GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.3

Based on 1.038 opinions finded in 2 websites

site_photo4

Nº 234 in 739 in Redbridge

CUSTOMERS TALK ABOUT DISHES WITH..noodlessoupmangococonutmustricespicyfriedprawnsaladchickencurrybeautifulpapaya

comment_iconOpinions

We had a table booked for 12.30 on a Saturday, so it was not overly busy, which is why a 4 star for atmosphere. Beautiful decor, clean and modern. The service was fantastic and as it was early and notbthat busy yet, they even gave us a free dish and salad to taste. We ordered starters, main and dessert. The food was amazing and very tasteful. The portion sizes were very good also. Our table ordered and tatsed, the chicken satay, salt and chilli prawns, the prawn pad thai, chicken pad thai, sizzling duck, and rice and the dim sum. It was one of the best pad thai's I have had. The duck was so flavoursome and complemented the pineapple rice. For dessert, we had the tiramisu and mango rice. Would definitely recommend and will be going back.

site_logo

RD . 2025-03-20

MORE AT Google

Really great attention to detail. Top notch service. Food is absolutely gorgeous. Will be returning soon.

site_logo

Emad . 2025-03-16

MORE AT Google

Amazing service and food! We will definitely come back!

site_logo

Ammarah Ahmed . 2025-03-16

MORE AT Google

Yesterday I came back here after 5 years. I met our old friend and now owner, Sohail. He has transformed Thai Imperial completely. The food was amazing. Hot , full of flavour, fresh and generous portions. The sea bass was lovely, and the papaya salad was bursting with flavours. The desserts were simply exquisite, especially the mango sticky fried rice The staff were very polite, welcoming and attentive. The restaurant was packed, no doubt due to the excellent food. We wish Sohail all the success that his hard work has brought. We will be coming back again soon ! Imran

site_logo

Imran . 2025-03-16

MORE AT Google

I had an amazing experience at Thai Imperial this Saturday ! The owner and staff were incredibly welcoming and made us feel right at home. Their hospitality truly stood out and added to the overall dining experience. The food was absolutely delicious—fresh, flavourful, and perfectly balanced with authentic Thai spices. Every dish we tried was a hit! I would recommend to try Chicken Red Curry, Salt and pepper squid and desserts. If you’re looking for great Thai food with outstanding service, this is the place to go but make sure you book in advance as it was fully occupied.Highly recommend!

site_logo

Sadia Sheikh . 2025-03-16

MORE AT Google

Staff and decor were spot on felt proper comfy as soon as we walked in, and the welcome was great. Tried the dumpling for a starter, but it was nothing special lacked flavour and quality. The beef steak, though, was banging! Proper tasty, and the caramelised onions underneath were a nice touch. The green curry didn’t stand out, and the egg fried rice tasted like it had been pre-cooked and was a bit overdone. Price was a bit steep, so I wouldn’t go back, but it’s worth a try if you fancy it.

site_logo

Fahad Khan . 2025-03-08

MORE AT Google

Best Thai food we’ve ever had! Highly recommend trying this place. The blend of Asian fusion with Thai flavors is a solid 10/10. This is our second visit, and the food never disappoints! The staff are incredibly friendly, and the customer service is truly top-notch. Can’t wait to come back again!

site_logo

Ikram . 2025-03-07

MORE AT Google

Excellent service. Very clean and nice setting. Food was great. Chicken satay was excellently cooked but a little sweet for my liking. The chicken penang was spot on. Great taste and perfect level of spice. Would definitely come back again.

site_logo

Laith : The Dental Build & Design by Laith . 2025-03-07

MORE AT Google

Thai Imperial in Gants Hill is a fantastic spot for authentic Thai cuisine. From the moment I walked in, the atmosphere felt warm and inviting, with elegant decor that set the perfect mood for a relaxed meal. The staff were friendly and attentive, making sure everything was just right. The food was the real highlight. The curry dishes were rich and flavorful, with just the right balance of spice and creaminess. But what really stood out for me were the noodles and fried rice—both were absolutely amazing. The noodles had that perfect texture, and the fried rice was packed with flavor, not greasy at all. Overall, it was a great experience, and I’d definitely recommend Thai Imperial to anyone looking for delicious, authentic Thai food in the area. I’ll definitely be coming back for more!

site_logo

Xavier Pereira . 2025-03-04

MORE AT Google

First time had thai food. Great customer service and very lovely food. Definitely worth trying three food.

site_logo

Mudaser Elahi . 2025-03-03

MORE AT Google

Very nice place. Food presentation is impressive. Good value for money

site_logo

Omar Shaikh . 2025-02-28

MORE AT Google

Really authentic Thai food, brilliant service and great atmosphere

site_logo

Morminah Nisa . 2025-02-28

MORE AT Google

Amazing food, amazing service and amazing atmosphere. Such a lovely experience, will definitely be dining here again!

site_logo

Habeeba Hussain . 2025-02-27

MORE AT Google

Lovely place authentic Thai place and very nice decor

site_logo

Natasha K . 2025-02-25

MORE AT Google

We had a wonderful time at Thai imperial and the food was perfect! Would definitely recommend and return. Afreeda our waitress was very kind and friendly and very helpful.

site_logo

Emma Haque . 2025-02-24

MORE AT Google

We had a very good experience and the service was very good.

site_logo

Jamila Begum . 2025-02-22

MORE AT Google

This place is exceptional!! First of all the food is so good! The Tom yum soup and papaya salad are one of the best and the tamarind sea bass! However add to that the most exceptional, kind and generous service! Sohail is the kindest and most thoughtful restaurant owner who having never met us, still made our birthday celebration one to remember! And catered for all the different dietary requirements required by our party! Thank you! Go visit - you will not regret it!

site_logo

Yaseen Sameja . 2025-02-18

MORE AT Google

Starting from good customer service to a tasty and healthy meal ❤️❤️

site_logo

ZAHAM Foods . 2025-02-15

MORE AT Google

The food here was absolutely amazing—exactly what I was craving. Every dish was packed with flavor, fresh, and beautifully presented. The service was just as impressive, with the staff being friendly, attentive, and making sure everything was perfect. I’d definitely recommend starting with the platter—it’s a great way to try a bit of everything. The pad Thai was spot on, with just the right balance of sweetness and tang. The mocktails were a nice surprise too—refreshing, creative, and a great complement to the meal. Overall, a fantastic experience, and I’ll definitely be going back soon!

site_logo

Ibrahim Ahmed . 2025-02-15

MORE AT Google

Suhel the owner is a great host, along with all the staff super attentive. The kind prawn main was delicious and dessert- was the highlight

site_logo

S Ahmed . 2025-02-14

MORE AT Google

Food was delicious and varied. Service was also exceptional and very welcoming. Will definitely visit again. Nice gem in Gants Hill

site_logo

Umar Razzaque . 2025-02-14

MORE AT Google

Went for our anniversary dinner & food very delicious and service was excellent…Thanks

site_logo

Abdullah Sadique . 2025-02-11

MORE AT Google

Can't explain the excellency and the taste of the food... Service is the best part . Staffs were so nice... Faysal and Akib especially the best .... Going to come here regularly

site_logo

Noor Mohammed . 2025-02-11

MORE AT Google

Took the family to Thai Imperial over the weekend and we were given the seats at the back which was the best and very private. The manager/owner was very welcoming as well as the staff. The food we ordered were very nice both presentation and more importantly the taste. Price of items I would say were reasonable so everything was in balance. Every dish we ordered was very good, the highlight was the giant king prawn dish and I personally enjoyed the green Thai curry. Flavours were just right. The mix platter starter was also nice. Mango sticky rice was great. Also to add, one of my son has autism and things can be tricky when it comes to new surroundings and he only eats certain types of food, so the place allowed us to bring food from outside which was greatly appreciated as it helped him to settle and not feel he has nothing to eat. Thank you.

site_logo

Mohammed Wadud . 2025-02-10

MORE AT Google

The food was amazing, so flavoursome and the best presentation! Faysal was amazing in caring for us - had the best service ! Highly recommend the Sticky Mango rice !!

site_logo

Hazera Miah . 2025-02-09

MORE AT Google

Had a great experience at this Thai restaurant! The food was delicious, full of authentic flavors, and perfectly cooked. Faysal, our server, was excellent—friendly, attentive, and made sure we had everything we needed. Highly recommend this place for great food and amazing service.

site_logo

Sarah P . 2025-02-09

MORE AT Google

Loved this place and the food was amazing. Faysal was an amazing server and gave top service, I will be back.

site_logo

Argenti Aliaj . 2025-02-09

MORE AT Google

I visited this restaurant for a girls evening meal out We were a group of 8. I have to say I was very pleasantly surprised. The service was exceptional, every single staff member had a smile and welcoming persona. The food was 10/10 from the mocktails down to the desserts and I haven’t been able to say that for a while! We are not a hard bunch to please but Mr Shuel made sure he went above and beyond to accommodate our demands and alway with a sprinkle of humor! Thank you Thai Imperial for making our girls evening one to remember we will be back for sure 👌🏽 😊

site_logo

Amira Ahmed . 2025-02-09

MORE AT Google

Very good place, but service is abit slow

site_logo

Gopal Rajput . 2025-02-08

MORE AT Google

This place was amazing. The decor is beautiful. The service was really good. Food is spectacular. I will definitely come again.

site_logo

Siddrah . 2025-02-07

MORE AT Google

Very nice restaurant, great decor but the main thing is food and they do not let you down when it comes to the food. Different twists on traditional Thai dishes. Food can be a bit of a wait but from what I sensed it's because everything was made fresh. Didn't taste anything that might have been frozen. The only issue is parking if you're coming earlier than 6PM. They also have a prayer area and ablution area at the back for Ramadan and prayer times. Staff are very attentive and pass by every few moments to check if you need anything. I would recommend booking a table in advance as it can get very busy

site_logo

Tanvir C . 2025-02-03

MORE AT Google

First time dining - great tasting food, lovely decor and vibes for a restaurant in the locality. Wish could have given the 5s had the service stepped up slightly better. Am sure they can only do better

site_logo

Joydeep Das . 2025-01-30

MORE AT Google

Amazing food, amazing service.The owner is a true gentleman. Will back again. Recommended for those who are Thai food lover

site_logo

sadia farzana Chitra . 2025-01-26

MORE AT Google

Arefin and faisal are Really good . They guide us very well.

site_logo

afroj jahan . 2025-01-21

MORE AT Google

It was ok. Food not the best. 😃 Staff was friendly and helpful though

site_logo

Zedd Shae . 2025-01-21

MORE AT Google

The food was amazing here but I have to say, the service was even better. Rathri looked after us from start to finish, and we could see she was also working hard to look after the numerous other diners in attendance. We didn’t see her stop once, and she still had the energy to do it all with a smile on her face. Excellent stuff!

site_logo

Aniqa Ahmed . 2025-01-20

MORE AT Google

Recently visited on a friday night. Food was nice and tasty and service good. Will definitely be going back for more. Doesn’t sell alcohol

site_logo

Dan Saunders . 2025-01-20

MORE AT Google

This is by far my most favourite Thai restaurant in all of UK. By far the best service, hospitality and excellent food. I travel all the way from Scotland to come eat in this restaurant! Thank you so much for having us today!

site_logo

Bismi Rahman . 2025-01-20

MORE AT Google

The food was great, as always, and the service was friendly. It’s easy to see why this place is always so busy!

site_logo

has . 2025-01-18

MORE AT Google

Thank you to Sohail and all the staff at Thai Imperial. We had a lovely evening. Food and hospitality were great as ever. Thank you and see you again soon.

site_logo

Jeremy Burton . 2025-01-18

MORE AT Google

We came for our parents anniversary for dinner and we were highly impressed. The staff were very friendly and kind and the owner himself was very welcoming and made time to speak to us. The food was amazing and there were so many options available - highly recommend the papaya salad and the mango sticky rice. The inside was beautiful and lively and the whole experience was wonderful. We will be coming back again.

site_logo

Zara Mustafiz . 2025-01-17

MORE AT Google

As I had recently been to Thailand, I wanted to taste Thai food, and I must say this was nothing compared to the food there, very overpriced and the jasmine rice was mushy - the starters was the only thing I enjoyed. I wouldn’t recommend it.

site_logo

Shaila Hussain . 2025-01-14

MORE AT Google

The pina colida was very nice and creamy, I definitely recommend trying it. The food was really tasty and just the starters had me delighted. The Stir Fried Black Pepper Beef was hot and tasted like heaven. The staff was also very kind and quick with the food. My family was very happy to eat here. 5 stars. Definitely, Come here with your family to have a great thai dinner.

site_logo

Yes Yes . 2025-01-13

MORE AT Google

Edit. Knocked two stars off this time. The service here is getting worse. Typically any restaurant drinks are served and also waiting staff will take order. For drinks. For some bizarre reasons this is not the case here. Not attentive at all. The staff are just poor and let down the entire experience. They have also changed their bottled soft drinks to syrup based soda. Considering this is a restaurant, I would really expect bottled drinks or bottle dispensed that cheap soda. Original review. 4 stars. A welcome return of this Thai restaurant with new management. Dined in this time. The food is fantastic. Everything we ordered did not disappoint. The ingredients were fresh and of high quality. Standout were the beef dishes, where the beef was succulent and tender. Food is very well presented. Ambience of the restaurant could be improved as the lighting is very bright. Noise also high when busy. Service can also be improved, while not horrendous, it’s just not to the same standard as a professional restaurant with properly trained staff of a quality establishment. It’s so difficult to find a decent halal Thai restaurant, this is one of those decent places where you will enjoy the food very much. Weekends are busy, so booking will be required.

site_logo

Mohammed Islam . 2025-01-12

MORE AT Google

Excellent service, food and atmosphere! All staff were extremely friendly and attentive, especially to my baby making sure me and my partner were able to enjoy the amazing food. Tried some different stuff than my usual, did not disappoint, really enjoyed the imperial pancake and sea bass (pla nueng ma nao) Definitely recommend trying this place out. Looking forward to returning again!

site_logo

Khadija Begum . 2025-01-10

MORE AT Google

Lovely place to try out some Thai food. Service was excellent and the atmosphere was really nice. We got served adequately and in good time. Food was very nice full of Thai flavour.

site_logo

Syed Rashid Abrar . 2025-01-07

MORE AT Google

Easy local parking. Very juice atmosphere inside. Staff are are pleasant and friendly. Food is generally very tasty and have a good menu. Price wise, could be slightly cheaper on some items. Only issue we had was it was very cold whenever the door is opened. This was very often. Spoils the nice meal you’re having. Highly recommend the papaya salad.

site_logo

Tajul Islam . 2025-01-05

MORE AT Google

“Excellent service! Went out with the whole family, and we had a wonderful experience. Afrida was a lovely lady who provided exceptional service. She gave a very clear and helpful explanation of the menu, guiding me perfectly as I was feeling a bit lost with all the choices. Highly recommend this place!”

site_logo

Qaam Iqbal . 2025-01-04

MORE AT Google

I recently dined at Thai Imperial and had an overall pleasant experience. The menu offers a variety of dishes and we were not disappointed with what we ordered with the exception of the mango sorbet which was of very very poor quality. One area that could use improvement is the timing of the service. We experienced a 25-minute wait between our starters and mains, and a similar delay between our mains and desserts. This disrupted the flow of the meal and made the evening feel longer than expected.

site_logo

Shahid Abdur-rahman . 2025-01-04

MORE AT Google

Delicious food and service from Ratri and the team - they are very accommodating especially if someone has allergies

site_logo

coco thomson . 2024-12-31

MORE AT Google

Unfortunately, like many restaurants who impress at the beginning only, this restaurant is no longer what it used to be. I made a reservation 3 hours in advance only to be told they didn't have it and be spoken to quite bluntly by a lead/manager waitress. Luckily there was a table available anyway and the other staff were friendly. I've been here four times before and recommended to others but the food was definitely different. Sauce for weeping tiger had changed and it was chewier and panang curry was almost cold when it arrived. Prices have gone up for sure which is to be expected but wouldn't expect quality to go down. It was Christmas Eve so will try this restaurant once more at a less busy time but disappointed and also not nice to feel like I was the one who had made up a reservation when the person taking it didn't do the job properly.

site_logo

Heena Battiwala . 2024-12-24

MORE AT Google

The restaurant is beautifully decorated, very clean and spacious too. Food was delicious. I finally had the famous Thai sweet sticky rice with mango and it was divine. I would definitely recommend this place to others.

site_logo

Rehana Akhtar . 2024-12-23

MORE AT Google

Great food, great service and Ratri went the extra mile with her service. We’ll be returning soon.

site_logo

Jay Ali . 2024-12-22

MORE AT Google

The nice atmosphere of the restaurant created high expectations. Also, the amazing appearance of the dishes, they looked amazing at first glance. However, the service was a bit rude, saying I could NOT have chicken satai with coconut rice (it was a delicious combination, BTW). My partner had Tom Yum, she liked it, but it was too spicy for her. Chicken satai was good, but both the coconut rice and the sticky rice we had later were tasteless. As the main dish, we had the duck (Chef's speciality), and I didn't like it. The smell was too strong, it look like it was prepared hours before and just warmed up (same with the rice). We ordered jasmine chai, and it came with the main dish after reminding the waiter. It was a disappointing experience tbh.

site_logo

Georgina Rabassó . 2024-12-17

MORE AT Google

I recently visited this Thai restaurant and had an overall enjoyable experience. While some dishes were truly excellent, others didn’t quite hit the mark. Unfortunately, it’s been a while since my visit, so I can’t recall the names of the dishes, but they do have pictures on the menu to guide you. What really stood out was the service—it was impeccable from start to finish. The staff were attentive, friendly, and made the evening feel special. Although I’ve had better Thai food at other places nearby, this spot is still worth a visit if you’re a fan of Thai cuisine. The atmosphere was pleasant, and the food was good enough to make it a decent night out.

site_logo

Shah hussain . 2024-12-12

MORE AT Google

Second time and I loved it again

site_logo

Marvin Paranjothy . 2024-12-06

MORE AT Google

Not very authentic Thai. Pricy.

site_logo

Ja . 2024-12-03

MORE AT Google

Food was fantastic but service was a little slow due to staff shortage. No alcohol but mocktails were nice

site_logo

Martin Kelley . 2024-12-02

MORE AT Google

Went for takeaway and were offered complementary drinks whilst we waited. The place looks brilliant and service impeccable. We would definitely come back properly for dine in next time.

site_logo

Ahsan H . 2024-11-19

MORE AT Google

Large group and still our food and service were excellent.

site_logo

Raiy Noor . 2024-11-10

MORE AT Google

Had a bad experience.My husband been there before with his friends and gave good review.I book a table at 18:00 but unfortunately due to heavy traffic got there at 18:35.As soon as we sat down the staff told us the tables has been booked for a group at 20:00.So we have to vacate the table at 20:00.We were rushed to order quickly and felt oppressed as the waiters were hanging around us looking stressed.At 18:30 the group was already here and I heard the waiter telling one of them and they are waiting for us to finish.I could not eat with people hanging around me and at 19:35 I had to tell them to give me some containers to pack my food and eat at home.Food was mediocre .fried fried was sticky but noodle was nice.Will not go again.

site_logo

Shei . 2024-11-05

MORE AT Google

We reserved a table for 7 people and were served by the best employee ever. Her name was Jinny and she was so friendly and kind and was willing to listen every single one of our order notes. Bless her. Such sweetheart. It was our 5th time and just as usual the food was bussin. We spent about £180 on everything and it was so worth it. Will be coming again😊

site_logo

Ayman Nashra . 2024-11-04

MORE AT Google

Beautiful restaurant with tasty Thai food. Atmosphere and service good too.

site_logo

Farzana Faisal . 2024-11-03

MORE AT Google

The best halal Thai restaurant Very classy and the food is amazing. The imperial pancake desert is my favourite

site_logo

Jewels Passion Detailing . 2024-11-01

MORE AT Google

⭐️⭐️⭐️⭐️⭐️ Authentic Thai Flavours and Amazing Service! I recently had the pleasure of dining at Thai Imperial, and it was a fantastic experience from start to finish. The flavours in every dish were incredible, truly capturing the essence of authentic Thai cuisine. The staff were friendly, attentive, and made us feel right at home. Standout dishes included the papaya salad and beef chilli basil, and the imperial pancakes were the perfect finish to the meal—perfectly balanced and delicious. I highly recommend this place to anyone looking for genuine Thai food in a warm, welcoming atmosphere. I’ll definitely be back soon!

site_logo

Rumon Bai . 2024-11-01

MORE AT Google

Great food. Mind blowing service.

site_logo

mir mahhfujur rahman . 2024-10-29

MORE AT Google

Food was lovely. Service was great too. Enjoyed it very much. My kids liked it too :) and my daughter is hard to please. Thank you thai imperial x

site_logo

Ren Hussain . 2024-10-29

MORE AT Google

Best food in Redbridge highly recommend 👌

site_logo

Sumon Ahmed . 2024-10-27

MORE AT Google

Thai restaurant in Ilford does not serve any alcoholic drinks, not even alcohol free beer! but they do some nice mocktails. Food was plentiful but quite highly spiced for Thai food. Don't expect much change out of £100 for a meal and drinks for 2 the staff were attentive and service was first class. The seating was comfortable but a wee bit cramped for average sized adults in some places. The biggest problem is parking in close proximity but if you come by taxi that isn't an issue

site_logo

Richard Skam . 2024-10-20

MORE AT Google

100/100 Came here yesterday to celebrate my friend’s birthday, and the Food was wow. Very authentic Thai food. The flavours were amazing, the staff were so friendly and accommodating. The food came out quickly. Will be back again soon.

site_logo

Christiana A . 2024-10-20

MORE AT Google

We travel an hour and a half to come to this best thai food in London! The food is delicious every time, the service is wonderful. They always remember and make every effort to accommodate. Navi and Jinny especially bring so much warmth and enthusiasm to the experience. We will never go anywhere else for Thai food in London. Exceptional in every way!

site_logo

Shazma Ahmed . 2024-10-19

MORE AT Google

Here’s a refined version of your review for Thai Imperial: Thai Imperial Food: 5/5 The meal started with a delightful complimentary prawn cracker platter, paired with peanut, sweet chili, and chili sauces that perfectly whet the appetite. The food was bursting with flavors, especially the Som Tum (papaya salad), which stood out. The mixed platter starter included dim sum with various dipping sauces, prawn toast, spring rolls, and chicken satay—all cooked to perfection. For the mains, we ordered Pad Thai chicken and curry, both of which were incredibly flavorful and satisfying. Service: 5/5 Miraj provided fantastic service. Though we initially booked a table for 9 and was asked to sit at the front of the restaurant, we preferred something more private, and Miraj kindly accommodated us by seating us toward the back. His attentiveness, along with the rest of the friendly staff, made the experience exceptional, changing plates promptly and ensuring we were well taken care of. Miraj even opened the door for us as we left, adding a personal touch to our wonderful dining experience. Atmosphere: 5/5 The decor was beautiful, with the restaurant maintained to an impeccable standard of cleanliness. Even the restrooms were stylish, adding to the overall appeal.

site_logo

Mubin Ahmed . 2024-10-13

MORE AT Google

The food and service was top notch, it was beautiful, authentic ambient music, Jinny was super nice to us and we will definitely come back in summer to try their mango sticky rice

site_logo

Levai Reka . 2024-10-13

MORE AT Google

Visited in October 2024- lunch time. If you’re craving an authentic Thai experience without hopping on a plane, Thai Imperial in Ilford, East London is your perfect destination! From the moment we stepped through the doors, we were transported into a space that beautifully blends modern elegance with intricate Thai design. The feature walls, gorgeous Thai ornaments, and lush furnishings make this spot a feast for the eyes, even before the food arrives. 🏮🌺 And now, let’s talk about the food—each dish is a true celebration of Thai flavours with a modern twist, thanks to the incredible talent of Chef Tania. We started with the Mixed Starter Platter (for 2), a delicious array of authentic bites paired with rich, flavourful sauces. From the Salt & Chilli Chicken to the perfectly aromatic Imperial Fried Rice (served in a pineapple!), to the Pad Thai (one of the best I’ve ever had!), and the sizzling Gai Yan (grilled chicken packed with fiery, bold flavours)—every dish was a showstopper. 🌶️🍍🍗 To finish, we indulged in two unforgettable desserts: the classic Mango Sticky Rice and the beautifully presented Imperial Pancakes—both a perfect, sweet ending to an incredible meal. 🍰🥭 Whether it’s a date night, a family outing, or a special celebration, Thai Imperial promises an unforgettable dining experience. For anyone in East London, this gem is a must-visit!✨🍴

site_logo

The G6 Guy - theg6guy . 2024-10-10

MORE AT Google

I’ve ordered takeaway from Thai Imperial a few times, and the quality of the food has always been excellent. The dishes are full of flavour. I particularly enjoy their spicy stir-fried rice noodles and nutty tofu. They offer a variety of other options as well; my mother, for example, loves their green curry. The owner and staff are always friendly and accommodating, even when we order takeaway. The restaurant’s ambience is warm and welcoming. Their starters, such as the chicken satay and prawn on toast, are also lovely.

site_logo

Mai An . 2024-10-07

MORE AT Google

We are blessed to have this Thai restuarant within this borough that is yummy and scrumlicious. It is halal, all the options in menu are worth it and the service is incredible. I usually go for takeway/collection and the staffs always welcome us with drinks. By the time we enjoyed and finish our drinks, the foods will be ready. Totally recommend!

site_logo

ItzJammyZz J . 2024-10-07

MORE AT Google

Amazing place with great food and even greater staff. Special thanks to Afrida, Ashiq, Navi and especially Jinny they are soooo great and made the whole dinner that much better.

site_logo

Ben Soobrattee . 2024-10-04

MORE AT Google

Amazing customer service, our waitress Jinny was so lovely and we had a wonderful time. Food was excellent, highly recommend Thai Imperial.

site_logo

Neetu Dakri . 2024-10-02

MORE AT Google

Excellent food and service. Jinny was so friendly and attentive.

site_logo

Samina Mungaye . 2024-10-02

MORE AT Google

Jinny was ever so pleasant. Dedicated to her job and very good customer service. Food was tasty tonite point

site_logo

Seeima Akhtar . 2024-10-01

MORE AT Google

Delicious food and good service

site_logo

Md Afzal H Joni . 2024-09-30

MORE AT Google

Wonderful staff, decoration and food. From the starters to the dessert and drinks (they have mocktails too) - it was delicious. They also care to ask about any allergies (excellent). You can tell the chef is meticulous and exceptionally skilled. The staff are so pleasant, professional and have a great sense of humour. This is a restaurant you simply must visit and you surely will visit multiple times! Brava!

site_logo

D D . 2024-09-28

MORE AT Google

Jinny and Navi were amazing!!! We had an absolutely wonderful time here! We loved the food, the atmosphere and the ambiance. The staff were really welcoming and the prices are really reasonable. I would definitely recommend this restaurant, and I'll 100% come again!!

site_logo

Stephanie . 2024-09-27

MORE AT Google

Delicious food highly recommended

site_logo

Musa Sekeroglu . 2024-09-27

MORE AT Google

Wonderful flavour I had Green curry chicken sadly they were a seven tiny slices of chicken Pad Thai which was delicious It had four prawns. I have not tried the soup yet. It is a pity for the price which is about £10 an item that there isn't reasonable amount of protein. I cannot fault the flavour. I would have given five stars if it had a reasonable amount of protein

site_logo

Estelle Coleena . 2024-09-25

MORE AT Google

We have been quite a few times and went again a few days ago. We always enjoyed the food, atmosphere and especially the mango sticky rice! The Tom Kha soup is also a must have and the papaya salad is good too. Food is good quality, atmosphere is great and service was also good. Only issue is lack of parking outside.

site_logo

Anisa Nomaan . 2024-09-20

MORE AT Google

Nope. This is a below average Halal focussed restaurant like most places in Ilford. Oil laden, sauce heavy dishes that aren't close to what Thai food is like. Nowhere close to Busaba, Thai Square or Rosa.

site_logo

Bhavik Kothari . 2024-09-16

MORE AT Google

Food was average at best. Having been to Thailand, I got to experience authentic real Thai food, and this unfortunately wasn’t anyways near. Just got starters and had to cancel the mains as the flavours were underwhelming. Place is very busy and had to make a reservation ahead of time, worth a one time go. Lamb chops were slightly on the undercooked side and too sweet. Rest were average.

site_logo

Kishor Dharmarajah . 2024-09-14

MORE AT Google

Outstanding service with Authentic Thai taste & huge seating arrangements. 👍

site_logo

Muhammad Arif Reza . 2024-09-13

MORE AT Google

Awesome food with brilliant service. Very nice Thai food.

site_logo

Akm Zakir Hossain . 2024-09-13

MORE AT Google

It’s great to see the restaurant has opened again. We used to be regulars at this restaurant prior to it closing over Covid and today I met Sohel who used to work in the previous restaurant. He now manages Thai imperial and we felt he was very friendly and professional.Thank you

site_logo

Pirushanthy Arunan . 2024-09-11

MORE AT Google

Great staff food and atmosphere

site_logo

Sunita Devi . 2024-09-07

MORE AT Google

Very good quality food, their service is second to none…..honestly can’t fault them on service and the atmosphere is amazing…. Lovely settings and surroundings 10/10

site_logo

H Raja . 2024-09-03

MORE AT Google

Absolutely delicious food and very friendly and attentive staff. It has a lovely little prayer hut in the back as well. I'm definitely coming back. Food was beautifully presented and portion sizes were just right. A lovely dining experience. Thanks.

site_logo

S Hafeez . 2024-09-03

MORE AT Google

It was just perfect, the food, the service, the atmosphere. The food was so delicious we just couldn’t stop eating. It also came really fast. Thank you again. The food was a bit pricey but all in all just great.

site_logo

Caressa Van gastel . 2024-09-01

MORE AT Google

It's a newly refurbished restaurant, decorated to a lovely standard. The food was good; all my dishes had lots of flavour.

site_logo

G . 2024-08-31

MORE AT Google

Thai Imperial in Redbridge offers a vibrant dining experience with authentic Thai flavors. Their extensive menu features all the classics, from pad thai to green curry, along with some unique specialties. The service is friendly and attentive, and the atmosphere is warm and inviting. Whether you're looking for a casual meal or a special occasion, Thai Imperial is a great choice in our neighborhood.

site_logo

SHOHIDUL ISLAM (shohag) . 2024-08-29

MORE AT Google

After a long time found a good Thai halal food. Scrumptious food, lovely environment. And their staff service was outstanding as well.

site_logo

Sadaf Khan . 2024-08-27

MORE AT Google

Outstanding vegan veg food we ordered. Best Thai food ever, totally recommend it. Food was so fresh, absolutely delicious.

site_logo

Asha S . 2024-08-25

MORE AT Google

Not authentic Thai food but was okay to eat. More like South Asian food. Limited choices on meat and seafood. Curries and mains lacked flavour, nothing special. Not worth it for the price. Never go again

site_logo

Kuru Suntharalingam . 2024-08-23

MORE AT Google

Similary restaurants in London

restaurant_img
4.3

121 Opinions

location-icon41 High St, Ilford, IG6 2AD, United Kingdom
outdoor_seating_349237takeaway_349237delivery_349237

far too many chips for one personsomostly wasted. everything else was ok

restaurant_img
4.3

966 Opinions

location-icon2 Greengate Parade Horns Road
Indian
outdoor_seating_237103takeaway_237103delivery_237103

My go-to Indian dining spot and has become a comfort location for me, I have celebrated many of my birthdays here with family and it is a great environment and atmosphere to do so. The food is spectacular, my personal favourites are the mogo chips and egg fried rice. Quick and efficient service and very friendly staff

restaurant_img
4.3

1958 Opinions

location-icon587 Cranbrook Rd, Gants Hill, Ilford IG2 6JZ, United Kingdom
outdoor_seating_354194takeaway_354194delivery_354194

Khadijah was very helpful and funny. The new chicken tenders where amazing

restaurant_img
4.3

3319 Opinions

location-icon219 Cranbrook Rd, Cranbrook, Ilford IG1 4TD, United Kingdom
outdoor_seating_385310takeaway_385310delivery_385310

Loved to have good quality of and helpful staff

restaurant_img
4.3

524 Opinions

location-icon245 Beehive Lane
Fast food
outdoor_seating_183876takeaway_183876delivery_183876

Food was okay. Nothing special. They dont look at notes even if you out them on there properly. Hubby lamb donor was quite dry and no sauces given. Won't be ordering from here again.