GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.0

Based on 192 opinions finded in 2 websites

site_photo4

Nº 1277 in 2148 in Bristol, City of

Nº 11 of 15 Thai in Bristol, City of

CUSTOMERS TALK ABOUT DISHES WITH..duckcurrychickenprawnricefriedprawnsspicynoodles

comment_iconOpinions

Very good- real thai flavor. Fish & prawn is fresh and fried very well. Recommend prawn with tamarind sauce so delicious

site_logo

machima archavanijkul . 2024-10-12

MORE AT Google

WOW! Absolutely amazing food, probably the best Thai food in Bristol. Set Menu B was incredible. Had the Panang curry, duck, beef and then separately had an incredible massaman curry. To start the dumplings, all just amazing authentic tastes and aromas. Wish we’d been sooner

site_logo

Becky Haworth . 2024-09-03

MORE AT Google

Recommend Thai food in Bristol! Various types of menu, quick serve, good service, taste delicious, and great services! What's else I can say? You need to try yourself. Before, I did order delivery often from here and today, I got a chance to visit, and I'm 100% impressed! ❤️❤️❤️

site_logo

Pim . 2024-08-19

MORE AT Google

Staff are friendly and the interior feels a lot more traditional than a lot of Thai restaurants. We really enjoyed our food, very delicious but the menu isnt very innovative...again its like your traditional popular Thai food.

site_logo

Aleina Allen . 2024-08-06

MORE AT Google

So good we went twice during our weekend visit! Food is fabulous, probably the best Thai we've had. Staff are always friendly & service is efficient.

site_logo

Lou Thomas . 2024-07-16

MORE AT Google

The food here is superb! Traditional, tasty and served with a smile! I’ve also had takeaway from these guys which is consistent and get delivered super fast! Would recommend for quick, delicious and healthy meals.

site_logo

Stacey Lillico . 2024-06-21

MORE AT Google

we got free jelly last sunday anyway thank you for kind heart

site_logo

Fteaeu Noipea . 2024-06-17

MORE AT Google

We ordered online and paid 35 quid for this, awful quality and dreadful value for money.

site_logo

Sasha Malléjac-Ward . 2024-05-24

MORE AT Google

Thai food will always be what I have whenever I am out of my home on a trip as a fussy eater. Food here was really good. I was skeptical because their menu online was from like 2years ago but I'm glad I was not disappointed. Dining in was not busy at all but I noticed they had a lot of take outs. The ambience was nice and neat. The server was polite and our food was hot and came on time. Portion was also filling. I had the special fried rice with chicken and loved it. I would have preferred if the veggies were cut smaller but it was amazing. My husband had khao sab pa rod with chicken which is basically rice with pineapple, cashew nuts and curry? I think lol. He loved it. Unfortunately I didn't take photos of the food. We forgot haha. But I have proof that we cleared the plate lol. I did take pictures of what remained when I remembered. We also had spring rolls. The spring rolls served was 3 and for drinks I had long island iced tea and he had Mai tai. They were really good. I highly recommend. It's good that it's very affordable as seen from the receipt. Service charge was applied

site_logo

Yemi Saka . 2024-05-21

MORE AT Google

Delicious Thai food in town! Tamarin Roast Duck is a must 😍, my friends and I had a good time here, the atmosphere is nice and staffs are super friendly!

site_logo

nicha . 2024-05-19

MORE AT TripAdvisor

Atrocious takeaway. Jungle "curry", which was actually just a broth with some chicken and veg. £6.90 for 4 tiny dumplings. Flavourless muck.

site_logo

Liam Hurley . 2024-04-26

MORE AT Google

Really advise against takeaway from this place. Pad Thai is probably the worst I've had in Bristol. No sauce, no flavour really. Pad Thai should have strong umami notes but it has nothing. We had to make our own Pad Thai sauce at home to put on it.

site_logo

Simon Redmile . 2024-04-16

MORE AT Google

Had to be the worst pad thai I’ver had. To charge £21 for a pad thai and a drink and for it to be this bad is completely unacceptable and disappointing. Tiny portion and completely tasteless. The iced tea was ok.

site_logo

BALKAN . 2024-04-09

MORE AT Google

good enough for an english person with no clue about thai food. not good enough for a thai person.

site_logo

nina . 2024-04-03

MORE AT Google

Took my mum there for mothers day.Food was really good people are really helpful and polite and it's 5 stars Food try the thai papaya spicy hot

site_logo

lee smith . 2024-03-14

MORE AT Google

The food is too fast, too delicious, and too affordable. Proceed with caution ⚠️

site_logo

Jon White . 2024-02-23

MORE AT Google

We had an amazing meal here for my birthday! The food was incredible and very authentic. The customer service was very attentive and friendly. We will definitely be back again. Thank you very much!

site_logo

Will Vile . 2024-02-18

MORE AT Google

The food was very, very nice. Service was good. Cleanliness in bathrooms a bit off. Not sure about the Cork for a toilet flusher! Would recommend to book as it did get busy after 7pm.

site_logo

Tracey Larkin . 2024-01-28

MORE AT Google

The food here is bland and totally overpriced. The worst Thai I’ve ever had. Never going to eat here again

site_logo

Adam Hewson . 2024-01-28

MORE AT Google

Amazing Thai food. Super friendly staff

site_logo

Matt Bedford . 2024-01-12

MORE AT Google

A really good Thai restaurant with excellent service and food taste really good. We had lots of food can’t find anything bad for us. Som Tom is my favourite 😁 Will go again next time for sure ☺️

site_logo

Lway Myint Myint Kyi . 2023-12-30

MORE AT Google

AVOID. Worst Thai takeaway I’ve ever had. Poor quality, small portions, over priced, over cooked. So dissappointing.

site_logo

Murray Hitchens . 2023-12-19

MORE AT Google

Excellent food with friendly and quick service. Don’t understand how it is not busier but always seems easy to get a table.

site_logo

David Bignell . 2023-12-13

MORE AT Google

Popped in for an evening meal, the presentation was above average, quality of the food outstanding, a must visit place

site_logo

Henry Thomas . 2023-12-01

MORE AT Google

Very friendly welcome. All the food was exceptionally tasty with a well balanced set menu. We will definitely come again if we are staying in Bristol.

site_logo

Clare Hansen . 2023-11-25

MORE AT Google

Absolutely the worst thai i have ever had, in a party of four we all agreed the food was awful,we had mixed starter for two that was OK, the coconut soup was awful supposed to creamy it was more like dish water with two halves of a cherry tomato,four slithers of red onion and 6 halves of mushroom and eight pieces of chicken which was so dry it was awful,my freind had the massaman lamb shank curry and the colour of the meat and its taste was dreadful,I had the pad kae moe and it was just greasy over cooked chopped noodles I had two fork fulls and left it the beef in it was dreadful,we also had a pad thai which was over cooked,the dumplings the crackers were OK tasty but that is and for a,£165.00 it wasn't worth 65.00 PLEASE DONT USE THIS PLEASE ITS AWFUL SAVE YOUR MONEY!

site_logo

Diggs C . 2023-11-05

MORE AT Google

Great food, Great service - a real treat.

site_logo

Richard Tempany . 2023-10-06

MORE AT Google

Food really bland, tasteless. Very small portions for the price. Won’t be ordering again.

site_logo

Greg Grey . 2023-10-01

MORE AT Google

We enjoyed our lunch, veg(eteri)an option for just about every dish. Dessert options very limited. Price very reasonable, especially considering the location. Parking possible but not free unless you have a blue badge. Two of the four would definitely go here again, one wouldn't mind, the fourth in the party complains about everywhere . . .

site_logo

Patrick Donnell . 2023-09-25

MORE AT Google

Just received jungle Thai curry, looks like hot water with a few things floating in it. Have had jungle curry in Thailand and this looks nothing like it. Have been charged 12 pound for things floating in hot water. Absolutely disgusting

site_logo

peter jones . 2023-09-02

MORE AT Google

Lovely warm ambience by riverside. We were greeted by the staff who were very courteous and happy to cater to our vegetarian needs. The food was absolutely delicious and beautifully presented. They asked for the level of spice we wanted and were happy to tweak it to our needs. We ordered the set menu with a range of starters which was a good sharing platter.Along with that we had a set menu with veg massman curry , papaya salad , jungle curry and veg noodles that my 8 yr old son loved it so much that he finished it happily. We recommend it to everyone and we will be definitely visiting this restauranton our next visit to Bristol.

site_logo

Lexi . 2023-08-27

MORE AT TripAdvisor

Very nice and authentic Thai food from uber delivery

site_logo

chui sunny . 2023-08-11

MORE AT Google

Absolute rip off - tiny tiny portions - stay away. The food is very poor. Haven’t been for a while for a good reason. Thought they might of just had a bad night. But no. It is awful

site_logo

Sam M . 2023-08-03

MORE AT TripAdvisor

Lovely, friendly customer service and yummy pad thai! :)

site_logo

Charlotta . 2023-07-13

MORE AT Google

Had takeaway from here and found a hair in my food. That was really gross and safe to say that I will not be ordering from here again

site_logo

Wombling_Free_7548 . 2023-06-16

MORE AT TripAdvisor

Can't fault this fantastic restaurant. Every detail from the pork dumpling presentation, to the music and cocktails. First class. We will be back soon.

site_logo

Jason Phelan . 2023-06-10

MORE AT Google

Last night of a short trip to Bristol and we fancied a Thai meal. Quick search brought this up and we booked and headed down. Place was a bit quiet which got us thinking we had made a mistake but nothing could have been further from the truth. Staff were brilliant and friendly. We made an error in our order which we corrected without and issues from the staff. Our food was faultless from start to finish. I like authentic Thai (hot) and asked for extra heat which was delivered and left me sweating. Prices were fair, wine wasn't overpriced (Merlot) and overall we were most impressed with the whole experience. I'll be heading back on my next trip to Bristol.

site_logo

JTMJTM . 2023-06-01

MORE AT TripAdvisor

The restaurant is reasonably priced, all classic Thai dishes on the menu , plus some fish options. Speedy service , nice cocktails, friendly staff.

site_logo

andrew hollister . 2023-05-29

MORE AT Google

The food here is spot on, great Thai flours. The staff are attentive and the service is first class.

site_logo

James Thomas . 2023-05-10

MORE AT Google

Fairly good food and service, they badly need to clean the filth off the toilet door and the thick dust adorning the inside of it that doesn't look as if it's seen a cleaner in a very long time ......

site_logo

Lloyd Vivian . 2023-04-30

MORE AT Google

The Food could have been better. Disappointing as had eaten here a few years ago and enjoyed.

site_logo

. Chittamani . . 2023-04-24

MORE AT Google

DEFINITELY RECOMMEND. If you’re looking for a really good Thai place I would say this has to be one of the best in Bristol. The food is really tasty and authentic.

site_logo

Keira Kaur . 2023-03-25

MORE AT Google

Had Prawn Tom Yam to start the Local Seabass and Masama chicken curry. Very tasty

site_logo

Ryan Chow . 2023-03-09

MORE AT Google

We were visiting our son in Bristol and booked here for a meal for the 3 of us (Valentines night!). The restaurant was very busy. We had a pleasant welcome on arrival and service throughout was very good but it was the food that was stand out- all three of us agreed that our individual meals were absolutely delicious- would definitely recommend and would love to visit again when were are next in Bristol.

site_logo

Jmac10 . 2023-03-09

MORE AT TripAdvisor

Use to be my favourite Thai but since new owners?? It's not what it was 👎 won't be returning .

site_logo

Derek Mead . 2023-01-18

MORE AT Google

Online order of cashew nut tofu, veg and rice. The food was tasty and arrived hot even from quite a distance because of how well wrapped it was e.g., the cold drink was not put in the same bag as the hot food, and the rice was double wrapped and all in plastic boxes. Great caring for my allergy, they wrote gluten free on the box so I could feel safe knowing it was. The food was good quality, cooked well and nicely presented. Thought even went into the pretty shaping of the carrots. I would be a regular here but for one thing, there were only 4 small bits of tofu in the meal, so it was mostly veg and rice. If the Local Thai reply to say they will add even two more small bits of tofu to this meal I would order it often! Overall, thank you.

site_logo

amelialouiserose . 2022-11-02

MORE AT TripAdvisor

We had a takeaway from here and I had to write a review as the food was outstanding. I had prawn Penang curry, it was full of flavour and fresh vegetables. The large butterfly prawns were fresh and tender. The jungle curry was also delicious with tender tasty marinated beef as was the mixed starter. Best Thai takeaway I’ve ever had.

site_logo

KLN03 . 2022-10-29

MORE AT TripAdvisor

Have to say the food is tasty but the portion sizes are tiny. I ordered tofu stir fry, and the tub was mostly filled with vegetables, only 2 little chunks of tofu. As it should be a protein replacement it should be way more although other reviews say they don't put much meat either. Such a shame as I'd visit more often If they put more meat/protein in.

site_logo

Lewis Winter . 2022-10-29

MORE AT Google

It is excellent Restaurant excellent food and drink very welcome staff lovely and friendly and helpful

site_logo

Patricia Louise Scother . 2022-10-15

MORE AT Google

Have been long not having good Thai-dishes in Bristol. This is a REAL surprise. - Possibly the closest to the taste we had in Hong Kong or Thailand. - Great atmosphere inside, while it’s just located next to the Bristol harbour. - Great services, as usual very humble and polite Thai style :) We ordered Tom Yum (with Mushroom), Roasted Duck Spring Roll and Pad Thai (with Chicken). Love to try Thai Curry next time.

site_logo

Sean Lau . 2022-10-07

MORE AT Google

Good choice of reasinably priced dishes. Service could have been better.

site_logo

Gerald McGrath . 2022-10-03

MORE AT Google

Delicious pad Thai, very polite staff.

site_logo

Klaudia Bączyk . 2022-09-24

MORE AT Google

Very tasty food! Really good price for the quality!

site_logo

Giannis Kamzolas . 2022-09-24

MORE AT Google

I got my ordered delivered from this place. Chicken satay starter, stir fried spicy kra praow prawn and stir fried ginger chicken. The food tasted nice and arrived quite warm. That is where the good things end. The portions were tiny. I am a very tiny woman who does not each much and a starter and main did not even touch the sides. The portions were tiny! So disappointing. The very shallow container was barely half full. I am not expecting that the restaurant give me a kilo of prawns or chicken but a bit more vegetable to make it filling and the portion size bigger does not increase the cost exponentially. I ended up cooking and serving the food as starters instead. So disappointing.

site_logo

Anita Matthews . 2022-09-02

MORE AT Google

Ordered on Uber Eats as it has really good ratings, although I’m not sure how they have such good ratings as my experience wasn’t so great. The food tastes good but overpriced for what you get. I paid £11.60 for a Beef Massaman Curry (no rice) and I literally got 5 small pieces of beef. I was so surprised to see so little beef in the container; not to mention the texture was rough and hard to bite into. The salt and pepper calamari was average too, and there were only a few pieces. I have had better ones before, where I got way more calamari for the same price. Maybe you’ll get a good experience when you eat at the restaurant? But I definitely would avoid ordering takeaway/delivery from this place.

site_logo

J B . 2022-08-22

MORE AT Google

Delicious food with efficient friendly service 😋

site_logo

Rosalind Evans . 2022-08-14

MORE AT Google

Quite nice tasting Thai restaurant this place is suited more for couples. Tastes very good good portions and friendly people here.

site_logo

Kris Bee . 2022-07-31

MORE AT Google

I would like to say we ‘chanced our arm’ after looking at some of these online reviews… but can honestly report that the food and service here are nothing short of wonderful. To start - salt and pepper chicken, prawn tempura and Duck Dumplings… duck - sensational - In one off the spoon… 🔥🫶🏽 Tempura light and crispy, allowing the juicy fresh ingredients to shine! Mains - Prawn red curry, duck red curry and Crying beef with coconut rice.. absolutely as good as on the beach in Thailand 🇹🇭 Authentic flavours - great attentive service and just exactly what I look for in a great Thai food establishment. Reasonably priced as a bonus - this will be on the list every time I come to Bristol!

site_logo

L Levon (K1teN1nja) . 2022-07-09

MORE AT Google

Absolutely amazing food every time

site_logo

Réka Márton . 2022-06-25

MORE AT Google

A friend recommended My Local Thai. I can honestly recommend it myself. Bottled beer bit expensive but what's new in restaurants. Will be visiting again soon.

site_logo

Mike Daniels . 2022-05-25

MORE AT Google

Great food friendly and helpful waiters thoroughly enjoyed our evening here thankyou

site_logo

Sally Daniels . 2022-05-22

MORE AT Google

Overpriced and not very authentic. When i asked if the mushroom tomyam has asian mushrooms in it (oyster mushrooms) the server said yes, but when the tom yam arrived, they were button mushrooms. So clearly they use cheap ingredients. theyre also not as spicy as i requested. For the price, food was mediocre and not as authentic as its supposed to be.

site_logo

Rania Hastings . 2022-05-13

MORE AT Google

Nice service. Food wasn't as flavoursome as I expected. Good portion sizes

site_logo

Sash Lods . 2022-05-04

MORE AT Google

An empty plate for me could only mean one thing. Took my family to dinner here (first time). We were greeted very pleasantly, service was excellent and food/ingredients fresh. For me personally, I would have liked more of a deeper Thai taste/flavour. But all together, it was an excellent evening dinner.

site_logo

San Hes . 2022-04-27

MORE AT Google

£3.50 for a side of rice? Thanks for ripping me off.

site_logo

Dave K . 2022-04-07

MORE AT Google

I recently got a takeaway order and was impressed with everything that I got (combo appetizer platter, prawn Pad Thai, and spicy Kra Praow with beef). I will definitely be ordering from The Local Thai again.

site_logo

Jordan Rongers . 2022-02-26

MORE AT Google

So polite and caring and helpful and the food is A****

site_logo

ruth Knight . 2022-02-05

MORE AT Google

The pad thai was bland and the tom yum was delicious but a bit salty. The somtam was average and spicy. I also ate local Seabass, and the fish meat was soft and delicious. ^^* I don’t know if I’ll go a second time… The servers are extremely slow and clattering,,! Recommendation: People with patience 👍🏻

site_logo

싫어요 호박약 줄거예요 . 2022-02-05

MORE AT Google

Really loved the food here Great service Food was prompt and delicious

site_logo

crift user . 2022-02-03

MORE AT Google

The food was delicious. Great service and great prices.

site_logo

George R . 2022-01-28

MORE AT Google

Awesome taste here,the atmosphere is fantastic! Thank you

site_logo

Calmis Constantin . 2021-12-24

MORE AT Google

Incredible food. Simply delicious

site_logo

Christian Lang . 2021-12-23

MORE AT Google

Great food, friendly and helpful service

site_logo

Jo B . 2021-12-17

MORE AT Google

Superb people - delicious food, thank you 🙏

site_logo

Erikas Kacerauskas . 2021-12-17

MORE AT Google

Nicely decorated, very friendly staff, good atmosphere, great food and well priced. Will definitely come again.

site_logo

swanysimmons . 2021-10-27

MORE AT Google

Portion size a plus but service slow and curt, menu online not updated correctly showing lunch special that doesn't exist

site_logo

A N . 2021-10-25

MORE AT Google

Very tasty and authentic flavours but absolutely tiny portions. The curry was just sauce, maybe 5 small slithers of beef and a couple of vegetables.

site_logo

Anna . 2021-10-23

MORE AT Google

Lovely food and atmosphere. First time ever eating Thai food brilliant. The staff are wonderful and so nice. Definitely coming back. Kobkun

site_logo

LionBolt Fitness . 2021-09-14

MORE AT Google

Awful decor, poor service and average food at best. I'm amazed anyone would give this place more than one star!

site_logo

Unequivocal Dao . 2021-09-12

MORE AT Google

Will never go there again. Loved the Thai that was here before it was taken over and assumed this would be as good, but unfortunately not. The restaurant carpet is filthy. Staff are rushing around and seem not to understand what you say. A female appeared to be the manager but not very effective in my opinion. We spent £58 on poor quality food. 2 starters and 2 mains. After about 20 minutes they arrived with 1 starter and both mains. The ‘manager’ then took the mains back and we had to wait 20 minutes for 2nd to arrive. We ordered squid but it was tasteless. Mains not much better. I ordered Thai Green Prawn Curry. Small portion with 6 tiny prawns which again was pretty tasteless. Whole evening was spoiled. I do not recommend this restaurant.

site_logo

625Lorraine . 2021-09-12

MORE AT TripAdvisor

What a find this is! Genuinely some of the best Thai food I've ever had. This is a lovely restaurant with plenty of seating. The staff are really friendly and welcoming and couldn't do enough to ensure we had a great time. We had the pork dumplings, ribs, spring rolls and calamari to start and we were not disappointed. All the mains after were fantastic. We will definitely be coming back here again. Parking isn't great here so look to get a bus or walk if you can. The toilets are up stairs, a little tired but they are clean.

site_logo

James Marchant . 2021-09-06

MORE AT Google

Great experience in the restaurant - tasty food, reasonably priced. Really friendly, attentive service. Came for a Birthday which they made such an effort to make special. Will definitely be back.

site_logo

Lucy C . 2021-08-25

MORE AT TripAdvisor

We visited here for a special birthday occasion and they made us feel very welcome (birthday banners and special pudding with a candle!) The food was delicious and all brought out together! Waiters were really attentive and friendly! It was a lush evening - can’t fault them.

site_logo

G3572DUdan . 2021-08-13

MORE AT TripAdvisor

Agree with the other reviews posted here- we ordered a takeaway and the food was extremely bland. My partners salt and pepper chicken was just regular fried chicken, my sweet and sour was tasteless, I probably could have made a more flavourful one myself! Very disappointing as I love Thai food because of its strong flavours, and this didn't have much flavour at all. Save your money and cook yourself!

site_logo

Paige Tracey . 2021-08-08

MORE AT Google

Lovely restaurant and staff. Food was excellent. Really good menu.

site_logo

Barbara Davies . 2021-08-05

MORE AT Google

Situated right on the waterfront, this restaurant offers an extensive menu, including sufficient, tasty vegetarian choices. The veg tempura contained a variety of vegetables in a light and crispy batter and the veg & tofu red curry was delicious. Great service, too, but I did visit at a quiet time, so I've no idea what service and quality are like when the place gets busy.

site_logo

Anke Jacobs . 2021-08-05

MORE AT Google

The food is authentic,the oneri very friendly,good service,not cheap!Had a great evening with my friends.

site_logo

Ariande Chaitun . 2021-07-28

MORE AT Google

Just had a very unpleasant takeaway, no flavour and exceptionally greasy. Mushroom toast was soaked in oil, food didn't taste fresh.I don't usually give bad reviews but I wouldn't order from here again.

site_logo

Lucia May . 2021-07-18

MORE AT Google

Excellent food and lovely people - you'll be well looked after....

site_logo

Phil Walker . 2021-07-15

MORE AT Google

Delicious green thai curry would recommend!

site_logo

Shina Sarwar . 2021-07-12

MORE AT Google

Ordered from this place yesterday and paid for prawn version of two dishes paying £4 extra just to have those prawns and in total I got 4 tiny prawns in my soup and 4 tiny prawns in the noodles - an amazing £0.50 for per shrimp. In addition, the worst Tom Kha soup - it had no veggies in it whatsoever, just the mushrooms galore and 4 tiny prawns. I do not recommend this Thai. Never had anything worse.

site_logo

Antonina T . 2021-07-04

MORE AT TripAdvisor

Food was pretty good. Staff very friendly but a little over attentive. Still enjoyed it though

site_logo

Samantha Gaylor . 2021-07-01

MORE AT Google

Amazing food and the staff are lovely. Its mine and the mrs special treat place.

site_logo

Mike Atkins . 2021-06-27

MORE AT Google

We went for a birthday meal and we were the only people in the restaurant! I guess it was a Thursday. The food was excellent and great portioned sizes. The service was also very good and consistent. I found the price quite high but I don't usually eat out at Thai restaurants so don't have much to compare it to. Will be visiting again!

site_logo

Caitlin L . 2021-06-21

MORE AT TripAdvisor

Really lovely food, great service and friendly staff.

site_logo

Jon Norris . 2021-06-19

MORE AT Google

Lovely restaurant. Staff were friendly, attentive and couldn't do more for you. The food was delicious, and reasonably priced. Worth a visit!

site_logo

Peter Bedford . 2021-05-31

MORE AT Google

A fantastic takeaway that kept us going during the pandemic! I highly recommend the shared platter, the dumplings and the chicken satay. The sweet and sour dish and the pad thai is also delicious!

site_logo

Mhairi . 2021-05-30

MORE AT Google

Amazing food, really lovely service. We popped in for a quiet Tuesday night dinner and the staff were lovely. Shared three starters and three mains with two friends and it was incredible! Can't wait to get back there

site_logo

Ellie Taylor . 2021-05-25

MORE AT Google

Fantastic food, reasonable price, great service and friendly staff. Would definitely dine here again.

site_logo

peterabedford . 2021-05-24

MORE AT TripAdvisor

Amazing food and ambience. Friendly service. A bit out of the way so you may not pass it but highly recommend. We had mixed platter starter which was delicious.

site_logo

richardmQ139XY . 2021-05-23

MORE AT TripAdvisor

Similary restaurants in South West

restaurant_img
3.9

455 Opinions

location-iconGloucester Road
Thai
outdoor_seating_84821takeaway_84821delivery_84821

perfect authentic food and fast service, quite cramped as it is small but that’s okay. i recommend the laksa noodles.

restaurant_img
3.9

247 Opinions

location-icon269 Two Mile Hill Rd, Bristol
Thai
outdoor_seating_124476takeaway_124476delivery_124476

We went here to celebrate my daughter’s 14th birthday. This is a place we have always over the past 20 years visited frequently. I don’t usually like to write bad reviews but I wouldn’t want anyone to fall short like we did. The food is average. All the poppadoms were stale. They did replace some with fresh ones once we asked. My prawns on my starter were very tough, chewy and overcooked. A few of us weren’t drinking alcohol but soft drinks were very limited! The whole experience felt like they were trying to get as much money out of us as they could. We were on the Tuesday banquet night which actually turns out more expensive!! When the bill came. It was a mess (I wonder why!) we couldn’t make head or tail of it. When we worked out our drinks bill they had stuck an extra £28.50 on!! Plus any extras they decided to put on for poppadoms and pickle trays. If you do decide to go here please keep your full awareness on what you consume. We will not be returning or recommending

restaurant_img
4.3

360 Opinions

location-icon100 West St
Thai
outdoor_seating_96029takeaway_96029delivery_96029

Brilliant food, excellent service and great price ! Very impressed . Would come back.

restaurant_img
4.3

2122 Opinions

location-icon34 Princess Victoria Street
Thai
outdoor_seating_184700takeaway_184700delivery_184700

It’s delicious, the tom yum goong is rich, spicy and delicious! The atmosphere is comfortable too.

restaurant_img
4.3

461 Opinions

location-icon226 Kingsway, St George,
Thai
outdoor_seating_129508takeaway_129508delivery_129508

Highly recommended very good quality food