Based on 1.581 opinions finded in 3 websites
Based on 1.581 opinions finded in 3 websites
Opinions
Me and my family go in here quite a lot ,sometimes for food , sometimes just for hot drinks, sometimes for both , really cheap and easy to order ,also have table service
Lee Gray . 2024-04-06
MORE AT Google
Your usual spoons, food pretty quick compared to service sometimes bur suppose depends how many is working
Billy Bezel . 2024-03-03
MORE AT Google
Night out spoiled by bar staff that forget why they are there.
Lawrence Reid . 2024-02-19
MORE AT Google
4 star for drink prices. This chain don't rip you off. Good logic lower prices bigger footfall through their pubs.! 👍 Gordon Darroch Inverkip Greenock
GORDON DARROCH . 2024-02-17
MORE AT Google
I haven't ate here in years and years! But I have seen peoples meals, and they look gross tbh. I've seen their recent menu's which states the calories in each. You won't find one meal which is low in calories. When i asked for healthy foods, they suggested the Vegan menu - what you have to be Vegan to be healthy now? (I don't think so!). I heard a man asking for brown breaded toast, the barmaid said they only do white bread. So i defo wouldn't be going here if you're wanting a healthy meal, or your on a diet etc. As for cleanliness, the toilets are really awful in afternoons/especially evenings/weekends. Some toilet blockages 🤢 And i've seen way too many not cleaned tables whenever i was there. I was keeping an eye on one table, when he left. that table didnt get cleaned at all for the whole time i was there, with bf. So they really need to up their cleaning, and defo change/more variety of meals on their menu's please. The pub itself should be refurbished, as this carpet is old and mould on one table near front doors - it wreaked of mould. I think this is because of the drain outside, on wall, is leaking through to inside on wall in pub. Good idea to sort that out.
Lass from Greenock . 2024-02-07
MORE AT Google
Very slow service waited 15mins to be served
John Welsh . 2024-02-03
MORE AT Google
Very nice late lunch, good service bar was very tidy tables being cleared regularly.
aj . 2024-01-22
MORE AT Google
Steak cooked to perfection and cheap as chips, it's my favourite January destination, though I pop in for beers as well from time to time.
david gray . 2024-01-18
MORE AT Google
Perfect place loved every minute fabolous staff great good food well done ⭐⭐⭐⭐⭐
Lisa Boni . 2024-01-16
MORE AT Google
Very busy but customer friendly staff.good ale varietys.again mobbed tonight 6/1/23
Steve Patrick . 2024-01-06
MORE AT Google
We often eat lunch at Wetherspoons in different towns. The beer is good, there's a wide choice of food, there's no hassle. But this week - the beer was good, the food came quickly - the chips were good, the peas were good. But the main items - my steak & kidney pie, partner's fish - were both horrible. The fish, dried up. The pastry on the pie, hard like it had been heated in a microwave for 10 minutes. We were cold and starving and we ate them. Yes I know, we should have made a fuss, carried them back to the serving hatch. Given them a chance to put it right. Asked for replacements (would you trust the replacements?) Asked for a refund. All that was too hard.
inhorto . 2023-12-15
MORE AT TripAdvisor
Warm and welcoming, great choice of beers, I.P.A'S and wine. Fantastic meal deals which include a drink (alcoholic or non alcoholic).. The fish and chips are delicious...as are the halloumi chips and chicken strips burger. Staff friendly and work very hard with a smile on their faces. Excellent.
Traveler164387 . 2023-11-03
MORE AT TripAdvisor
The best place spent in Greenock, but unfortunately this place doesn't always clean and food quality is so-so.
Artūras Jankauskas . 2023-10-26
MORE AT Google
Spoons #144 and what a building, great character Good service and nice pudding
Wayne Gammon . 2023-10-01
MORE AT Google
While visiting the James Watt in Greenock, a customer on the day complained that I had said something Racist which is obviously criminal , well the Manager at the time Amanda came and asked Me to leave. I as there had been a report of racism made against Me, Me flabbergasted in public humiliation asked, I asked Amanda a manager what have I said that's racist?. Amanda said I don't know, I said that's criminal an accusation of Criminality and asking Me to leave after publicly humiliating Me, with no explanation and No Idea of what I had allegedly said The Manager asked Me to leave. In fact Amanda had been told 2 minutes before and acted with reckless disregard for My own reputation and gross misconduct in her managerial position, clearly lacking any evidence but acting on hearsay alone, I have shamefully treated and been called a racist with no evidence. I will likely take a civil action and complain in house head office. While going back to discuss her Statement made in front of other customers that I said something Racist and wanting to know what I said?, She said we are not dealing with that now we are dealing with My Facebook posts in which I had mentioned My understandible grievances at being called a criminal racist in public, well Amanda the manager said We are not dealing with that now you're not being barred for an unsubstantiated NO PROOF accusation I'm baring you for your Facebook posts mentioning My name Amanda it's on public view on her name badge, so clearly too n the public domain, as there can be no expectations of privacy in public by anyone. Shamed with no proof in public and barred for sharing public information in the public domain. Amanda has made a serious mistake and is fully liable for her conduct that has negative affected My life and reputation, I have no criminal record and it's a defamatory and a false accusation.
Alexander B . 2023-09-11
MORE AT TripAdvisor
Historical building and good local beer. Yeah life is good .
Saltwater Taffy . 2023-07-12
MORE AT Google
Was nice place to go for coffee after a family funeral. Plenty of room for us to sit together.
cat early . 2023-06-11
MORE AT Google
First time in the Jimmy in years probably my last on arriving bar staff were unwelcoming friend asked for a can of diet coke told they didn't do it then pointed to what they had on the draft didn't tell use they had Pepsi in bottles... Sat in the beer garden was there for over 2 hours for tables not to be cleaned friend said to one of the staff to be told they had no room inside to put the dirty glasses... When leaving went to the bar to have a shot and boy had poured 2 n a half of them and went to look for another bottle.. took bout 10 mins friend commented to another friend about the service only for a staff member to confront her and say how busy they had been pub wasn't particularly busy seen it alot busier... majority was all young staff members who were all standing about at the end of the bar staff members attitude was shocking so we walked out overall terrible experience
Gillian K . 2023-05-27
MORE AT TripAdvisor
Very nice place in centre of Greenock, the bar man was still learning but we kept him right. Served up a nice meal that we all enjoyed. Credit to Greenock, has a lot of history on the walls.
Ross 'Honest man' Mccreadie . 2023-05-27
MORE AT Google
Absolutely no shortage of seating in this massive wetherspoon, it even has quite a large beer garden, on the plus side is the toilets are on the ground floor which is quite unusual for wetherspoon public houses, we both found the staff helpful and attentive, can get busy at times.
M7729KAmichaelo . 2023-03-24
MORE AT TripAdvisor
A wonderful establishment for a pre match drink!
J stephenson . 2023-02-16
MORE AT Google
Great pub, brilliant breakfast and free coffee free fills. The pub was clean service good and has a local history in the old part of town. Highly recommended
Andrew Rogers . 2023-01-25
MORE AT Google
Every time I go in there's tables needing cleared. Once the customer leaves, plates etc sit there for an hour or more.
sambL6845WQ . 2022-12-07
MORE AT TripAdvisor
Very nice was there for a coffee mmm nice enjoyed it very much 😋 I've been quite a lot over the years since you guys moved in cool to sit chat with friends and chat even if it's not having a few pints witch I have lol
HUGH BROWN . 2022-12-01
MORE AT Google
Not been since before pandemic except for once a few months ago. It was very disappointing both food and sticky table. However we went again last week and a big improvement. I actually spoke to the staff and it's a new Manager and it's much better. Food especially. Me and friends used to meet up for supper every 4 to 6 weeks. You can have a chat ,( can actually hear what's being said), something to eat and a glass of wine and exceptionally reasonable. Change of Manager has made a difference. We all miss the young female Manager who is now at Braehead. She was terrific!
Elizabeth Rodger . 2022-11-14
MORE AT Google
Huge classic Wetherspoons. Very cheap. Reasonable food. Hard to fault
thefirstcut . 2022-10-05
MORE AT Google
Situated in a nice locale. Impressive building.
John McCardle . 2022-09-28
MORE AT Google
We visited at 6.15. Disappointingly there was no Sauvignon Blanc left and I got the last bottle of sparkling water. Meals were very enjoyable and reasonably priced. The staff were courteous and efficient. Toilets were modern and clean.
Giovanniscozia . 2022-09-24
MORE AT TripAdvisor
Ordered using the app for the first time here, and service was super quick. Great location just on the edge of Greenock town centre.
Scott Hughes . 2022-09-18
MORE AT Google
What you might expect from a Wetherspoons pub, but an essential for Greenock. Converted from the old main post office, a large, spacious interior making use of a building that might otherwise be redundant or even pulled down. Wetherspoons prices, so £1.49 for Belhaven Best and several other reasonably priced beers. Importantly, as far as I know, this is the only real ale pub in the town and worth supporting for that reason alone.
Geoff Green . 2022-08-30
MORE AT Google
Pretty affordable place, lot of space. Great meal deal, howerver the quality of food could have been just a bit better, e.g. adding some herbs and spices isn't that expensive... yes I'm talking about you skinny chicken burger 🍔 😋
Sundancekid Tash . 2022-08-17
MORE AT Google
Cheap and basic place. Bar was stinking of stale bear morning pub at 5pm which is strange but staff where friendly and as per all Weatherspoons no drinkers very well catered for cheaply.
Chef Adrian Magnano . 2022-08-10
MORE AT Google
Massive place had a few drinks in the lovely beer garden will be back.
Carole LArkin . 2022-08-02
MORE AT Google
Staff friendly enough and food ok but the tables could be cleared quicker. There were empty plates on the table next to us for about half an hour after the customers had left.
sambL6845WQ . 2022-07-26
MORE AT TripAdvisor
This place is in need of some serious attention to decor and staff for that matter. Went in 10.30am Sunday morning for a breakfast. Probably around 5 customers there so not busy by any means. I order 2 scottish breakfasts and 2 coffees. The coffee machine had no milk in it and the filter hadn't been changed so coffee was virtually cold. Breakfast came and was 100% food that had been lying on a not so very hot plate as you could taste and again look warm. As per protocol noone came to ask how things were or had even cleaned the table beforehand as still sticky from Probably the evening before. If you can eat a breakfast anywhere I strongly suggest you do so.
Aaron Mcbryde . 2022-07-17
MORE AT Google
If only they would do music but alas it's a decent pub, needs more staff at times
Daniel Watson . 2022-06-23
MORE AT Google
Toller Pub mit gutem und preiswerten Essen.
Sabine Eck . 2022-05-29
MORE AT Google
Nice pint of Punk IPA, relaxing atmosphere .
Robert Halliday . 2022-05-04
MORE AT Google
We got followed into the bathroom because we were gay. They accused us of doing drugs because we shared a cubicle. When we said we were happy to be searched they said they couldn’t search us and the security refused to display his license. When asked where their policy is displayed about toilets they claimed it was ripped down earlier that day but not to worry as we were not “barred” when challenged why they let illegal activity of drugs going on outside That security was made aware of why they allowed them to stay but why were kicking us out because we were gay they kept repeating it was policy and that it was not displayed to take it up with security but the bouncer was gay so it was not homophobia. Shocking how it was handled.
nr959 . 2022-04-16
MORE AT TripAdvisor
If I go out for a drink I need: plenty of choice; good prices; somewhere not too busy but a comfortable atmosphere; no argument's; friendly helpful staff and of course someone with me to share all this♥️. I just love Wetherspoons pubs. Some people get hung up on the owner and his politics blah de blah. Well done the James Watt from a past resident to this town
Ciderman . 2022-04-06
MORE AT Google
Well impressed great value for money food nice and big enough to relax in eould definitely recommend we went pre theatre
Katy MacDonald . 2022-03-21
MORE AT Google
No fuss pub grub. Cheap and cheerful with friendly, helpful staff
Georgie Wilson . 2022-03-19
MORE AT Google
This was our place of choice for many a meal but we wont be returning. The last twice that we have visited for breakfast there have been no sausages and the last time no eggs! Unbelievable for a Wetherspoons and we've been visiting various ones since the brand was launched. It is also freezing cold inside and I know Covid "experts" advise opening the doors but no heating? I don't think so.
Tourerbycar . 2022-02-27
MORE AT TripAdvisor
Average food, can be a bit tough and go here, steak varies as does breakfast, Yesterday we a breakfast with a lot of cold items also cold toast
Cra Kins . 2022-02-20
MORE AT Google
Superb, great staff, great value food and drinks
robert odonnell . 2022-01-17
MORE AT Google
Staff are friendly and efficient, and have done all they can to make it safe with social distancing etc. Good food and the variety and quality of beer pints is great.
Andrew Webster . 2022-01-03
MORE AT Google
Great prices, great service thanks Jimmy Watt!
Geo K . 2021-12-13
MORE AT Google
Unbelievable a company this big refuse to call emergency heating engineer while place is frozen all day Sunday
John Skalley . 2021-11-15
MORE AT Google
Had a few drinks in here. Nice big pub. Witherspoon so you know what you get. Food and drink. Staff are nice even when there so busy.
Vee Fitzy . 2021-10-28
MORE AT Google
I visited on a Wednesday about 5pm/6pm and it was very quiet with no more than ten people in there. No complaints from me I was quite happy sat on my own with a drink. Clean and big, close to the train station and lots of room to sit. Maybe it would have been busier later on or at a weekend. As always I got served at the bar becasue it is a whole lot quicker than the app
TheCount69 . 2021-10-20
MORE AT TripAdvisor
Service at the bar was good but no one clearing and cleaning tables for about 1 hour after we arrived. Reinforcements came in later and cleaned up. Toilets were clean Friendly staff. Would we go again. Of course
John Aston . 2021-10-10
MORE AT Google
Good services, friendly staff, expected quality food. Only 1 hot drink machine in use (possibly due to Covid), but slot machines all in use beside each other? Also, no pizza cutters/ pre-cut pizza? Given stake knives instead? 😂
Lillie Cooke . 2021-09-09
MORE AT Google
Not my cup of tea ok if your just wanting one drink
carol mcdonald . 2021-08-15
MORE AT Google
Very impressive interior. Called in for early morning breakfast. Both the regular breakfast and eggs bennedict cooked to perfection.
colin galbraith . 2021-08-09
MORE AT Google
Clean. Staff great. Always busy . Had to wait for meal but it was worth it .
Starfire Mclees . 2021-07-31
MORE AT Google
Everything was nice except the steak, asked for medium rare, was very rare and couldn't cut through it. Brownie was nice.
karen graham . 2021-07-17
MORE AT Google
Staff was helpful but problems with their app for ordering food & drinks
Peter Jamieson . 2021-06-22
MORE AT Google
Always ask for receipt for food ect they have overcharged my card 3 time's in 18mth
David Hill . 2021-06-16
MORE AT Google
Paid a visit to the James watt in Greenock sorry but I have to say the table service in the place is diabolical sat waiting for someone to come and take my order 25minuits later no show I wouldn't mind but the place was quiet sorry no excuse Sorry won't be back
kennethgY9159NR . 2021-06-08
MORE AT TripAdvisor
Great for real ale selection food not to bad good beer Garden
Senga Heron . 2021-05-31
MORE AT Google
I was in before the previous lockdown, this past December with my dearest husband and daughters. The service was quite frankly unacceptable! The majority of staff were not pulling up customers about face masks. This impacts my family because my husband suffers severely from a respiratory illness. The food was cold and there was even a small piece of plastic in the Mac and cheese, as if it had just been dumped on a plate from the microwave! The member of staff serving us was a man with longer hair, (looked like a form of manager) and was unapologetic about the whole situation. Which makes my family and I hesitant to return. Wouldn’t definitely not recommend!
Susan_79h . 2021-05-30
MORE AT TripAdvisor
Food overcooked on mixed grill Haggis and neeps dry could do with butter on side for mash. Lovely staff Great location and Building very clean
Maria Gligan . 2021-05-18
MORE AT Google
Probably mostly used by locals, this former post office is massive, appears to be clean, found staff to be pleasant and helpful, toilets were at ground floor level which is always a bonus, decor is tasteful to the buildings age 1899, it even has a fairly large beer garden for those sunnier greenock days.
M7729KAmichaelo . 2020-10-04
MORE AT TripAdvisor
The service was unacceptabe the food was cold the order were in complete we waited over 20 minutes for the drink that were supposed to arrive with the food .
Jo Hudson . 2020-09-02
MORE AT Google
Great food and app is really easy to use
alien lyall . 2020-08-30
MORE AT Google
We have often visited the James Watt. We go there for the food and it is normally good value for money. Our last visit on 24/8/20 showed the IT system struggling under the strain of COVID. At the first attempt the app responded with 'not available - order at bar! Staff were very helpful to provide 'work arounds' but it is not fair on them and it is disappointing for customers. Black coffee was available on the app but latte etc were out of stock - the waiters said they knew about it and we got what we wanted. We ordered two steaks both 'medium' but when they arrived the edges were black and crispy. The chicken and ribs were ok. We had a long wait for the food to arrive (35 minutes) and guessing by the steaks, someone forgot they were quietly being incinerated. The place was not very busy - less than 50% full and many just drinking. We will return tonight as we feel entertaining friends at home is not so great an idea at present.
stevehG8337JE . 2020-08-25
MORE AT TripAdvisor
It is cheap and cheerful Staffin general are chirpy and clhelpfu bar a few lazy ones
Catherine McDonald . 2020-08-21
MORE AT Google
Due to COVID prices all 50% off with free drinks on selected meals. Really big old pub with lots of olde worlde charm. Much better than many Wetherspoons we have visited in other towns and cities. Food was very enjoyable and drinks were cold and refreshing. Table service vis app was prompt and efficient. All staff very friendly and accommodating. Very safe environment, very busy environment for a Tuesday afternoon.
Saintnumberone . 2020-08-05
MORE AT TripAdvisor
Sehr gemütlich und tolle Auswahl an Getränken. Gute günstige Speisen. Tolle Atmosphäre.
Ralf Wehrhahn . 2020-03-12
MORE AT Google
Any staff member that manages to put up with the kind of drunken degenerates that inhabit a Wetherspoons pub all day every day with literally 0 awareness or shame of how pathetic and irritating they are, deserves a five star rating. Bravo.
Jamie's Music . 2020-03-08
MORE AT Google
Another nice building as nearly all wetherspoons are, pleasant Caledonian burger, the haggis staple I can't get in England so took advantage and a pint from the wonderful Orkney brewery, generally the sort of experience you expect from a wetherspoons wherever you go
chris pickard . 2020-02-21
MORE AT Google
Good staff . Great place to go before and after Morton matches
Crawford Black . 2020-01-29
MORE AT Google
Quick service and typical bar food. Great selection,and many offers available,also small portions which are ideal for smaller appetites. Busy but quick service and friendly staff.
Morag C . 2020-01-26
MORE AT TripAdvisor
not been at greenock for years lovely pub and setting and the drinks and food were well priced nice building and history well worth visiting again!
jeffrey r . 2020-01-24
MORE AT TripAdvisor
Good place to have a beer and food with friends cheap and cheerful
Raymond . 2020-01-18
MORE AT Google
Went here today with 9 of my friends, we all ordered drinks and food which were all good but what really lets this place down are it’s toilets they were disgusting, to put it bluntly they were covered in excrement and the smell would turn your stomach and not just in the ladies, obviously the staff don’t check them on a regular basis
Susan L . 2020-01-16
MORE AT TripAdvisor
Excellent staff. Just dropped in for a morning coffee . Nic bar layout and areas are clean.
Victor Nelson . 2020-01-13
MORE AT Google
It's a friendly place & staff are very friendly
Jim Mcgreachan . 2019-11-25
MORE AT Google
Been here twice now, good choice of real ale, ciders and lagers. Food is decent for the price, staff are attentive and friendly. All round nice place for a bite and a beer.
beni320 . 2019-11-23
MORE AT TripAdvisor
Easy going local dining with no hassles or fuss. Good food, good drinks, good times!
C.J. Lindstrom . 2019-11-12
MORE AT Google
My son was out with a few friends and was refused service for being too drunk. He was not drunk he has mild cerebral palsy and even after his friend explained this he was still refused service. Very poor customer service and we as a family will never again go back.
jacobooboo . 2019-11-08
MORE AT TripAdvisor
On my last visit to my home town I went back in after it had some bad press I found it to be clean and staff helpful even when it was packed with locals on a Friday and Saturday night well worth the time to visit and I would have no problem using it again even better if your on your way to watch Greenock Morton play orasthey say in these parts the the Ton
Dobybee24 . 2019-11-06
MORE AT TripAdvisor
Good pint and near the train station worth a visit...
Mark Harding . 2019-10-29
MORE AT Google
Formerly used as an post office, with this absolutely massive pub/restaurant is worth a visit when in the area, the decor is very fitting with this 1899 building, toilets are unusually on the level and not upstairs, it has a beer garden for the warmer west coast days, probably mostly a locals type of Wetherspoon's, with men playing dominoes in the corner, staff were pleasant and obliging.
M7729KAmichaelo . 2019-10-28
MORE AT TripAdvisor
My favourite cocktail bar and the foods not bad either.
Helen Blair . 2019-10-17
MORE AT Google
Went in for breakfast ordered the eggs Benedict really looking forward too it well what a shame Plate came first thing we noticed missing the rocket.... one egg cook ok a bit runny the second well over done muffin was cold ham was straight out the fridge making the sauce cold and eggs cold extremely disappointing..... best part of the mean was the tea cause we made it our selfs
JordanL299 . 2019-09-12
MORE AT TripAdvisor
Great place to get a traditional Scottish breakfast. Service is nice & friendly, relaxed environment & centrally located in Greenock
elynch213 . 2019-09-08
MORE AT TripAdvisor
My partner and I went here for a late Sunday lunch
Mathew W . 2019-09-08
MORE AT TripAdvisor
This is a great pub coupled with the Weatherspoons brand of reasonable pricing for both food and drink. The building architecture is attractive and it’s well located in the centre of Greenock. Highly recommended.
mikesierra . 2019-08-14
MORE AT TripAdvisor
If you are looking for a cheap drink with a sticky table then this is your place . I have been to many wetherspoons from Aberdeen, glasgow , Dumfries, london , liverpool , blackpool etc etc . This Wetherspoon is the ultimate low point of them all . The food on offer is horrific, it is by far the dirtiest , disorganised place I have ever been in . Management are only there by name of position as the woman I spoke to clearly didn't have a clue about the hospitality trade as a whole . I know it is greenock but c'mon wetherspoons you can do better than what you are doing in greenock . Especially on the food front . As I write this I am sitting in the wetherspoons paddle steamer in largs about 10 mile down the road . Lovely food , lovely ambience and management to be proud of . The manager in question at greenock was Ashley. Horrifying
Relax564056 . 2019-08-10
MORE AT TripAdvisor
This Spoons has a nice feel to it as it has a bit of character to it as an old Post Office. Nonetheless the same as many Wetherspoons with average customer service and interest in my spending my money. Breakfast was Ok they did listen and meet my specific needs.
Nastame . 2019-08-08
MORE AT TripAdvisor
good food children friendly got a beer garden for sunny days relaxing good prices definately recommend it to people out of town
RWSABC . 2019-07-03
MORE AT TripAdvisor
For an Englishman on his first visit to Scotland what could have been better than to try the traditional Scottish dish, haggis at a very reasonable price.
bill999rta . 2019-06-17
MORE AT TripAdvisor
Great prices pleasant efficient service, good selection of drinks and great pub grub.
Bill Adair . 2019-06-11
MORE AT Google
food was A1 and it had a good selection of beer and wines the place was clean and tidy staff very friendly
bill l . 2019-06-09
MORE AT TripAdvisor
We walked from our ship to Greenock’s James Watts Pub after receiving a recommendation from someone nice at the port information booth and excellent directions from a local resident. We ordered a couple lagers from a brewery in nearby Glasgow, spicy chicken wings and a hot bowl of broccoli cheese soup. The place was beautiful. It had stained glass, old fashioned chandeliers an ancient wooden bar and a mellow afternoon crowd.
KD4ML . 2019-05-09
MORE AT TripAdvisor
I visited the James Watt recently with friends for a casual lunch date the food was fine the staff were nice service was quick and prices were good
janice w . 2019-05-07
MORE AT TripAdvisor
Came here with family as like all Witherspoon's never a enough staff and dirty tables would probably not go back.
munrokatie273 . 2019-04-23
MORE AT TripAdvisor
We came here one morning it was lovely I really like to come back here it was early we came about 9:00 am great staff 👍😊
KJoeSnow . 2019-04-16
MORE AT TripAdvisor
This pub used to be great and we ate in here a lot but haven’t been in for a long while due to poor past experiences. Decided to give it another go as we wanted a quick lunch. It was very busy inside on a Saturday lunch time. A number of tables were reserved so didn’t feel we could sit in those. Others had balloons in the chairs but no reservation so no idea what was going on there. Tried to sit at one table that had a number of empty pint glasses on but the chairs were filthy and stained. The table was wet and had lumps of sticky substances on. Tried to find another table. Sadly, the only other place was the “balloon area” which was totally empty except for a few blokes on one table. The smell up there was toe curdling so we left. Never again will we be back. Disgusting!
Sandancer77 . 2019-03-10
MORE AT TripAdvisor
These schedules may not be completely accurate on special days. Please always confirm with the restaurant
Similary restaurants in Glasgow and Surrounding
3 Opinions
Solely disappointing food along with rather unsatisfactory hygiene standards. Went here today with my partner for the first time - To start of our experience at Sally's we were pretty unenthusiastic a
steakssteakoldcurrycoffeeeggssaladcheesepaychickenham271 Opinions
Hospital food would have been better! Macaroni cheese was over cooked and left a chalky residue in your mouth. The chips that accompanied it were luke warm. The coffee was not very good tasting for th
steakssteakoldcurrycoffeeeggssaladcheesepaychickenham568 Opinions
Went for breakfast on a Friday morning. Place was very busy and lots of tables Wii dirty plates. Went to sit on high stools tables to by told by a staff member “before you make yourselves comfortable
steakssteakoldcurrycoffeeeggssaladcheesepaychickenham57 Opinions
We have visited this establishment regularly, now called Carriages But on 2 recent visitss were very disappointed. We had dinner, nothing exciting but one of us had a pasta dish and requested parm
steakssteakoldcurrycoffeeeggssaladcheesepaychickenham668 Opinions
Had a lovely meal at the waterwheel. I went for the carvery, had the beef, a little bit chucky in parts but overall tasty and the veg was great. Husband and son both had the cowboy burgers which they
steakssteakoldcurrycoffeeeggssaladcheesepaychickenham