GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
3.9

Based on 230 opinions finded in 2 websites

site_photo4

Nº 1354 in 1872 in Brighton and Hove

Nº 27 of 29 Thai in Brighton and Hove

CUSTOMERS TALK ABOUT DISHES WITH..ricecurrynoodlessquidfriedprawncookedcoconutprawnsfishsaladchickenspicyscallops

comment_iconOpinions

We had a takeaway from here last night and the Khao Soi is absolutely amazing! Has lots of cardamom in and so tasty, really impressed by the quality and portion size will definitely be ordering again :)

site_logo

Hannah Doherty . 2025-03-29

MORE AT Google

Unfortunately I won't be ordering again. I was a very regular customer of this restaurant. At least once or twice a week. Food was great but over the last year it has doubled in price and lowered in quality. The final straw was when they forgot to put and item in my delivery (£10+) and after calling the restaurant they said there was nothing they could do and deliveroo wouldn't help either. I explained the situation but they just said there's nothing they could do. To just take money off a regular customer give them nothing for the money and shrug it off seems like a very bad business model. I won't be ordering again as I don't want to take the risk of paying for nothing.

site_logo

Kyri Jones . 2025-01-19

MORE AT Google

I ordered £124 worth of food on new year's eve via deliveroo. Only 5 items from our order were delivered. I phoned the restaurant and whilst they were apologetic, they did not offer to rectify the situation in any way. They said they were "swamped". The food that did arrive was stone cold. They told me on the phone, they would approve a refund for me. Instead I have been offered a £85 credit note (that has to be used within 3 months) to be spent with deliveroo. I am fuming and am having to pursue this as I feel I have been treated appallingly.

site_logo

Aimee Morris . 2025-01-03

MORE AT Google

We get takeaway from here whenever we fancy Thai food. It's always very good, and portion sizes are better than a lot of other Thai restaurants. Staff are always friendly and helpful.

site_logo

Mark Wilson . 2024-10-27

MORE AT Google

The pork larb and pork pad see ew was so amazing. Please keep it up and don't change or cut corners. Whoever cooked our order for deliveroo order tonight, 7th September around 830pm for P.K, please stay consistent and keep up the great work. I'm so happy I found a place that does great larb. Sometimes what I find is some restaurants can be unreliable with certain food orders (saltier or overcooked one day) which was why I decided to try a different thai restaurant, which led me here Update: 5 stars to 4. Ordered drunken noodles and it did not match description of dish made with basil, garlic and chili. Instead it had cauliflower 🤢, tomatoes, beansprouts, red/green/yellow bell pepper, carrots, brocolli, spring onions, yellow onion, purple onion, bean sprouts and parsley and lemon slice. This is not pad kee Mal (drunken noodles), as you can see no basil, garlic, chilli. What the heck? I don't even know what dish this was as I couldn't find it on the menu. It seems like someone just threw this together and didn't think a customer could tell the difference. If so, it's unfortunate because this is a good restaurant and maybe someone new cooked today? Please keep the consistency and quality control. Ordered Friday noon, 27th Sept Update 8th October: this is unfortunately the final and last time I order pad kee Mal. This time it had long green beans, tomatoes and pineapple.

site_logo

A A . 2024-10-09

MORE AT Google

The food here is absolutely delicious. Me and my mum went in randomly once after a yoga class and were pleasantly surprised by how fresh and tasty everything was. Now we make sure to go regularly and always try something different. I couldn’t recommend it enough and there are loads of amazing veggie options too! The staff are also all lovely. I don’t normally leave reviews but this place needs more recognition for how good it is!!

site_logo

Poppy Lichtenberg . 2024-09-11

MORE AT Google

The food is fantastic. Delicious and authentic. However, the service is absolutely diabolical. I have stopped going there as it is so poor. It makes for a very unpleasant atmosphere as you can sense and sometimes hear other diner’s frustrations. The last time my family went we walked out on a quiet afternoon having spent 15 minutes sat waiting to be greeted or offered a drink while a member of staff stood chatting out the front on her phone. It’s a real shame as the food is great. However, until the standards of service improve, it doesn’t really deserve anyone’s custom.

site_logo

Freddie Mills . 2024-09-03

MORE AT Google

Awesome flavor , full of authenticity of Thai taste , can’t recommend enough. Got a taste like from Thailand .

site_logo

Alvan Xu . 2024-07-16

MORE AT Google

The best Thai authentic foods I’ve had so far. Very satisfied with the taste and service🤍 Very recommended.

site_logo

Ngu Shwe Eain . 2024-07-16

MORE AT Google

Great Thai restaurant! The food was so nice, and the hardworking waiter made our experience special.

site_logo

aungnyimoe . 2024-07-16

MORE AT Google

Love all the foods there. Just a bit complicated of menu style . Apart from that best Thai food I’ve had in UK so far as an Asian . 100

site_logo

Thet Htoo Aung . 2024-07-16

MORE AT Google

I ordered them off deliveroo and I was so pleasantly surprised. It's authentic and just so flavourful. I went for the spicy papaya salad and it was so spicy so good I just can't believe I found this place in Brighton. Also they got the BEST tom yum absolutely not a doubt there.

site_logo

R. N. . 2024-06-22

MORE AT Google

Overall, this place is quite a find and definitely the most authentic Thai food I've found in Brighton. It's taken me years to find a Thai curry that wasn't loaded with tons of added sugar. They also have khao soi and other regional dishes that I've not encountered in the UK before. The only downside is I was disappointed to find that my vegan pad kra-prow inexplicably did not have any tofu :( . Just seems odd to have all vegetables and no protein for £10. I'll definitely try some of their other food in the future though.

site_logo

T. N. . 2024-05-14

MORE AT Google

I see all the bad reviews of this place and they sound like a different restaurant to what I just ate. This has to have one of the best takeaways and Thai meals I’ve ever had. And I am not easily impressed. We had the Tom Kha, Pad Thai and Pad Kee-Mal and all were delicious. Perfect spice levels, loads of flavour, fresh yet rich and decadent - just how I like Thai food. Only thing I can think of is that maybe this place is too authentic for some people’s taste? Not sure, but to me it was amazing. Highly recommend.

site_logo

Geoff Fogden . 2024-05-13

MORE AT Google

Absolutely delicious, traditional Thai food. Amazing. Everything we have tried is great.

site_logo

Ian S . 2024-05-10

MORE AT Google

The first real Thai restaurant I have encountered in the UK. Food is divine and the staff are lovely. Can’t wait to come back!

site_logo

Russell Catchpole . 2024-04-28

MORE AT Google

Mistake with order but this was rectified quickly, politely and resent out. Much appreciated! Now delicious as always 😋

site_logo

Emma Stirling . 2024-04-02

MORE AT Google

We are returning customers after several years and this place has kept its momentum food wise simply delicious so well done Sit for keeping it going.

site_logo

luiven rivas-sanchez . 2024-03-02

MORE AT Google

Amazing food. The best tom yum soup in the whole Brighton. The Lamb was phenomenal. So yummy. We had a lovely Valentine family lunch at thai Connection. If love thai, must try here.

site_logo

Loki Ban . 2024-02-16

MORE AT Google

Had a delivery, very nice food ! yum yum !!

site_logo

Mike Mike . 2024-02-13

MORE AT Google

Wonderful food and great atmosphere

site_logo

Kate Eleanor . 2024-02-05

MORE AT Google

Sent one rice instead of two. How hard is it to check the order before you send it out? I’ve given overall three stars because the food was amazing but attention to detail on actually getting the order right is very disappointing on an order value in excess of £50 which is a bit of a treat.

site_logo

Oscar . 2024-01-24

MORE AT Google

Amazing food as always, highly recommend 5 Stars and they are offering 20% off on their own website which means you can order more which you will want to as this food is addictive

site_logo

Rico D . 2024-01-13

MORE AT Google

Fantastic Thai food. There’s loads in Brighton & Hove but this really does trump them all.

site_logo

R R . 2024-01-10

MORE AT Google

Took my wife here for an evening meal and were greeted by a friendly host with a great sense of humour. The menu is immense with so much to choose from. Food portions are generous, and as a spice lover I asked if I could have my food super spicy . The chef was happy to do so, which made us happy customers. Highly recommended 👌 can't wait to return.

site_logo

Markus Heinel . 2024-01-03

MORE AT Google

Very good food and amazing service, severely underrated :)

site_logo

Eliza Robinson . 2023-12-29

MORE AT Google

Amazing food, great service. I can’t recommend this restaurant enough.

site_logo

Alex Hayes . 2023-12-24

MORE AT Google

Absolutely love this restaurant food is amazing..fabulous service

site_logo

Tana Rousell . 2023-12-22

MORE AT Google

Best Thai restaurant in Hove so don’t miss out on trying their awesome food with a big discount of 30% off the whole menu for delivery when you order directly through their website www.thaiconnection.io as this deal won’t be around much longer so grab a Thai feast and enjoy

site_logo

Proper Delivery LTD . 2023-11-11

MORE AT Google

Nice and clean restaurant. The food was good. But we have to wait for little while for the food.

site_logo

Kitty Brighton . 2023-10-12

MORE AT Google

Wow! A new extensive menu with many of our favourites. We had a lovely evening.

site_logo

Cherie DAVIES . 2023-08-14

MORE AT Google

Absolutely stunning. So authentic and consistently amazing

site_logo

raizen696969 . 2023-08-12

MORE AT Google

Really good food, special the red curry

site_logo

Dominik Dakowicz . 2023-08-12

MORE AT Google

Excellent Thai. Maybe only one which reminds me of the food from Thailand.

site_logo

Raivo . 2023-07-07

MORE AT Google

The food here is delicious, we ordered papaya salad, prawns padthai, pad phed talay (seafood), and roti, with two drinks. For Thai people like me and my boyfriend who love Thai food very much. This restaurant makes authentic Thai food. The owner and staff here are friendly and care about customers. The atmosphere in the restaurant and the music made me miss home. I highly recommend this restaurant as the number 1 Thai restaurant on my list.

site_logo

Hathaichanok Phairojthinnakorn . 2023-05-28

MORE AT Google

Been going to Thai Connection and then IM for over ten years but our food this evening was truly revolting. The service was even worse with large gaps between each person's starters arriving and then the same with the mains. My fish was cold by the time my rice arrived. The fish was over cooked and dry. It was so bad that I found it funny until we had to wait 15 mins for the bill. It wasn't even busy. A couple left because no one came to serve them. They did knock my son's curry off the bill as it came 10 mins after my fish but the bill still came to £100. I wouldn't pay half of that for what we were presented with. The waiter (luckily for him) didn't bother to ask how our meal was. I think he probably knew. It has literally left a bad taste in our mouths!!! Incredibly disappointed. Can't see us ever going back again.

site_logo

CrazyLegz-68 . 2019-10-10

MORE AT TripAdvisor

I ordered a takeaway through Deliveroo and it arrived after an hour and 10 mins. My Thai green curry with tofu had chicken in it !!! Not great for a vegetarian and my chicken Khao pad was actually special fried rice with prawns, cashews and pineapple ‍♀️ bit of a disappointment as none of us like prawns or pineapple - 2 dishes were clearly wrong. Very disappointing !!!

site_logo

Paula C . 2019-04-13

MORE AT TripAdvisor

Ordered take away from this place. Phad Thai grey and greasy, my prawns swam in grease. No flavour or flair, save yourself some money and hustle and go elsewhere.

site_logo

Karolina O . 2019-04-04

MORE AT TripAdvisor

It was my first time here since the re-opening as IM Thai street food and I do like the new look. It has a warm and relaxed vibe, and is really welcoming. Fab new menu too, more expansive that I expected. There are the familiar thai faves plus loads more if you fancy trying something different. I took a punt and was extremely pleased - it was delicious. Can't wait to go back for more!

site_logo

Caroline M . 2019-02-23

MORE AT TripAdvisor

Came here when it was Thai Connection and returned now it has reopened as ImThai. We were very impressed at the transformation. There is a new menu of Thai street food and all our choices were absolutely delicious and very fresh, with lovely complex flavours compared to our home stir fries. We asked the waiter for recommendations and they were just right for us. Two of us are vegans and it was great to have so many vegan options. Good value too.

site_logo

LuckyTheRescueDog . 2019-01-02

MORE AT TripAdvisor

Totally new menu, and a complete makeover; now called 'Im Thai'. Really good Thai street food, loads of vegan options. I had a fab spicy tofu dish on the waiter's recommendation. Thoroughly recommended!

site_logo

U6850GOkeiths . 2019-01-02

MORE AT TripAdvisor

My wife, our 4 yr old son, and I came for an early dinner. Service was prompt and the food was excellent. My wife’s tofu curry had two pieces of tofu in it, but it didn’t bother her, as the food was excellent.Come her if you love Thai food. They also deliver!

site_logo

GrandTour813250 . 2018-12-22

MORE AT TripAdvisor

Rather cramped space downstairs. Wc upstairs. Lunch time deal for £8.95. Tasted fine. Would go back. On interesting Blatchington Rd in Hove. Can’t comment about the evening menu.

site_logo

jillianarb . 2018-11-20

MORE AT TripAdvisor

Excellent service, very tasty, good value, comfortable restaurant that’s relaxed and not too hectic. My favourite choice in Hove for Thai

site_logo

JCONNO007 . 2018-07-22

MORE AT TripAdvisor

We ordered a takeaway via dinner2go and I have to say that the food was so disappointing- we paid £30 for a selection of starters that were not as good as you can get in the frozen section in the supermarket. The menu said that the mixed starters were the chefs selection and they really were quite tasteless- I’m not even sure what was in the spring rolls or ‘prawn toasts’. Not only was the food tasteless it was also the smallest portions and expensive. We really will never order from here again and will certainly never eat in. We’re also still hungry

site_logo

sallywilki . 2018-06-29

MORE AT TripAdvisor

Had expected better but having looked at the other reviews seems we should have been prepared for a long wait. The food is OK - not large portions whcih I think ivo the prices should be bigger. It's the poor customer service and slow delivery of food. Two waiters for 5 or 6 covers tonight yet we spent 2 hours for our meal.If you are in a hurry AVOID

site_logo

d1023sdf . 2018-04-10

MORE AT TripAdvisor

We went on a Thursday. The restaurant only had 2 other customers, and needed a little more heating. The food was really good and served quickly. Good value foe money & tasty.

site_logo

David B . 2018-02-09

MORE AT TripAdvisor

Real Thai food, always fresh and prepared to order, so might have to wait . Staff very friendly, Good value meals

site_logo

Sylviane C . 2018-01-09

MORE AT TripAdvisor

Me and my partner have been to Thai Connection numerous times. The food has never let us down, however the customer service can be quite slow which is a shame (they are still very nice it can just take a while to get anything!). Because of this we tend to get a takeaway. Either way the food is so good I just had to give it 5 stars. Highly recommend the Tord Kra'Tiem

site_logo

sophies133 . 2017-12-02

MORE AT TripAdvisor

We came on Fri 8 Sep17, at 9.15 pm. A choice of tables to pick from, so I started to worry. There was absolutely no need, good was fabulously tasty, fresh and service was great.

site_logo

GusMcC_12 . 2017-09-08

MORE AT TripAdvisor

A nice atmosphere; the decor is a little rustic yet quaint and satisfying. Food was excellent, it was tasty and arrived promptly. Service was attentive. £25 for 2 - wonderful!

site_logo

Hughes93 . 2017-08-30

MORE AT TripAdvisor

We have eaten and had takeaways on many occasion from Thai Connection but our most recent experience leaves us a little sad with how things were.

site_logo

BwanaSam . 2017-08-15

MORE AT TripAdvisor

Food was at reasonable prices and got a discount using a tastecard the portions was small however the taste and price made up for it. The restaurant was quaint and nice Victorian decor and staff were pleasant.

site_logo

Justin2guys . 2017-04-11

MORE AT TripAdvisor

A sweet little Thai restaurant, lovely waiter and the food felt fresh and lean. I had the noodles with seafood and the squid was perfect. I would definitely go back and eat more.

site_logo

Kate T . 2017-03-22

MORE AT TripAdvisor

A lovely meal with a friend. We both had our favourite- green and red curries Gorgeous! Friendly service. So pleased this is my local Thai

site_logo

Kathy R . 2017-02-13

MORE AT TripAdvisor

No algo esta noche que nunca he hecho antes, salí de un restaurante! El servicio era tan malo-, y después de una hora, llegamos a una mina de arranque - pero nunca se materializó. Una mesa de cuatro, nosotros pedimos después tenía sus bebidas, aperitivos, platos principales y había dejado ante el llegó de arranque!

site_logo

italyfanBrighton . 2017-02-12

MORE AT TripAdvisor

He comido en este restaurante varias veces. El interior está decorado con colores cálidos y estatuas tailandés tradicional, llevando el ambiente tailandés para el Reino Unido. Las mesas y las sillas están hechas de maderas con flores frescas en los floreros diminuto mono además parpadeantes velas creando el moderno y algún tipo de romance a este lugar. El servicio es bueno y los camareros son ya las camareras muy amable y servicial y rápido en asignar mesas a los clientes. El menú aquí es el más largo y más interesante que he tenido oportunidad de ver. Le hará un poco confundido, pero curioso en primera experiencia, pero no te preocupes porque los camareros pueden ayudarle. Algunos platos son las recetas especiales y secreto de conexión tailandesa. Personal de aquí son bastante fluido en inglés y encantados de hablar con usted. Mientras se comportan en forma cortés, el dueño de este restaurante es divertido tener una conversación. Tengo que dar muchas evaluaciones al chef desde su cocina es muy buena. Cuando pida, si es alérgico o tiene algunos requisitos especiales, sólo tienes que contar los camareros y camareras para pasar sus requisitos para el chef y disfrutar la comida cómodamente. La comida se sirve en orden: - plato principal de arranque para garantizar la comida es caliente. Sin embargo, si quieres saltarte el entrante, plato principal puede pedir o exigir que todo se sirve todos juntos. Algunos postres son bastante deliciosos, como banana split en leche de coco caliente o helado frito. Pero agárrese, debe presentarse temprano para tener la oportunidad de probarlas. Hay sillas para bebés, así que puedes llevar a sus niños. Tengo la intención de visitar Conexión Tailandés pronto. Casi me olvide, Gourmet la sociedad y tarjeta de sabor puede ser utilizado en este restaurante en determinados días, el precio muy razonable pero que todavía son muy completos y satisfechos.

site_logo

huongdttcfaa . 2017-01-03

MORE AT TripAdvisor

The reviews below about indifferent and apathetic service are bang on. It is no surprise when the owner (an old soak who just sits in the corner supping wine) doesn't care and even pretends not to be the owner if you want to voice a complaint.

site_logo

HovePunter . 2016-10-21

MORE AT TripAdvisor

The menu is vast. The dishes we chose were very tasty and different, maybe more traditional than in other Thai places I've visited. Service was good just I had to get up go and find waitress to ask for second drink.

site_logo

howardandmoo . 2016-10-19

MORE AT TripAdvisor

I love this place and have eaten there many times. The food is great, freshly prepared and with good fresh ingredients. The service is usually good but if you arrive when there is a big group it can be very slow. They do take away also but not delivery. It's a relaxed environment which is good for couples and small groups.

site_logo

BristolBear . 2016-10-18

MORE AT TripAdvisor

Have used this place several times before, always a nice meal for a meal at home. Efficient service and good food. Staff friendly.

site_logo

thescarletwoman . 2016-10-12

MORE AT TripAdvisor

Being going to this restaurant on and off for 6 years. Food is great, authentic and worth visiting. Service is poor at best and non-existent at worst. With a bit of organisation and management could be great.

site_logo

Scott R . 2016-08-20

MORE AT TripAdvisor

Great traditional Thai food - one of my favourites in Brighton and Hove. Food is always great, staff lovely and great for a low key meal

site_logo

Lolabeachgirl . 2016-08-14

MORE AT TripAdvisor

Great food and they take taste card too. We had a meal there last night and we just love the food and the service.Good environment and it is unhurriedMy wife and I both love the curries and the fish salad (my favourite) and the duck salad(hers) are both excellent

site_logo

Pete J . 2016-07-28

MORE AT TripAdvisor

Short summary of my experience:Waitress attempted to sell a beer not listed on the menu without informing us it was £7.Starter tasted like childrens rice krispies. I ordered mixed grilled seafood and was told 10mins later that they didn't have any. So I ordered butterfly king prawns. 5mins later I was told that they didn't have any. I ordered soup. Friends meal arrives. I order water. I sit and stare until the end of their meal with no soup and no water. Waitress nowhere to be seen for the entirety of the meal- so with every request I had to get up find her and order. Instead of bringing coconut rice - they brought plain rice. Eventually I cancelled my order and requested the bill. Waitress did not bother to come to the table to hand over the bill but rather leaned over from a distance expecting me to reach across my table to get it and scurried away so that we can't speak to her about the experience. Was charged £9 for 5 pieces of little prawns in some sauce.To top it off we now have FOOD POISONING.

site_logo

Yasmin A . 2016-07-24

MORE AT TripAdvisor

Second time I ordered grilled mixed seafood main course here and second time it was served without scallops .Both times I was not told, when I placed my order, that there wouldn't be any scallops with it.I asked to speak to the chef to suggest they either get scallops in and serve them up or change the menu so it doesn't mention scallops in the dish.This must go against advertising standards.Chef did not come to speak with me before I left so I've decided to leave this review instead.Be warned if ordering grilled mixed seafood which is listed as prawns, mussels, scallops and squid you are not likely to have any scallops on your plate.

site_logo

Shane M . 2016-07-16

MORE AT TripAdvisor

Truly awful atmosphere. Edgy over attentive and awkward staff. Meals were Ok but we were served so fast and were in and out within 40mins, someone was constantly stood behind us which made me feel really uncomfortable. Weird place for Hove.

site_logo

PGB711 . 2016-06-27

MORE AT TripAdvisor

Well , what can I say one of the worst eating out experiences I've had in a long time - service is Very poor the food I could cook better myself and after waiting an hour before our food was finally delivered to the table & that was because we had to ask where our food was! The quality of the food was terrible , prawn crackers were damp and soggy ...I must say once more I was far from happy and won't be returning

site_logo

Rob i . 2016-06-24

MORE AT TripAdvisor

We chose badly for the starter, a mixed starter which we more generic Chinese than Thai. Therefore a great surprise was that all the main courses ( we tried three ) were really authentic and tasty: just enough heat but aromatic, and distinctly Thai. A bonus was the friendly service.

site_logo

joetidd . 2016-05-05

MORE AT TripAdvisor

We have dined here on a number of occasions but this time it was horrible. Asked for mixed starter for 3 told only available for 2 or 4. Asked to speak to manager, came back after 10 minutes and agreed to starters for 3. Starters soggy, long delay and after three quarters an hour only 5 king prawns available.(3 main courses prawns ordered.) already cooked we will give you smaller portions. Ask to speak to manager, not available. Walked out.

site_logo

colin w . 2016-03-25

MORE AT TripAdvisor

We have been going there since it opened about 14 years ago.We have always found the food to be absolutely delicious & plenty of it! We went there last Saturday evening with a couple of friends - we have been recommending a visit for ages.. how embarrassing!!We were shown to our table & given menus - however it was at least 20 minutes before anyone appeared to take our drinks order.The waitress was clearly inexperienced but we have no complaints about that - she tried her best & was friendly .The starters for 3 of us arrived in a reasonable time but my boyfriend had to wait an extra 10 minutes for his.These were delicious & plentiful.The main courses were very small & again we had to wait before the rice arrived.We always order the mixed grilled seafood,spicy seafood rice,plain rice & brandy duck.Tiny portions & my duck was just a few fatty lumps -we had to wait for ages after asking for the bill.Not sure if we will be back.ISuch a shame as it is our local.

site_logo

freyjafox . 2016-03-12

MORE AT TripAdvisor

First visit with a group to this restaurant.The staff apologised that they were all new and so were unfamiliar with everything!Our meal took over an hour to appear but when it finally arrived it was delicious and served on hot plates.

site_logo

judyou . 2016-03-07

MORE AT TripAdvisor

Years previously I reviewed this restaurant and had a little moan about the slow service. This visit we arrived at the unusual time of 4pm and again the service was slow even though only one other table was being occupied. Once 5pm arrived extra staff turned up as did further customers. So we were a little unlucky with our timing. All the food was very nice. I usually have the Red Duck Curry - delicious as usual. We all enjoyed the meal and, of course, will be back again.

site_logo

HoveParkCharlie . 2016-03-06

MORE AT TripAdvisor

We visited Thai Connection with a Taste card so got 50% off the food. We had a mixed starter which was lovely, although didn't like the fried crispy sweet noodles, just not to our taste and felt like the sweetness didn't really go with rest of the starters which were very nice.Mains were King prawn dish, had a kick but very good and a beef massamam curry with sticky rice.I would say that overall it was good and the waiting staff were really lovely.I would not say that this is the best Thai restaurant but there was certainly nothing wrong with it.

site_logo

ruthi b . 2016-03-04

MORE AT TripAdvisor

A few years ago this was one of the best Thai restaurants in Hove, but no longer.We went early and there were only 3 other tables occupied. We were seated and given menus but then waited maybe 15 minutes for someone to return to take our drink order. By then we were ready to order our food too. The drinks came within 5 minutes and starter about 5 or 10 minutes after. The main courses took a long time to arrive and were disappointing. Small portions, and not particularly tasty. The green papaya salad was positively bland. The green curry was tasty but watery. The pad thai was equally disappointing. The beef pad prik was ok, but small and short of flavour.After we finished we finally found someone to ask for the bill, and waited ... After 15 minutes still no sign of the bill, so we got up to leave, at which time a piece of paper with a final total arrived, and no itemized list to check. I paid and left.By the time we left the place was packed - I really do not understand it!My impression is that all the serving staff were totally inexperienced and could benefit with some training. There was no sign of a manager or anyone responsible for ensuring people were satisfied. Perhaps the boss or owner should take an interest? I will not be returning for a while.

site_logo

BrightonPhil . 2016-03-04

MORE AT TripAdvisor

It's a shame I have to write this review as last time my meal was nice- but have just eaten with my wife and shocked how different it can be, very watery red Thai curry no proper flavour - wife's just as bad.Real shame as Thai friends recommend this place too- no consistency.

site_logo

Jon006 . 2016-02-05

MORE AT TripAdvisor

I came here for Sunday lunch with a couple of friends, the waiter was pleasant and the food good and reasonably priced. The interior is quite attractive. Would come again.

site_logo

Peter S . 2015-10-31

MORE AT TripAdvisor

Have been eating here for several years , always found the food and service excellent , reasonably priced and a lovely atmosphere

site_logo

steven b . 2015-10-27

MORE AT TripAdvisor

The food was extremely good, extensive menu, very hot and tasty. Pleasant service, just a shame the restaurant was so quiet on a Tuesday evening.

site_logo

mabs . 2015-10-20

MORE AT TripAdvisor

Went for an early evening Sunday dinner, lovely friendly staff & nice decor. Very fresh and authentic food & I had the chicken curry with "secret" ingredients which was delicious, highly recommend! reasonably priced too.

site_logo

Nicky C . 2015-10-04

MORE AT TripAdvisor

Always good food .. Great staff and lovely thai style decor.. parking in the evenings is easier than at lunchtime......

site_logo

jez l . 2015-09-15

MORE AT TripAdvisor

Loved the food and atmosphere in the restaurant. Service was a tiny bit slow but overall a wonderful Thai experience.

site_logo

raccers . 2015-08-08

MORE AT TripAdvisor

LOVE LOVE LOVE this place. Thai healing food at it's best, friends come all the way from london to eat here.

site_logo

iamgogs . 2015-07-31

MORE AT TripAdvisor

We were there with a large group of 12 and because of that we had to wait a bit longer, which is understandable. The flavours are amazing and the food is authentic. Lovely staff and nicely decorated place. I would definitely recommend this place.

site_logo

HastingsSandy . 2015-07-28

MORE AT TripAdvisor

We often get take away as we live very close. It is always good particularly the salads. My partner lived in Thailand for a while and feels this is best Thai food round here.

site_logo

Claire T . 2015-07-21

MORE AT TripAdvisor

Really great food and service. I live on Blatchington road and this place is a hidden gem in a sea of sticky sweet and sour sauce and MSG frozen chicken. Two thumbs up.

site_logo

Rhys T . 2015-07-08

MORE AT TripAdvisor

Great place to eat. We love there food the Salads are to die for and the curries are awesome. Also the vegetables are always fresh and inviting.

site_logo

Pete J . 2015-05-19

MORE AT TripAdvisor

I took my friends here for my birthday and I had a great dinner here. The staff were so professional and friendly and the food were nicely decorated and tasty. One of my friends recommended me here before I came as they also had a surprise treat from the house. The atmosphere here is amazing, suitable for romantic couple. Definitely recommend for people who would like authentic Thai food. The place is such a fine dining and I don't understand why a few people are so dramatic about this place in this website.

site_logo

ShAdy N . 2015-05-17

MORE AT TripAdvisor

Been here after read good reviews, and i am wonder where all these people had eaten so far? The food was not only badly presented but also tasted no way near to Thai food (more like re-heated dish).Service practically no - existent and place not so clean (pleasant decorated throughout though). Won't bother coming back here again as not actions were taken by the owner after I presented my discontents to him.

site_logo

luigi s . 2015-05-10

MORE AT TripAdvisor

A complete waste of a meal. Tried this place for takeaway as it had a very high review score on another takeaway app. I have absolutely no idea why. The fishcakes were rubbery and oily and generally disgusting, the source which came with them was like sugary water rather than a sweet chilli dip. I had a Thai curry and this one was the worst I have ever eaten. Big lumps of overcooked chicken which disintegrated on impact, huge chunks of undercooked potato and nothing else except a watery source. My wife had the green curry and she said it was bland and disappointing as well. The only things which were okay were the rice and prawn crackers. I never usually contact restaurants to complain about their food as I just think I won't return again in future, but this was so bad and such a waste of money that I called the restaurant straight away. The manager was not available to speak to me so someone else took details of why we were unhappy with the food. I'll be amazed if I get a call back from the manager.

site_logo

Hayley J . 2015-05-02

MORE AT TripAdvisor

Great food, great service, authentic, do fantastic takeaway. Can't count how many times I have visited this place, love love love it! Recommend!!

site_logo

Sue O . 2015-05-02

MORE AT TripAdvisor

Sunday afternoon March 29th, the Alex-Suze-Thaioff commenced again, feeling blissfully hungover from the previous evenings Chocolate and Whisky cocktail drinking marathon we both knew the only way to feel 100% would be to have a full on Thai meal, once in Hove, the first Thai place choosen was closed, unaware of how many there actually were in Hove we walked up and down in search of Thai sustenance, as we strolled Alex googled for nearby restaurants, as he found the list we stopped to review and decide where to go, I hastily added that we had actually stopped right outside a Thai and we made our way in... dissappointedly we were told that the kitchen had just closed. Still in need of a Thai food fix, Alex rang the Thai Connection and thankfully they took a reservation. Upon arrival it was quiet, that is to our liking though.A tastefully decorated and comfortable restaurant, a good selection of vegetarian meals on 2 menus were available. We were both ravenous by now and was hoping for a bowl of Thai crackers, alas none arrived. The food came fairly quick thankfully, an amazing Pad Thai was beautifully presented and was filled by an enormous selection of tasty vegetables that we just kept feasting on and it never seemed to reduce in size. As norm a Massaman was my choice, once again the chef had added extra cashews as requested and we enjoyed every mouthful. The cocunut rice was plentiful and a delight.The Thai red curry was very pleasant and moorish and as hot as my date. All the dishes were giving that 'tingling on our tongues', sensation, our tastebuds were awakened by this Thai food, accompanied by a cheeky sparkling bottle of Rose.A unique and romantic meal. It hit the spot, just as we had desired.Alex/Suze

site_logo

Alex-Suze-Thaioff . 2015-04-15

MORE AT TripAdvisor

My partner and I enjoyed a great meal here last night. We arrived early on our way to a concert in Brighton, and were the only customers at the time, however, the staff were loverly and the food was just delicious, full of flavour and plenty of it. Can't recommend this restaurant highly enough and we shall all go back.

site_logo

Roger B . 2015-04-15

MORE AT TripAdvisor

タイのお友だちと一緒に訪問しました。みんなで、色々注文して、シェアしましたが、美味しくて、豊富な種類のタイ料理に大満足でした。もちろん、辛いメニューが多いので、辛いもの好きな方には是非オススメしたいのですが、苦手な方でも、食べられるメニューもありますのでご安心を。店内も、シックでモダンな雰囲気でデートなどにも使えそうに感じました。

site_logo

pecanbird . 2015-03-23

MORE AT TripAdvisor

I have just made a new discovery in Hove. We finished a concert and decided to go for a meal and one of the singers suggested Thai Connection. I was blown away by the food. We started with satay and ribs followed by pad Thai noodles and crispy beef noodles and then to finish off a deep fried banana with rasperry coulis and cream. It was absolutely delicious.I can't recommend this restaurant highly enough and we shall all go back.

site_logo

Denise W . 2015-03-07

MORE AT TripAdvisor

Excellent food , service and ambience . The staff were lovely and the food was simply delicious . It felt almost like being in Thailand .

site_logo

Magdalena R . 2015-01-06

MORE AT TripAdvisor

My partner and I enjoyed a great meal here last night. We have always been impressed by the quality of the food here and the service is low key but friendly. I had the vegetarian corn cakes and they were delicious. Normally I find corn cakes tend to stick in your teeth for ages afterwards but not these, they were perfect. Then as a main I had the Tofu Kra Pow which was cooked beautifully and tasted devine. In my opinion it is the best of the veggie dishes.My partner had king prawn tempura which he was impressed with, especially as it was coated in breadcrumbs rather than batter which made it lovely and crispy. Then he had the Chargrilled Seafood Platter which he has had a number of times now and says it is always good.We get takeaway from here on occasion too and it is always to the same high standard as the restaurant.

site_logo

Spikeyo . 2014-11-29

MORE AT TripAdvisor

Visited after recommendation from a friend for an early dinner. Only table in restaurant to begin with (3 others arrived after us). Asked for starters and mains together but brought out seperately leaving us hungry as very slow to clear plates and bring mains. Food was average although my mixed seafood dish was luke warm, but did not inform waiter as felt I would wait another 20 minutes for him to return. After finishing we waited another 20 minutes for our plates to be cleared. Overall a 'quick' meal took almost 2 hours due to lack of/slowness of service. Also music only put on as we were leaving, so atmosphere a little dull. Another table also chose to change their child's nappy at their table whilst we were eating, but no comments were made by staff that this should be done in the toilets. Perhaps this restaurant is better for later sittings as with one member of staff they seemed unable to deliver the service and experience I was expecting. Staff member did seem friendly though but seemed to also lack hospitality experience. Would not return in a hurry although would maybe try a later evening.

site_logo

SussexEat . 2014-10-04

MORE AT TripAdvisor

We popped in for a takeaway last night following a friend's recommendation. The staff were gentle, kind and helpful and were quite happy to run off to the kitchen and check whether things had gluten in them (the Thai green curry doesn't).The food was lovely and flavourful and even though it was quite hot, the flavours survived and triumphed!

site_logo

Adeling79 . 2014-10-02

MORE AT TripAdvisor

I've been here a few times and it's always nice but considering the wealth of competition around here it could be better. There was plenty of vegetarian choice for me and my starter was delicious but my main course of pad thai noodles and a chick pea dish were really mediocre. The pad thai was quite dry and didn't come with any of the little accompaniments that are usual. Nothing wrong with it but it could be better.

site_logo

TerriWD . 2014-09-15

MORE AT TripAdvisor

Similary restaurants in South East

restaurant_img
3.9

217 Opinions

location-iconCounty Oak Avenue, Brighton BN1 8DJ England
Thai
outdoor_seating_273137takeaway_273137delivery_273137

The chicken nuggets were the best I've ever eaten. The onion rings were just ok. Portion size is very generous! Service is very friendly & professional. I asked for a large extra plate & they wouldn't being it without it being warmed.. A nice touch. Recommended.

restaurant_img
4.0

826 Opinions

location-icon36 North Gardens
Thai
outdoor_seating_84444takeaway_84444delivery_84444

Great pub. Great staff a real treat

restaurant_img
4.0

58 Opinions

location-icon58 Southover Street
Thai
outdoor_seating_82747takeaway_82747delivery_82747

The local beer with a citrus flavour was awesome and I loved it. The dinner menu was Middle East with lamb Kofta and chicken shawarma. The portion size was just right and the food was nice. This is a nice pub with friendly services.

restaurant_img
4.0

4 Opinions

location-icon50 Southover Street
Thai
outdoor_seating_227571takeaway_227571delivery_227571

Esta operación en el Charles Napier ofrece una excelente elección de lo que creo que es una relación calidad-precio tailandesa. Tuvimos la fuente para compartir como aperitivo, tuve un curry verde, mi amigo tenía rollitos de primavera. Estábamos al final de una tarde ocupada, así que fue un poco lento y se olvidó 1 orden. Sucede, pero no quita la buena comida. Los vinos en el bar tienen un precio razonable.

restaurant_img
4.0

237 Opinions

location-icon30 High Street
Thai
outdoor_seating_82072takeaway_82072delivery_82072

Myself and my family went here for a New Year’s Eve meal and were greeted with the rudest woman on earth. Tutting, rolling eyes, sighing and muttering things under her breath are only a small list of the rude, unpleasant things she would due during our time at Ros Thai. The restaurant is silent and there is more of a vibe at a wake. Food was bland and had no authentic Thai flavour - bog standard and not to mention took over an hour to arrive. Will not be returning ever again, would give 0 stars if possible.