GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
3,5

Based on 1.581 opinions finded in 3 websites

4.0Ambience3.5Cuisine4.0Price4.0Service
site_photo4

Nº 145 in 200 in Inverclyde

Nº 21 of 26 British in Inverclyde

CUSTOMERS TALK ABOUT DISHES WITH.. steakssteakoldcurrycoffeeeggssaladcheesepaychickenhamtomatocookedfishpotato

comment_iconOpinions

Me and my family go in here quite a lot ,sometimes for food , sometimes just for hot drinks, sometimes for both , really cheap and easy to order ,also have table service

site_logo

Lee Gray . 2024-04-06

MORE AT Google

Your usual spoons, food pretty quick compared to service sometimes bur suppose depends how many is working

site_logo

Billy Bezel . 2024-03-03

MORE AT Google

Night out spoiled by bar staff that forget why they are there.

site_logo

Lawrence Reid . 2024-02-19

MORE AT Google

4 star for drink prices. This chain don't rip you off. Good logic lower prices bigger footfall through their pubs.! 👍 Gordon Darroch Inverkip Greenock

site_logo

GORDON DARROCH . 2024-02-17

MORE AT Google

I haven't ate here in years and years! But I have seen peoples meals, and they look gross tbh. I've seen their recent menu's which states the calories in each. You won't find one meal which is low in calories. When i asked for healthy foods, they suggested the Vegan menu - what you have to be Vegan to be healthy now? (I don't think so!). I heard a man asking for brown breaded toast, the barmaid said they only do white bread. So i defo wouldn't be going here if you're wanting a healthy meal, or your on a diet etc. As for cleanliness, the toilets are really awful in afternoons/especially evenings/weekends. Some toilet blockages 🤢 And i've seen way too many not cleaned tables whenever i was there. I was keeping an eye on one table, when he left. that table didnt get cleaned at all for the whole time i was there, with bf. So they really need to up their cleaning, and defo change/more variety of meals on their menu's please. The pub itself should be refurbished, as this carpet is old and mould on one table near front doors - it wreaked of mould. I think this is because of the drain outside, on wall, is leaking through to inside on wall in pub. Good idea to sort that out.

site_logo

Lass from Greenock . 2024-02-07

MORE AT Google

Very slow service waited 15mins to be served

site_logo

John Welsh . 2024-02-03

MORE AT Google

Very nice late lunch, good service bar was very tidy tables being cleared regularly.

site_logo

aj . 2024-01-22

MORE AT Google

Steak cooked to perfection and cheap as chips, it's my favourite January destination, though I pop in for beers as well from time to time.

site_logo

david gray . 2024-01-18

MORE AT Google

Perfect place loved every minute fabolous staff great good food well done ⭐⭐⭐⭐⭐

site_logo

Lisa Boni . 2024-01-16

MORE AT Google

Very busy but customer friendly staff.good ale varietys.again mobbed tonight 6/1/23

site_logo

Steve Patrick . 2024-01-06

MORE AT Google

We often eat lunch at Wetherspoons in different towns. The beer is good, there's a wide choice of food, there's no hassle. But this week - the beer was good, the food came quickly - the chips were good, the peas were good. But the main items - my steak & kidney pie, partner's fish - were both horrible. The fish, dried up. The pastry on the pie, hard like it had been heated in a microwave for 10 minutes. We were cold and starving and we ate them. Yes I know, we should have made a fuss, carried them back to the serving hatch. Given them a chance to put it right. Asked for replacements (would you trust the replacements?) Asked for a refund. All that was too hard.

site_logo

inhorto . 2023-12-15

MORE AT TripAdvisor

Warm and welcoming, great choice of beers, I.P.A'S and wine. Fantastic meal deals which include a drink (alcoholic or non alcoholic).. The fish and chips are delicious...as are the halloumi chips and chicken strips burger. Staff friendly and work very hard with a smile on their faces. Excellent.

site_logo

Traveler164387 . 2023-11-03

MORE AT TripAdvisor

The best place spent in Greenock, but unfortunately this place doesn't always clean and food quality is so-so.

site_logo

Artūras Jankauskas . 2023-10-26

MORE AT Google

Spoons #144 and what a building, great character Good service and nice pudding

site_logo

Wayne Gammon . 2023-10-01

MORE AT Google

While visiting the James Watt in Greenock, a customer on the day complained that I had said something Racist which is obviously criminal , well the Manager at the time Amanda came and asked Me to leave. I as there had been a report of racism made against Me, Me flabbergasted in public humiliation asked, I asked Amanda a manager what have I said that's racist?. Amanda said I don't know, I said that's criminal an accusation of Criminality and asking Me to leave after publicly humiliating Me, with no explanation and No Idea of what I had allegedly said The Manager asked Me to leave. In fact Amanda had been told 2 minutes before and acted with reckless disregard for My own reputation and gross misconduct in her managerial position, clearly lacking any evidence but acting on hearsay alone, I have shamefully treated and been called a racist with no evidence. I will likely take a civil action and complain in house head office. While going back to discuss her Statement made in front of other customers that I said something Racist and wanting to know what I said?, She said we are not dealing with that now we are dealing with My Facebook posts in which I had mentioned My understandible grievances at being called a criminal racist in public, well Amanda the manager said We are not dealing with that now you're not being barred for an unsubstantiated NO PROOF accusation I'm baring you for your Facebook posts mentioning My name Amanda it's on public view on her name badge, so clearly too n the public domain, as there can be no expectations of privacy in public by anyone. Shamed with no proof in public and barred for sharing public information in the public domain. Amanda has made a serious mistake and is fully liable for her conduct that has negative affected My life and reputation, I have no criminal record and it's a defamatory and a false accusation.

site_logo

Alexander B . 2023-09-11

MORE AT TripAdvisor

Historical building and good local beer. Yeah life is good .

site_logo

Saltwater Taffy . 2023-07-12

MORE AT Google

Was nice place to go for coffee after a family funeral. Plenty of room for us to sit together.

site_logo

cat early . 2023-06-11

MORE AT Google

First time in the Jimmy in years probably my last on arriving bar staff were unwelcoming friend asked for a can of diet coke told they didn't do it then pointed to what they had on the draft didn't tell use they had Pepsi in bottles... Sat in the beer garden was there for over 2 hours for tables not to be cleaned friend said to one of the staff to be told they had no room inside to put the dirty glasses... When leaving went to the bar to have a shot and boy had poured 2 n a half of them and went to look for another bottle.. took bout 10 mins friend commented to another friend about the service only for a staff member to confront her and say how busy they had been pub wasn't particularly busy seen it alot busier... majority was all young staff members who were all standing about at the end of the bar staff members attitude was shocking so we walked out overall terrible experience

site_logo

Gillian K . 2023-05-27

MORE AT TripAdvisor

Very nice place in centre of Greenock, the bar man was still learning but we kept him right. Served up a nice meal that we all enjoyed. Credit to Greenock, has a lot of history on the walls.

site_logo

Ross 'Honest man' Mccreadie . 2023-05-27

MORE AT Google

Absolutely no shortage of seating in this massive wetherspoon, it even has quite a large beer garden, on the plus side is the toilets are on the ground floor which is quite unusual for wetherspoon public houses, we both found the staff helpful and attentive, can get busy at times.

site_logo

M7729KAmichaelo . 2023-03-24

MORE AT TripAdvisor

A wonderful establishment for a pre match drink!

site_logo

J stephenson . 2023-02-16

MORE AT Google

Great pub, brilliant breakfast and free coffee free fills. The pub was clean service good and has a local history in the old part of town. Highly recommended

site_logo

Andrew Rogers . 2023-01-25

MORE AT Google

Every time I go in there's tables needing cleared. Once the customer leaves, plates etc sit there for an hour or more.

site_logo

sambL6845WQ . 2022-12-07

MORE AT TripAdvisor

Very nice was there for a coffee mmm nice enjoyed it very much 😋 I've been quite a lot over the years since you guys moved in cool to sit chat with friends and chat even if it's not having a few pints witch I have lol

site_logo

HUGH BROWN . 2022-12-01

MORE AT Google

Not been since before pandemic except for once a few months ago. It was very disappointing both food and sticky table. However we went again last week and a big improvement. I actually spoke to the staff and it's a new Manager and it's much better. Food especially. Me and friends used to meet up for supper every 4 to 6 weeks. You can have a chat ,( can actually hear what's being said), something to eat and a glass of wine and exceptionally reasonable. Change of Manager has made a difference. We all miss the young female Manager who is now at Braehead. She was terrific!

site_logo

Elizabeth Rodger . 2022-11-14

MORE AT Google

Huge classic Wetherspoons. Very cheap. Reasonable food. Hard to fault

site_logo

thefirstcut . 2022-10-05

MORE AT Google

Situated in a nice locale. Impressive building.

site_logo

John McCardle . 2022-09-28

MORE AT Google

We visited at 6.15. Disappointingly there was no Sauvignon Blanc left and I got the last bottle of sparkling water. Meals were very enjoyable and reasonably priced. The staff were courteous and efficient. Toilets were modern and clean.

site_logo

Giovanniscozia . 2022-09-24

MORE AT TripAdvisor

Ordered using the app for the first time here, and service was super quick. Great location just on the edge of Greenock town centre.

site_logo

Scott Hughes . 2022-09-18

MORE AT Google

What you might expect from a Wetherspoons pub, but an essential for Greenock. Converted from the old main post office, a large, spacious interior making use of a building that might otherwise be redundant or even pulled down. Wetherspoons prices, so £1.49 for Belhaven Best and several other reasonably priced beers. Importantly, as far as I know, this is the only real ale pub in the town and worth supporting for that reason alone.

site_logo

Geoff Green . 2022-08-30

MORE AT Google

Pretty affordable place, lot of space. Great meal deal, howerver the quality of food could have been just a bit better, e.g. adding some herbs and spices isn't that expensive... yes I'm talking about you skinny chicken burger 🍔 😋

site_logo

Sundancekid Tash . 2022-08-17

MORE AT Google

Cheap and basic place. Bar was stinking of stale bear morning pub at 5pm which is strange but staff where friendly and as per all Weatherspoons no drinkers very well catered for cheaply.

site_logo

Chef Adrian Magnano . 2022-08-10

MORE AT Google

Massive place had a few drinks in the lovely beer garden will be back.

site_logo

Carole LArkin . 2022-08-02

MORE AT Google

Staff friendly enough and food ok but the tables could be cleared quicker. There were empty plates on the table next to us for about half an hour after the customers had left.

site_logo

sambL6845WQ . 2022-07-26

MORE AT TripAdvisor

This place is in need of some serious attention to decor and staff for that matter. Went in 10.30am Sunday morning for a breakfast. Probably around 5 customers there so not busy by any means. I order 2 scottish breakfasts and 2 coffees. The coffee machine had no milk in it and the filter hadn't been changed so coffee was virtually cold. Breakfast came and was 100% food that had been lying on a not so very hot plate as you could taste and again look warm. As per protocol noone came to ask how things were or had even cleaned the table beforehand as still sticky from Probably the evening before. If you can eat a breakfast anywhere I strongly suggest you do so.

site_logo

Aaron Mcbryde . 2022-07-17

MORE AT Google

If only they would do music but alas it's a decent pub, needs more staff at times

site_logo

Daniel Watson . 2022-06-23

MORE AT Google

Toller Pub mit gutem und preiswerten Essen.

site_logo

Sabine Eck . 2022-05-29

MORE AT Google

Nice pint of Punk IPA, relaxing atmosphere .

site_logo

Robert Halliday . 2022-05-04

MORE AT Google

We got followed into the bathroom because we were gay. They accused us of doing drugs because we shared a cubicle. When we said we were happy to be searched they said they couldn’t search us and the security refused to display his license. When asked where their policy is displayed about toilets they claimed it was ripped down earlier that day but not to worry as we were not “barred” when challenged why they let illegal activity of drugs going on outside That security was made aware of why they allowed them to stay but why were kicking us out because we were gay they kept repeating it was policy and that it was not displayed to take it up with security but the bouncer was gay so it was not homophobia. Shocking how it was handled.

site_logo

nr959 . 2022-04-16

MORE AT TripAdvisor

If I go out for a drink I need: plenty of choice; good prices; somewhere not too busy but a comfortable atmosphere; no argument's; friendly helpful staff and of course someone with me to share all this♥️. I just love Wetherspoons pubs. Some people get hung up on the owner and his politics blah de blah. Well done the James Watt from a past resident to this town

site_logo

Ciderman . 2022-04-06

MORE AT Google

Well impressed great value for money food nice and big enough to relax in eould definitely recommend we went pre theatre

site_logo

Katy MacDonald . 2022-03-21

MORE AT Google

No fuss pub grub. Cheap and cheerful with friendly, helpful staff

site_logo

Georgie Wilson . 2022-03-19

MORE AT Google

This was our place of choice for many a meal but we wont be returning. The last twice that we have visited for breakfast there have been no sausages and the last time no eggs! Unbelievable for a Wetherspoons and we've been visiting various ones since the brand was launched. It is also freezing cold inside and I know Covid "experts" advise opening the doors but no heating? I don't think so.

site_logo

Tourerbycar . 2022-02-27

MORE AT TripAdvisor

Average food, can be a bit tough and go here, steak varies as does breakfast, Yesterday we a breakfast with a lot of cold items also cold toast

site_logo

Cra Kins . 2022-02-20

MORE AT Google

Superb, great staff, great value food and drinks

site_logo

robert odonnell . 2022-01-17

MORE AT Google

Staff are friendly and efficient, and have done all they can to make it safe with social distancing etc. Good food and the variety and quality of beer pints is great.

site_logo

Andrew Webster . 2022-01-03

MORE AT Google

Great prices, great service thanks Jimmy Watt!

site_logo

Geo K . 2021-12-13

MORE AT Google

Unbelievable a company this big refuse to call emergency heating engineer while place is frozen all day Sunday

site_logo

John Skalley . 2021-11-15

MORE AT Google

Had a few drinks in here. Nice big pub. Witherspoon so you know what you get. Food and drink. Staff are nice even when there so busy.

site_logo

Vee Fitzy . 2021-10-28

MORE AT Google

I visited on a Wednesday about 5pm/6pm and it was very quiet with no more than ten people in there. No complaints from me I was quite happy sat on my own with a drink. Clean and big, close to the train station and lots of room to sit. Maybe it would have been busier later on or at a weekend. As always I got served at the bar becasue it is a whole lot quicker than the app

site_logo

TheCount69 . 2021-10-20

MORE AT TripAdvisor

Service at the bar was good but no one clearing and cleaning tables for about 1 hour after we arrived. Reinforcements came in later and cleaned up. Toilets were clean Friendly staff. Would we go again. Of course

site_logo

John Aston . 2021-10-10

MORE AT Google

Good services, friendly staff, expected quality food. Only 1 hot drink machine in use (possibly due to Covid), but slot machines all in use beside each other? Also, no pizza cutters/ pre-cut pizza? Given stake knives instead? 😂

site_logo

Lillie Cooke . 2021-09-09

MORE AT Google

Not my cup of tea ok if your just wanting one drink

site_logo

carol mcdonald . 2021-08-15

MORE AT Google

Very impressive interior. Called in for early morning breakfast. Both the regular breakfast and eggs bennedict cooked to perfection.

site_logo

colin galbraith . 2021-08-09

MORE AT Google

Clean. Staff great. Always busy . Had to wait for meal but it was worth it .

site_logo

Starfire Mclees . 2021-07-31

MORE AT Google

Everything was nice except the steak, asked for medium rare, was very rare and couldn't cut through it. Brownie was nice.

site_logo

karen graham . 2021-07-17

MORE AT Google

Staff was helpful but problems with their app for ordering food & drinks

site_logo

Peter Jamieson . 2021-06-22

MORE AT Google

Always ask for receipt for food ect they have overcharged my card 3 time's in 18mth

site_logo

David Hill . 2021-06-16

MORE AT Google

Paid a visit to the James watt in Greenock sorry but I have to say the table service in the place is diabolical sat waiting for someone to come and take my order 25minuits later no show I wouldn't mind but the place was quiet sorry no excuse Sorry won't be back

site_logo

kennethgY9159NR . 2021-06-08

MORE AT TripAdvisor

Great for real ale selection food not to bad good beer Garden

site_logo

Senga Heron . 2021-05-31

MORE AT Google

I was in before the previous lockdown, this past December with my dearest husband and daughters. The service was quite frankly unacceptable! The majority of staff were not pulling up customers about face masks. This impacts my family because my husband suffers severely from a respiratory illness. The food was cold and there was even a small piece of plastic in the Mac and cheese, as if it had just been dumped on a plate from the microwave! The member of staff serving us was a man with longer hair, (looked like a form of manager) and was unapologetic about the whole situation. Which makes my family and I hesitant to return. Wouldn’t definitely not recommend!

site_logo

Susan_79h . 2021-05-30

MORE AT TripAdvisor

Food overcooked on mixed grill Haggis and neeps dry could do with butter on side for mash. Lovely staff Great location and Building very clean

site_logo

Maria Gligan . 2021-05-18

MORE AT Google

Probably mostly used by locals, this former post office is massive, appears to be clean, found staff to be pleasant and helpful, toilets were at ground floor level which is always a bonus, decor is tasteful to the buildings age 1899, it even has a fairly large beer garden for those sunnier greenock days.

site_logo

M7729KAmichaelo . 2020-10-04

MORE AT TripAdvisor

The service was unacceptabe the food was cold the order were in complete we waited over 20 minutes for the drink that were supposed to arrive with the food .

site_logo

Jo Hudson . 2020-09-02

MORE AT Google

Great food and app is really easy to use

site_logo

alien lyall . 2020-08-30

MORE AT Google

We have often visited the James Watt. We go there for the food and it is normally good value for money. Our last visit on 24/8/20 showed the IT system struggling under the strain of COVID. At the first attempt the app responded with 'not available - order at bar! Staff were very helpful to provide 'work arounds' but it is not fair on them and it is disappointing for customers. Black coffee was available on the app but latte etc were out of stock - the waiters said they knew about it and we got what we wanted. We ordered two steaks both 'medium' but when they arrived the edges were black and crispy. The chicken and ribs were ok. We had a long wait for the food to arrive (35 minutes) and guessing by the steaks, someone forgot they were quietly being incinerated. The place was not very busy - less than 50% full and many just drinking. We will return tonight as we feel entertaining friends at home is not so great an idea at present.

site_logo

stevehG8337JE . 2020-08-25

MORE AT TripAdvisor

It is cheap and cheerful Staffin general are chirpy and clhelpfu bar a few lazy ones

site_logo

Catherine McDonald . 2020-08-21

MORE AT Google

Due to COVID prices all 50% off with free drinks on selected meals. Really big old pub with lots of olde worlde charm. Much better than many Wetherspoons we have visited in other towns and cities. Food was very enjoyable and drinks were cold and refreshing. Table service vis app was prompt and efficient. All staff very friendly and accommodating. Very safe environment, very busy environment for a Tuesday afternoon.

site_logo

Saintnumberone . 2020-08-05

MORE AT TripAdvisor

Sehr gemütlich und tolle Auswahl an Getränken. Gute günstige Speisen. Tolle Atmosphäre.

site_logo

Ralf Wehrhahn . 2020-03-12

MORE AT Google

Any staff member that manages to put up with the kind of drunken degenerates that inhabit a Wetherspoons pub all day every day with literally 0 awareness or shame of how pathetic and irritating they are, deserves a five star rating. Bravo.

site_logo

Jamie's Music . 2020-03-08

MORE AT Google

Another nice building as nearly all wetherspoons are, pleasant Caledonian burger, the haggis staple I can't get in England so took advantage and a pint from the wonderful Orkney brewery, generally the sort of experience you expect from a wetherspoons wherever you go

site_logo

chris pickard . 2020-02-21

MORE AT Google

Good staff . Great place to go before and after Morton matches

site_logo

Crawford Black . 2020-01-29

MORE AT Google

Quick service and typical bar food. Great selection,and many offers available,also small portions which are ideal for smaller appetites. Busy but quick service and friendly staff.

site_logo

Morag C . 2020-01-26

MORE AT TripAdvisor

not been at greenock for years lovely pub and setting and the drinks and food were well priced nice building and history well worth visiting again!

site_logo

jeffrey r . 2020-01-24

MORE AT TripAdvisor

Good place to have a beer and food with friends cheap and cheerful

site_logo

Raymond . 2020-01-18

MORE AT Google

Went here today with 9 of my friends, we all ordered drinks and food which were all good but what really lets this place down are it’s toilets they were disgusting, to put it bluntly they were covered in excrement and the smell would turn your stomach and not just in the ladies, obviously the staff don’t check them on a regular basis

site_logo

Susan L . 2020-01-16

MORE AT TripAdvisor

Excellent staff. Just dropped in for a morning coffee . Nic bar layout and areas are clean.

site_logo

Victor Nelson . 2020-01-13

MORE AT Google

It's a friendly place & staff are very friendly

site_logo

Jim Mcgreachan . 2019-11-25

MORE AT Google

Been here twice now, good choice of real ale, ciders and lagers. Food is decent for the price, staff are attentive and friendly. All round nice place for a bite and a beer.

site_logo

beni320 . 2019-11-23

MORE AT TripAdvisor

Easy going local dining with no hassles or fuss. Good food, good drinks, good times!

site_logo

C.J. Lindstrom . 2019-11-12

MORE AT Google

My son was out with a few friends and was refused service for being too drunk. He was not drunk he has mild cerebral palsy and even after his friend explained this he was still refused service. Very poor customer service and we as a family will never again go back.

site_logo

jacobooboo . 2019-11-08

MORE AT TripAdvisor

On my last visit to my home town I went back in after it had some bad press I found it to be clean and staff helpful even when it was packed with locals on a Friday and Saturday night well worth the time to visit and I would have no problem using it again even better if your on your way to watch Greenock Morton play orasthey say in these parts the the Ton

site_logo

Dobybee24 . 2019-11-06

MORE AT TripAdvisor

Good pint and near the train station worth a visit...

site_logo

Mark Harding . 2019-10-29

MORE AT Google

Formerly used as an post office, with this absolutely massive pub/restaurant is worth a visit when in the area, the decor is very fitting with this 1899 building, toilets are unusually on the level and not upstairs, it has a beer garden for the warmer west coast days, probably mostly a locals type of Wetherspoon's, with men playing dominoes in the corner, staff were pleasant and obliging.

site_logo

M7729KAmichaelo . 2019-10-28

MORE AT TripAdvisor

My favourite cocktail bar and the foods not bad either.

site_logo

Helen Blair . 2019-10-17

MORE AT Google

Went in for breakfast ordered the eggs Benedict really looking forward too it well what a shame Plate came first thing we noticed missing the rocket.... one egg cook ok a bit runny the second well over done muffin was cold ham was straight out the fridge making the sauce cold and eggs cold extremely disappointing..... best part of the mean was the tea cause we made it our selfs

site_logo

JordanL299 . 2019-09-12

MORE AT TripAdvisor

Great place to get a traditional Scottish breakfast. Service is nice & friendly, relaxed environment & centrally located in Greenock

site_logo

elynch213 . 2019-09-08

MORE AT TripAdvisor

My partner and I went here for a late Sunday lunch

site_logo

Mathew W . 2019-09-08

MORE AT TripAdvisor

This is a great pub coupled with the Weatherspoons brand of reasonable pricing for both food and drink. The building architecture is attractive and it’s well located in the centre of Greenock. Highly recommended.

site_logo

mikesierra . 2019-08-14

MORE AT TripAdvisor

If you are looking for a cheap drink with a sticky table then this is your place . I have been to many wetherspoons from Aberdeen, glasgow , Dumfries, london , liverpool , blackpool etc etc . This Wetherspoon is the ultimate low point of them all . The food on offer is horrific, it is by far the dirtiest , disorganised place I have ever been in . Management are only there by name of position as the woman I spoke to clearly didn't have a clue about the hospitality trade as a whole . I know it is greenock but c'mon wetherspoons you can do better than what you are doing in greenock . Especially on the food front . As I write this I am sitting in the wetherspoons paddle steamer in largs about 10 mile down the road . Lovely food , lovely ambience and management to be proud of . The manager in question at greenock was Ashley. Horrifying

site_logo

Relax564056 . 2019-08-10

MORE AT TripAdvisor

This Spoons has a nice feel to it as it has a bit of character to it as an old Post Office. Nonetheless the same as many Wetherspoons with average customer service and interest in my spending my money. Breakfast was Ok they did listen and meet my specific needs.

site_logo

Nastame . 2019-08-08

MORE AT TripAdvisor

good food children friendly got a beer garden for sunny days relaxing good prices definately recommend it to people out of town

site_logo

RWSABC . 2019-07-03

MORE AT TripAdvisor

For an Englishman on his first visit to Scotland what could have been better than to try the traditional Scottish dish, haggis at a very reasonable price.

site_logo

bill999rta . 2019-06-17

MORE AT TripAdvisor

Great prices pleasant efficient service, good selection of drinks and great pub grub.

site_logo

Bill Adair . 2019-06-11

MORE AT Google

food was A1 and it had a good selection of beer and wines the place was clean and tidy staff very friendly

site_logo

bill l . 2019-06-09

MORE AT TripAdvisor

We walked from our ship to Greenock’s James Watts Pub after receiving a recommendation from someone nice at the port information booth and excellent directions from a local resident. We ordered a couple lagers from a brewery in nearby Glasgow, spicy chicken wings and a hot bowl of broccoli cheese soup. The place was beautiful. It had stained glass, old fashioned chandeliers an ancient wooden bar and a mellow afternoon crowd.

site_logo

KD4ML . 2019-05-09

MORE AT TripAdvisor

I visited the James Watt recently with friends for a casual lunch date the food was fine the staff were nice service was quick and prices were good

site_logo

janice w . 2019-05-07

MORE AT TripAdvisor

Came here with family as like all Witherspoon's never a enough staff and dirty tables would probably not go back.

site_logo

munrokatie273 . 2019-04-23

MORE AT TripAdvisor

We came here one morning it was lovely I really like to come back here it was early we came about 9:00 am great staff 👍😊

site_logo

KJoeSnow . 2019-04-16

MORE AT TripAdvisor

This pub used to be great and we ate in here a lot but haven’t been in for a long while due to poor past experiences. Decided to give it another go as we wanted a quick lunch. It was very busy inside on a Saturday lunch time. A number of tables were reserved so didn’t feel we could sit in those. Others had balloons in the chairs but no reservation so no idea what was going on there. Tried to sit at one table that had a number of empty pint glasses on but the chairs were filthy and stained. The table was wet and had lumps of sticky substances on. Tried to find another table. Sadly, the only other place was the “balloon area” which was totally empty except for a few blokes on one table. The smell up there was toe curdling so we left. Never again will we be back. Disgusting!

site_logo

Sandancer77 . 2019-03-10

MORE AT TripAdvisor

Similary restaurants in Glasgow and Surrounding

restaurant_img
3,5

3 Opinions

Sally's
location-icon85 Cathcart Street, Greenock PA15 1DE Scotland
British

Solely disappointing food along with rather unsatisfactory hygiene standards. Went here today with my partner for the first time - To start of our experience at Sally's we were pretty unenthusiastic a

steakssteakoldcurrycoffeeeggssaladcheesepaychickenham