafe food but a little overpriced for where it is. Assume its targeted at tourists/visitors coming from afar.

site_logo

Andy M . 2024-05-17

MORE AT Google

Long queues, dirty cutlery and messy tables. Plenty of other places to eat there

site_logo

Irene Mason . 2024-05-09

MORE AT Google

Nice place for meal food is excellent and reasonably priced. The staff are very friendly and helpful.

site_logo

STEPHEN PETER GOUGH . 2024-04-27

MORE AT Google

Service is always okay, but they run out of most food by 12, the hot food is very on par to hospital food so if your into that then sure. The sandwiches and cakes are better but for the price I just can’t seem to justify it.

site_logo

Luna xx . 2024-04-20

MORE AT Google

Absolutely disgusting the choice on offer was not very good so we chose to have the panini big mistake they were cold also served with cold chips. The ladies toilets were filthy. Will never use again

site_logo

Carlisle186 . 2024-04-18

MORE AT TripAdvisor

Quite a large seating area, with hot food available but early on. We had baked potatoes with various fillings, good size portions enough to share between two.

site_logo

Ms Anjali . 2024-03-24

MORE AT Google

Caledonia Park and feeling peckish …. Such a poor offering of food on their hot plate so we decided on panini options - that was our biggest mistake - we should have left. We chose ham & Swiss cheese panini and a tuna melt. We asked to add chips and told they were included and did we want coleslaw - we said yes, thinking it was included. The sad excuse for a panini, chops and coleslaw arrived in an oval plastic mesh ! It looked like a poor joke from the 70’s. My son who was visiting me from Edinburgh messaged his friends to say he’d had his worst meal ever. The half slice of razor thin ‘ham’ was so poor and the Swiss cheese (aye right!!) As for the tuna melt ended up being a knife and fork job as it was such a mess! The chips were minimal in every sense and we wondered if they had been microwaved to try and make them taste better - which they did not. The finale was when we discovered the very small coleslaw was not part of the deal and was charged at £1.70 extra each. Our lunch was dreadful and cost £36.50 for 3 panini, chips, coleslaw and a drink. Certainly not a ‘designer’ experience or an incentive to go back to shop if we wish to enjoy food / drinks. There’s much better options elsewhere for sure.

site_logo

Lighthouse keeper . 2024-02-25

MORE AT TripAdvisor

Very disappointed complete waste of money .my little girl got sausage chips and beans.the sausages were rock hard beans were like they'd been there since the morning.glass of milk was warm.pot of tea was cold and the soup well it was no way home made and lets not talk about the bread I'd never go back 🙈.the staff were very efficient but food was disgusting

site_logo

Joanne M . 2024-02-21

MORE AT TripAdvisor

Unfortunately had to edit this after my last few trips here not being very good Have come here for years, always been great service & good food, especially pre-covid, but unfortunately the bad attitude of 'one' lady behind the counter seems to be bringing it down. Second encounter of dismal service from her, this time complaining about her job to another member of staff who looked as dismayed as me 🤷 Coffee not great, coffee grounds in the bottom of my cup. Food ok, but over priced, chips served luke warm. Tables use to be wiped after each use, not left salty ..... It didn't use to be like this

site_logo

Jenny Dryden . 2024-01-27

MORE AT Google

The food is OK... stick to the simple stuff that is difficult to get wrong, like chips maybe. Some lovely people serving, the place is clean and well looked after, but we have yet to have an enjoyable meal. (Several attempts have been made) This time we had the soup and it tasted so artificial it was verging on the unpleasant, the baguettes were pale, slightly undercooked and not the freshest. The coffee was bitter, and lukewarm so by the time we had eaten the soup it was almost cold. Also...They never advertise what the soup of the day is before you choose whether you want a sandwich or toastie so you either have to go back to the end of the queue if you don't happen to like the sound of the soup, or you have to push ahead between the queue to ask, leaving someone to keep your place in the queue at the sandwichdisplay... such a 'simple to solve' issue if someone could be bothered to consider the customer experience. Just stick a sign at the start... The name 'Village' gives the impression you might get something closer to a home cooked meal, maybe even local produce, but you would unfortunately be mistaken. The food is akin to hospital grade. (Edible but questionable nutrition where flavour is sacrificed for volume), in fact I have had better food in hospital compared to this last meal. We won't be back any time soon I'm afraid.

site_logo

Jo Seawright . 2024-01-09

MORE AT Google

One star regarding food and wait time I am being too generous, zero would be more honest, if there was one. My partner and I bought (stupidly) , We feel hoodwinked by the staff and service., and we and others were totally at the mercy of the restaurant. Ordered and paid eventually for a portion of chips (small amount) with two sausages on one plate, for myself and another small portion of chips with a tomato, ham and cheese toastie on another plate for my partner. Plus Two traditional pots of tea. It cost £22.40 ish. Food was cold by time we found a table.. Q took forever to get served paying at cash till even longer. No itemised receipt. I will be complaining as it was day light robbery of the highest standard.

site_logo

Pamela Booth . 2023-12-29

MORE AT Google

Visited The Village and ordered the Mac and Cheese with a Caffe Latte for £12. While the price suggested a promising treat, the experience fell short. The Caffe Latte, unfortunately, leaned towards bitterness – perhaps a suggestion for a lower coffee strength next time. The Mac and Cheese, although labeled as "just fine," left a salty aftertaste, contributing to a somewhat dissatisfying meal. A mixed bag that may benefit from some adjustments for a more enjoyable experience.

site_logo

Joseph Thomas . 2023-12-27

MORE AT Google

Gotta say. BEST mince pies we have ever had!!! I'm kinda glad you couldn't buy them by the box lovely relaxed atmosphere too 😊

site_logo

DaniBluebell . 2023-12-17

MORE AT TripAdvisor

Very unpleasant lady served us, no flexibility in meal choice, I didn’t want chips but was told it came with the dish, my friend asked for a small portion and was told that the Christmas dish one was just one size!! In spite of the fact she was serving it with a spoon from hot hold dishes. Plates were cold, food was Luke warm. Tasted not bad but very expensive for low quality cafeteria foods of!

site_logo

Anne McLauchlan . 2023-12-14

MORE AT Google

On a Christmas shopping 🛍️ trip I decided to treat myself to a Christmas turkey lunch… I wish I hadn’t. The food was cold, red cabbage was overly sweet, parsnips and Brussels sprouts were hard and inedible! And for £12 it was day light robbery. Lady serving the lunch had as much Christmas cheer as the food .. avoid and go to Greggs !!!

site_logo

Christine Cox . 2023-12-13

MORE AT Google

Husbands breakfast sausage roll (no full breakfasts left and turkey dinner not ready) was 2 very unappetising looking sausages with 2 pats of butter and a small roll, not even made up as a roll! My jacket potato took so long to come he’d finished his roll. When we tried to chase it up, as people who arrived after us had been served, the reply was a very short “it’s coming”. When it did arrive it wasn’t even hot enough to melt the cheese and there was no butter. Couldn’t wait to get out of there and won’t be back. Should have been a red flag how few people were in there at 11:30 on a Saturday.

site_logo

Nicola S . 2023-11-28

MORE AT TripAdvisor

Food was nice. I however don’t get the logic of serving one plate up off the hot counter and then bringing the second one out 20 mins later after wife has finished eating

site_logo

Anton Pearson . 2023-10-21

MORE AT Google

Food was rotten bake tattie was hard vegetable soup had no taste would not return

site_logo

Dawn Crooks . 2023-10-19

MORE AT Google

The food was good but a little bit pricey. Service was slow.

site_logo

Alex Smith . 2023-10-09

MORE AT Google

Very poor quality food. Chips looked and tasted like they were cooked at the start of service and repeatedly reheated. Crockery and cutlery were not properly cleaned. No local/fresh ingredients.

site_logo

MarshaG573 . 2023-10-08

MORE AT TripAdvisor

Good village cafe with a good selection of food at reasonable prices. Good service and lovely staff with a good atmosphere

site_logo

Derek Forster . 2023-10-07

MORE AT Google

The lady serving on the counter was very friendly and professional. The food was very good and the place was dog friendly, which was a bonus to us. Highly recommend this establishment.

site_logo

Anita Short . 2023-10-04

MORE AT Google

Arrived just before 11am. Not busy. Scant availability of breakfast items. Ordered crispy bacon roll which they were going to cook. It arrived and was not properly cooked. Maybe they are economising on electricity. Had to request a nuking in the microwave to ensure no bacteria. The roll was covered with a yellow spread probably some kind of seed oil blend. Gives new meaning to greasy spoon cafe. Not value for money. One star is overly generous. Give this place a miss.

site_logo

Helena Innes . 2023-09-30

MORE AT Google

I travelled a fair distance to use the restaurant and unfortunately I was left disappointed. I ordered a cheese toastie for my partner. I was informed it was cheese and ham, I explained my partner didn't eat ham and asked if they could please remove the ham. Before heating. the young lady serving refused and told me to remove it myself. I was shocked at this, certainly didn't expect that reply. I also ordered a coffee which was not the warmest I also had chips egg and cold meat which was acceptable.

site_logo

tony tumulty . 2023-09-24

MORE AT Google

Lack lustre service, passable food but a limited selection.

site_logo

Jack Eales . 2023-08-28

MORE AT Google

Love going for Breakfast here. Good food you get a choice of a six piece or eight piece or ten piece breakfast. Staff are always friendly and there is plenty of seating.

site_logo

Lesley Billington . 2023-08-23

MORE AT Google

Chaotic service, poor quality overpriced food, drinks expensive, had to ask for a hand written receipt because the till printer wasn't working. Overall an unpleasant experience will not use again.

site_logo

John Radigan . 2023-08-19

MORE AT Google

dry tasteless food , expensive for cheap rubbish,avoid at all costs go elsewhere

site_logo

Lana Whitehall-pain . 2023-08-02

MORE AT Google

Good food at a reasonable price, even let our little dog in

site_logo

stevethegrease monkey . 2023-07-30

MORE AT Google

The coffee here was cold and tasteless.I ordered macaroni cheese which was all cheese and no macaroni or pasta.We were also overcharged for an extra portion of the macaroni cheese,not sure how the staff member didn’t notice the cost as reflected to what was on our tray.Staff member dropped chips and salad when serving another table and stepped over them on way back leaving another staff member to clear it up. On the plus side the sandwich my friend purchased was avarage but still awaiting his refund for non existent macaron……

site_logo

Hilary B . 2023-07-07

MORE AT TripAdvisor

Disappointing experience! First the positive: This is a busy restaurant but it is clean, food looks good and it’s well-presented. Now the downside: We ordered a toastie and a panini, each served with chips at £7.60 were thought this quite reasonable. We were offered coleslaw to which we we said yes, only to find at the till that we would pay £1.70 (subsequently discovering that this was for the privilege of a little plastic container that I’ve seen used for tomato sauce and the like, filled with coleslaw). We then selected a seat with our order number marker clearly showing and waited and waited, watching those served after us ,with similar orders, be served before us. The food finally arrived without my panini to which I heard ‘oh they’ve done it again’ but the other order (toastie) also turned out to be wrong! The server then said ‘I must have picked up the wrong order’. After another wait the correct order finally arrived and the panini was okay, not brilliantly toasted but okay! The toastie, I’m told smelled and tasted off and the chips neither looked or tasted good. The small £1.70 carton of coleslaw was however tasty - in so glad we got it! Would I visit here again: absolutely not! Would I recommend it to others: absolutely not!

site_logo

Sandra McKenzie . 2023-04-28

MORE AT Google

The pleasant exterior & decor are a masquerade for poor quality food. We had the breakfast menu of a bacon roll. It was served as a dry bun, rock hard butter & cold bacon that you made yourself. My wife had a tuna panini off the shelf which was fine. All in All, very poor, but not much competition in the shopping centre

site_logo

bob19872018 . 2023-04-27

MORE AT TripAdvisor

Just went for a drink, was told no by a member of staff, with no explanation! Walked out as very rude staff. I can only assume they didn't serve drinks without a meal?! 😡

site_logo

Ian Wood . 2023-04-16

MORE AT Google

Coffee and cake before shopping. Dog friendly. Clean and friendly.

site_logo

Tracy Gray . 2023-04-09

MORE AT Google

Great selection of foodstuffs and soft drinks. Choice of 6 8 or 10 piece breakfast

site_logo

George Bain . 2023-04-07

MORE AT Google

Here for bite to eat and toilet break. Didn't get time to see shops...... another time.

site_logo

Lesley Martin . 2023-03-18

MORE AT Google

Great place to eat. Coffee and Welsh cake very good. Staff friendly and helpful.

site_logo

Phyllis Cook . 2023-03-08

MORE AT Google

Typical run through motorway cafe. Nice array of snack meals & drinks..

site_logo

hugh ross . 2023-03-05

MORE AT Google

Second visit and again it was really clean with a great choice of fresh food and drinks. Highly recommended.

site_logo

sue capewell . 2023-02-27

MORE AT Google

Awful food, asked for fish and chips to be told the didn't have it but could do scampi but when ordered that was off the menu too. Had lasagne but on trying to empty it on the plate it was macaroni. Did order 2 curries as well and it was all cold and had to be put in a micro to be heated, this was at 12.30 and not a busy place. Definitely won't be back

site_logo

Chris Pirie . 2023-02-06

MORE AT Google

12:40 and no selection of food left what we got was the cold left overs which had to be heated up in microwave and very expensive. Staff not very friendly even carry lukewarm coffees for them just walk in front of u . Save your money

site_logo

callum Pirie . 2023-02-06

MORE AT Google

Toasties could be better, cakes were good and tea and coffee was good. Rather big for lack of customers even at this busy time resulted in it feeling cold.

site_logo

Paul Hipster . 2023-01-05

MORE AT Google

Mediocre food , not great quality for the price . Jacket potato with no butter,soft skin, not soft and fluffy as a jacket should be. With a low grade coleslaw on the side. Nice surroundings, pleasant staff , but the hot food really needs to better.

site_logo

Alison Bates . 2023-01-05

MORE AT Google

Very quick efficient service,food was tasty well presented.goodclean toilets too

site_logo

david blinkhorn . 2023-01-03

MORE AT Google

The thing I liked most about this place was the staff, the management team are very nice people and willing to do anything to keep the place good for its customers

site_logo

David Gladden . 2023-01-03

MORE AT Google

Visited today for lunch while shopping, very friendly staff, and my Turkey with all the trimmings was absolutely lovely, and the mince and onion pie with nice fresh chips was also a hit with my partner, we usually go to the hotel across the road , but will definitely return, highly recommend,

site_logo

479maureenl . 2022-11-18

MORE AT TripAdvisor

Food nice enough, but the vegetarian panini I wanted, was turned non vegetarian by adding turkey for Christmas.

site_logo

Rachel Parsons . 2022-11-08

MORE AT Google

Food was very cold i think it was lying for some time a waste of money

site_logo

john ness . 2022-11-07

MORE AT Google

Thoroughly enjoyed our lunch, the turkey baguette & chips was really good!!

site_logo

David Nichol . 2022-11-07

MORE AT Google

We visited during a busy lunchtime. Understandably, there was a large queue, but I was slightly disappointed at the length of time it took to place an order. The size of text on the wall display menu near the door was a bit too small, and my sight is very good. By the time I had placed out order and paid, all the seats in the restaurant were occupied, so the only option for us was to share a table with people we didn't know. The food was tasty when it arrived.

site_logo

Leanne Rossin . 2022-11-07

MORE AT Google

Nice placr to eat and dog friendly which helps

site_logo

Steven Brown . 2022-11-06

MORE AT Google

Great fish and chips reasonably priced.

site_logo

Neil Lennox . 2022-10-31

MORE AT Google

Always go here if passing bye and always very good.

site_logo

David Stalker . 2022-10-30

MORE AT Google

Just went for a light lunch after shopping. The Baked potato with chili was tasty and very large. while the children's portions of a baked potato with cheese was not much smaller. Service was very quick despite it being busy. Pleasant staff .

site_logo

thomas n . 2022-10-23

MORE AT TripAdvisor

Prime example of getting what you pay for.

site_logo

Peter McAuley . 2022-10-18

MORE AT Google

Only had drinks so absolutely no idea about food but staff were friendly enough.

site_logo

Johnny Northerner . 2022-10-11

MORE AT Google

weak warm cafe wouldn't use again if I visiting the outlet

site_logo

Jules . 2022-10-06

MORE AT Google

Was perfect for a coffee cakes all looked very tempting unfortunately didn't have time for more than a quick visit

site_logo

Gaynor Birnie . 2022-10-06

MORE AT Google

Slooooow service especially when you're in a rush

site_logo

Stuart Walker . 2022-10-05

MORE AT Google

Poor service. Dirty floor. Food was ok.

site_logo

Fiona Turner . 2022-10-03

MORE AT Google

Based in Gretna Outlet Village. A busy cafe for drinks and snacks. Also cooked meals were available, reasonably priced compared to others coffee houses!!

site_logo

Martin Hill . 2022-09-24

MORE AT Google

Called in for lunch, and was not disappointed. Staff very helpful, Food served promptly and at a reasonable price.. Will call again.

site_logo

Nigel D . 2022-09-15

MORE AT TripAdvisor

Pleasant place for a snack and drink during your visit to the outlet mall

site_logo

Sam Spud . 2022-09-13

MORE AT Google

Good food at reasonable prices.

site_logo

Patricia Yassin . 2022-08-30

MORE AT Google

Great dog friendly restaurant. Fresh food, high quality and friendly

site_logo

Carol Mee . 2022-08-29

MORE AT Google

Nice place to stop. Had nice soup and drinks.

site_logo

Jack Cannon . 2022-08-25

MORE AT Google

Great place to stretch the legs after a long journey, dog friendly and nice food

site_logo

Bathroom Trend . 2022-08-21

MORE AT Google

I was a dissatisfied with the staff when I got to hot food pit they just stood there and didn't ask anyone what do you want.

site_logo

Tina Morton . 2022-08-19

MORE AT Google

Quick service, friendly staff and food was great

site_logo

Allan Smillie . 2022-08-07

MORE AT Google

Called in on our way home, just for drinks a pot of tea & a cappuccino also a cheese scone & a fruit scone they were ok but nothing special. Staff were pleasant & helpful when we asked if we could bring in our dog.

site_logo

alison s . 2022-07-26

MORE AT TripAdvisor

Nice breakfast, reasonable prices,very clean,and quick service from friendly staff.

site_logo

Andrew Young . 2022-07-25

MORE AT Google

Similary restaurants in Lowlands

restaurant_img
4.0

162 Opinions

location-icon54 Victoria Street
Other cuisines
outdoor_seating_116635takeaway_116635delivery_116635

Sorry this review is late but can I say we stopped off to watch the play off final( national league England) and we were made to feel so welcome by the lad behind the bar whose name I'm embarrassed to say I cant remember. I must say the locals on the day were fabulous and were fellow Poolies by the end! As far as the place itself it's a proper pub,clean ,good beer good craic and very very freindly atmosphere if ever we go back over that way it will definitely be a place to visit

restaurant_img
4.0

245 Opinions

location-icon88 Queen Street
Other cuisines
outdoor_seating_205596takeaway_205596delivery_205596

Gerard McGonigle. My wife and I stayed in this hotel in September this year( 2024) and were delighted with the place. We could not understand how it ever received bad reviews. The staff were always pleasant and included in the very affordable price was a full Scottish breakfast.I’d have no hesitation in recommending this hotel. Sincerely, Mr.&Mrs.McGonigle.

restaurant_img
4.2

2772 Opinions

location-iconGullane, Lockerbie Road
Other cuisines
outdoor_seating_111132takeaway_111132delivery_111132

We arrived a little early but were seated promptly along with our dog, staff were quick and efficient with drinks and food order, food was again very nice , piping hot and once again a great experience

restaurant_img
4.3

180 Opinions

location-icon6-8 Butts Street
Other cuisines
outdoor_seating_322121takeaway_322121delivery_322121

Yet another fantastic meal, this time on the Friday in March BOGOFF burger deal. Food is faultless, plentiful, service is always good and atmosphere was lovely with the mood lighting. Steak burger with choice of 3 toppings ( photo shows toppings of cheese, haggis and fried egg and the other is cheese, bacon and fried onions) good selection of toppings and a sauce of your own choice too. Even without the BOGOFF deal it is good value for money Finished off with a lovely pint colada cheesecake

restaurant_img
4.3

882 Opinions

location-iconQuayside Glencaple, Dumfries DG1 4RE Scotland
Other cuisines
outdoor_seating_270915takeaway_270915delivery_270915

What a gem of a place. We stopped by on a camper van tour for breakfast /brunch. Food excellent as was service. Caters for vegans too. Would imagine it gets very popular in season. Felt relaxed and unhurried here looking out on the Nith river with Criffel in background. Oystercatchers to watch browsing along the shoreline.