GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.3

Based on 2.101 opinions finded in 4 websites

site_photo4

Nº 263 in 740 in Lewisham

Nº 18 of 41 Indian in Lewisham

CUSTOMERS TALK ABOUT DISHES WITH..currylambchickenriceprawnspicymintmeatmusttenderoldonionbeautifulchilligarliccooked

comment_iconOpinions

Loved Taste of Raj. The butter chicken was phenomenal. As well as our service. Selena in particular was very nice :)

site_logo

Isaac Bale . 2025-01-16

MORE AT Google

Taste of Raj has become our go to restaurant in Blackheath. Lovely dinner as always. Great food and wonderful service by Selina and the whole team. Would absolutely recommend.

site_logo

Lucrezia Gentili . 2025-01-15

MORE AT Google

Very nice dinner. Fast and convenient. Lisa gave us great recommendations.

site_logo

Louis . 2025-01-14

MORE AT Google

Delicious food as always and great service. Delivery was delayed but there was a traffic incident nearby so perfectly understandable

site_logo

Christopher . 2025-01-10

MORE AT Just Eat

Hot and tasty 🤤 Great for winter 🥶. Thank You.

site_logo

Miss . 2025-01-10

MORE AT Just Eat

First time in this restaurant. My favourite cuisine, however, this was such a disappointment. I’ve never eaten chicken tikka like this before. Looked like chicken with a sauce on, no taste whatsoever. The chilli chicken was like deep fried chicken with a few chillies thrown on top. The dhansak was mush and the madras was very dark in colour yet tasteless. Waste of money and disappointing night out.

site_logo

sharon sales . 2025-01-10

MORE AT Google

Always extremely good. It’s still my ‘local’ despite moving further away and it being a 15 mile round trip.

site_logo

R L (RL) . 2025-01-09

MORE AT Google

Excellent food and service. The waiters were really helpful, polite and attentive.

site_logo

Guillem Calpe . 2025-01-01

MORE AT Google

so bad that I can't put zero stars. You don't deserve our money. Delivery guy never called us, they claim that they did and asked for more money so they can bring us the food. Just do your job man. And I am talking about the manager of the place that on the phone he claimed that it was our fault, while behind our back he gave orders to the delivery guy to NOT deliver the food if it takes more than 3 minutes. (we eventually found out).I don't know what is wrong with this country.

site_logo

L1ON K1NG . 2025-01-01

MORE AT Google

We ordered takeaway and we were so disappointed with the food that I am leaving a review. All of the dishes were bland and sloppy. It hardly tasted of anything. We cannot believe that food this dreadful is being willingly sent out of the kitchen. Have seen a few reviews saying that the food here is inconsistent in flavour, but we will not be returning to find out. Bad start to 2025.

site_logo

Tadnum Yaleha . 2025-01-01

MORE AT Google

Food never arrived. Not sure if I will be refunded.

site_logo

Beatrice . 2024-12-31

MORE AT Just Eat

Very nice meal and was offered a table at a very busy time as we had traveled far to come to black heath. Lisa was our server and she was very attentive

site_logo

Carmen Mercado . 2024-12-31

MORE AT Google

A Memorable Christmas Eve at Taste of Raj Last night, on Christmas Eve, my family, friends, and I dined at Taste of Raj, and I must say it was a wonderful experience. From the moment we arrived, the team was incredibly welcoming. They consistently checked in to ensure everything was okay and even escorted us to the door as we left—a small but thoughtful touch that truly stood out. One particular staff member, Selina, left a lasting impression. Her attentiveness and kindness were remarkable. I had ordered a dish called chicken vindaloo, which was delicious but far too spicy for me to handle. When I mentioned this to Selina, she immediately brought me some yogurt to help balance the spice, without hesitation. This simple yet considerate gesture made the experience all the more enjoyable. Selina’s exceptional service, along with the warm hospitality of the entire team, made the evening feel special. I truly appreciate her kindness and wish her all the best for the New Year. Thank you, Taste of Raj, for such a memorable evening!

site_logo

Angelina Jambhulkar . 2024-12-25

MORE AT Google

Such a nice place with very welcoming staff. Good food and vibes. Our waitress Selina was super nice and even gave us extras 😊

site_logo

Eline Owusu . 2024-12-25

MORE AT Google

Best Indian restaurant in the area. Liza was friendly and helpful.

site_logo

M S . 2024-12-21

MORE AT Google

We live locally and have tried many of the restaurants in the area - this one is reasonably priced and the food is excellent. It’s our ‘go to’ for Indian food.

site_logo

Christine . 2024-12-21

MORE AT Just Eat

First Time Ordering on Uber Eats and Issue This was my first time using Uber Eats, and while my order was missing a wrap, I was really impressed with how the situation was handled. The driver seemed a bit hungry (which is understandable!), but I called the restaurant directly to let them know about the missing item. The manager was very professional and took the issue seriously. They quickly sent me a fresh wrap, and it arrived in perfect condition. Overall, despite the small hiccup, the customer service was excellent, and I appreciated how quickly they resolved the issue.

site_logo

Stan The Men . 2024-12-19

MORE AT Google

Pollo buryani es especial y delicioso y precio razonable. buen servicio y . ambiente peacfull. irá de nuevo con la familia.

site_logo

Charles W . 2024-12-12

MORE AT TripAdvisor

The food was wasn’t great in my opinion, have had much better! It was Sunday night and maybe the chef had a night off. The service was very friendly and attentive.

site_logo

Shay Shay . 2024-12-10

MORE AT Google

Fantastic food, amazing location and service. Selina was particularly helpful, and very attentive. Highly recommended!

site_logo

Adam Lee . 2024-12-09

MORE AT Google

I come here very often to and I’m never disappointed. The food is always delicious and the staff is attentive and nice. Thanks to Rubi in particular for the lovely service.

site_logo

Francky G Lamine . 2024-12-01

MORE AT Google

Best Indian food I have had in London, and I have tried alot.

site_logo

Dean Wright (Dean Wright Photography) . 2024-11-26

MORE AT Google

arrived cold and tasted horrible. ordered from a different nicer take away

site_logo

Claire . 2024-11-23

MORE AT Just Eat

Excellent place. Attentive and charming and much better food than the usual

site_logo

Tim Cranmore . 2024-11-15

MORE AT Google

Disfrutamos de la experiencia, buen personal amable. La calidad de la comida era buena, las porciones buenas, no logró comer todo el mío, pero puede haber pedido más! Dhansak sabroso con buenos trozos de pollo, guarniciones muy sabrosas. Recomendaría como extremo superior de la casa de curry estándar con gran ubicación, buen interior (música sutil en el fondo gracias) , personal amable y buena comida.

site_logo

Simes1965 . 2024-11-13

MORE AT TripAdvisor

Lovely Hot tasty food. Thank You

site_logo

Miss . 2024-11-12

MORE AT Just Eat

We’ve ordered a few veggie daals and curries. They didn’t hold back on the heat! Give them a try if you like your food with a bit of a kick.

site_logo

Chris . 2024-11-07

MORE AT Just Eat

Came here for dinner with the family and Liza, our waitress, made sure it was a wonderful experience. Their food was very flavourful - would high recommend.

site_logo

Rei . 2024-11-04

MORE AT Google

Always great food from Taste of Raj. Have been having takeaways & food in the restaurant for over 10 years now. Chicken Handi is my go to dish!

site_logo

Steven . 2024-11-03

MORE AT Just Eat

Top notch food, absolutely delicious, best in this area by a country mile

site_logo

Nick . 2024-11-02

MORE AT Just Eat

Delicious food and brilliant staff. It was my partner and I’d anniversary and the waitstaff offered to take photos for us and even made us some surprise celebratory cocktails at the end of the meal. The service was fast and efficient, we got complementary delicious orange slices, and the atmosphere was lovely. We really got let down by the service at another local restaurant before going to Taste of Raj, and the experience totally brightened the evening.

site_logo

Sabrina Coghlan-Jasiewicz . 2024-10-28

MORE AT Google

The food is rich in spices and tastes great. An authentic experience.

site_logo

Selahattin Bahar . 2024-10-27

MORE AT Google

Food was really good, i recommend coming here

site_logo

An X . 2024-10-20

MORE AT Google

Outstanding. Every part of the meal was spectacular, will 100% be back

site_logo

Jamie . 2024-10-16

MORE AT Just Eat

Tuve un almuerzo de cumpleaños encantador con amigos en un sábado. Personal muy servicial y buena selección de platos vegetarianos y no vegetarianos muy sabrosos. Generosas porciones. Gracias Irfan en recepción y colegas!

site_logo

Shiraz O . 2024-10-12

MORE AT TripAdvisor

Very late delivery and no explanation to why

site_logo

p . 2024-10-06

MORE AT Just Eat

amazing food and good portions. Best Indian we have had in ages!

site_logo

Allison . 2024-09-30

MORE AT Just Eat

Chicken was pink, took one and a half hours to get it. So it was warm not hot

site_logo

Gary . 2024-09-29

MORE AT Just Eat

Really tasty food and great portions 🙂

site_logo

Cindy . 2024-09-28

MORE AT Just Eat

What a lovely discovery this place was……only 15 mins from the O2 (if you find yourself waiting for kids at a Gig)….great chilled vibe with a delicious menu and attentive service to match)…..highly recommend you try it 👌

site_logo

Andy Outlaw . 2024-09-26

MORE AT Google

Taste of Raj is my favourite restaurant! the food is amazing and the portion sizes are huge for the price! Cannot recommend enough!

site_logo

Chloe . 2024-09-22

MORE AT Just Eat

...let's put it this way...I will go to bed dreaming of Taste of Raj's tandoori king prawns with pilau rice... Service - very pleasant and unobtrusive; atmosphere - lively for such a small place; food - generous portions of perfectly seasoned dishes (we were all stuffed!); value for money - absolutely. Left with doggie bags; what more can you ask for? We will return to this restaurant, over and over again. So glad we took a chance on it.

site_logo

Suse Barc . 2024-09-21

MORE AT Google

Restaurant is just around the corner however did take over an hour to arrive & was only warm, not hot. Disappointing

site_logo

Hayden . 2024-09-20

MORE AT Just Eat

Have a lovely evening, food was good and the service as well. Inshallah Will come again

site_logo

Gbeju_Jatta . 2024-09-16

MORE AT Google

The food was lovely, The manager suggested a meal difference for me , and it was super!!!

site_logo

Gloria Hutton . 2024-09-10

MORE AT Google

Amazing restaurant with amazing staff and top food. Very chilled and relaxing atmosphere. I really liked that we had time to chat with wine and starters before our main courses. It was a great evening and it was clear the food was all very fresh and the meats were tender and melted in the mouth. The staff were very friendly and on point to our needs. Definitely my favourite Indian Restaurant in the borough of Greenwich, London. I highly recommend this place and I'll definitely be a regular customer when in the area

site_logo

billy lewis . 2024-09-08

MORE AT Google

Very warm service. The food was hearty and tasty. Almost packed on the Saturday night that we went. Highly recommend this lovely curry house in Blackheath.

site_logo

Thomas Irwin . 2024-09-08

MORE AT Google

We order most weeks and the food is always good with decent sized portions. The wait time can be up to an hour on a Saturday night but if you’re prepared for that it’s ok.

site_logo

Vicky . 2024-09-03

MORE AT Just Eat

I ordered through their website and then the food came almost two hours later.

site_logo

Jakab Kaufmann . 2024-09-01

MORE AT Google

Very late delivery. 2 items ordered. average taste

site_logo

Ribhu . 2024-09-01

MORE AT Just Eat

Stumbled on this place on a Thursday evening and was pleasantly surprised. Lovely location looking over the heath, lovely friendly & attentive staff. Food was great (and im quite fussy) Reasonably priced too. All in all, a lovely night out. Will recommend & come again

site_logo

Elephant Estates . 2024-08-29

MORE AT Google

¡Completa pérdida de tiempo! Reservamos una mesa para el sábado por la noche. Cuando llegamos nos dijeron que el restaurante estaba lleno y no podíamos sentarnos. Después de quejarnos, nos dijeron "¡siéntate!" en la mesa libre que quedaba. Nos fuimos poco después y no pedimos nada. Muy mal servicio y se sintió muy desagradable.

site_logo

Andrew S . 2024-08-26

MORE AT TripAdvisor

Delicious food. Nice sized portions!

site_logo

Simon . 2024-08-25

MORE AT Just Eat

Extremely inconsistent quality and taste of food. We went on 2 consecutive days and were blown away at how bad the food was on the second as compared to the first — won’t recommend.

site_logo

Sayan Goswami . 2024-08-23

MORE AT Google

Ordered for a small function and was NOT disappointed. Food was tasty, hot and delivered promptly with care. The customer service was excellent.

site_logo

Pauline M Harris . 2024-08-14

MORE AT Google

We had a really lovely meal. Lamb dishes were the best I’ve ever had. Melt in the mouth. Service was great. Nice atmosphere. Good price.

site_logo

Peter Brighton . 2024-08-10

MORE AT Google

Tuvimos una cena muy deliciosa y un excelente servicio por Selina. La comida era muy sabrosa y podemos recomendar el Restaurante 100%.

site_logo

Silke . 2024-08-10

MORE AT TripAdvisor

Superb meal. Good service. Lamb Kiralhi that melted under the slightest fork pressure. A little expensive but the quality was that good.

site_logo

Paul Webb . 2024-08-04

MORE AT Google

Mixed bag for me.....I had the Chicking set menu meal. I found the dinner to be absolutely great. The chicken was so tender in the Madras and the rice was the best I have had from a taxkaway. And the mixed starters was fantastic ( not a lot sadlyto say i.e. three prownsone small onion bargy and a what wever that thing was....yes nice but not a lot. Sad to say the rest was a let down. The mint sauce was not nice as was a the other dish that was. And only one poppadom. No nan bread ....for me it was nice food but a bit of a let down in price. I think next time I'll just order from the menu and not the set menu as I'll know what I'm getting.

site_logo

Mark S . 2024-07-27

MORE AT TripAdvisor

Delicious food, friendly service and clean interior. Real Indian and full stop f aroma.

site_logo

Saleh Elshobokshi . 2024-07-27

MORE AT Google

A very nice restaurant, with lovely staff and high quality delicious food. Would definitely recommend.

site_logo

Lucrezia Gentili . 2024-07-26

MORE AT Google

Lovely, if what you want is an 'English' curry, but done ever so well, and not a lump of protein thrown belatedly into some insipid yet fluorescent sauce. The lababdar is very good.

site_logo

Jeremy Hunt . 2024-07-22

MORE AT Google

Absolutely beautiful food , the staff are always so welcoming and friendly, always a good atmosphere.

site_logo

Selina Mayne . 2024-07-21

MORE AT Google

hot tasty best Indian in London full of flavour and friendly driver

site_logo

Christian . 2024-07-14

MORE AT Just Eat

We’ve ordered a few veggie options, the food was great and we even got a couple of extra boxes of rice and pappadoms. I really liked my mattar/green pea paneer but an absolute dark horse of our order has proven to be kidney beans daal and we’ll definitely order more of it next time.

site_logo

Chris . 2024-07-13

MORE AT Just Eat

Very quiet - but it was Sunday. Food here is excellent and decent value considering how popular Blackheath is at weekends. I had chicken tikka dhansak which was delicious with a good level of spice kick! Keema Paratha fabulous. Service is always attentive and when in Blackheath this is a regular haunt for us. Worth a visit.

site_logo

richard hill . 2024-07-12

MORE AT Google

Very nice food and generous portions. Not the cheapest by far but very nice and great staff. I recommend the lamb dishes.

site_logo

Hardev “H” singh . 2024-07-01

MORE AT Google

The food is faultless. Always delicious.

site_logo

Garry Johnson . 2024-06-26

MORE AT Google

Lovely food and excellent service from Irfan (sorry if I spelled that wrong). Will definitely come back

site_logo

Joseph Reece . 2024-06-24

MORE AT Google

My order was very late but several calls I made to the restaurant only met with false promises. The delivery person was extremely rude shouting at me while delivering that my house was in the wrong location.

site_logo

Subha . 2024-06-22

MORE AT Just Eat

excellent food every time delivered by their own drivers.

site_logo

Alex . 2024-06-22

MORE AT Just Eat

Delicious curry and great, friendly service. Very reasonable prices

site_logo

Adam Lewitt . 2024-06-07

MORE AT Google

10/10 service and food - we will be back

site_logo

Emily Armstrong . 2024-06-07

MORE AT Google

This is the best Indian food I have ever had. We just happened to find the restaurant in 2019. We ate there multiple times on that trip. We were very excited to see that they were still there I’m when we returned in 2024. It is still the absolute best Indian food.

site_logo

Curtis Romey . 2024-06-02

MORE AT Google

All round great experience and delicious food - will be returning!!

site_logo

Victoria Dale . 2024-06-01

MORE AT Google

The best curry in Blackheath by a mile. Keep up the good work!

site_logo

Jake Atkins . 2024-05-30

MORE AT Google

Veg samosas missing Aloo gobi had no taste and chapati hard shame as normally ok

site_logo

samantha . 2024-05-27

MORE AT Just Eat

Great service, generous size portions, beautiful taste. Will order again.

site_logo

Julie . 2024-05-26

MORE AT Just Eat

A lovely curry house visited last night. Fantastic service with a smile. Tasty food- the naan was great. Overall very impressed

site_logo

owen Crouch . 2024-05-25

MORE AT Google

Can’t fault them, food and service was amazing, I love the traditional aspect of the restaurant and all the servers know about there menu and food, you see some reviews and think these people are looking to be negative regardless of their experience, they need to get a life. Well done guys, keep doing what your doing 👍👌🤤

site_logo

Ak . 2024-05-25

MORE AT Google

Best place for lunch! Good food, amazing service. Highly recommend

site_logo

Ramina Utyagulova . 2024-05-22

MORE AT Google

A proper, solid Indian restaurant. Excellent dishes and quality. The king prawn puri is a must as it the chicken Punjabi! The shasliks (lamb or chicken) are truly brilliant. Very pleasant, traditional atmosphere inside and they always make us feel very welcome. Great spot!

site_logo

A W-L . 2024-05-21

MORE AT Google

The customer service from Selina and Zakir was wonderful, both of them showed great attention to detail. The food was lovely too :)

site_logo

samson akere . 2024-05-18

MORE AT Google

Had an amazing meal there with a friend last night...we both agreed it is our new favourite restaurant!! The food was really great - couldn't fault anything, the service was thoughtful and prompt! We had a cocktail, which was also really tasty! It is a cosy restaurant with a wonderful atmosphere and the food was delicious...would highly recommend!!

site_logo

Hople Thane . 2024-05-17

MORE AT Google

Delicious curry, well made and with quality and fresh ingredients. Delivery was a tiny little late but it was so worth waiting!!

site_logo

Jander . 2024-05-03

MORE AT Just Eat

The food wasn’t really nice it was warm and I had stomach ache 😔

site_logo

Khadija . 2024-05-02

MORE AT Just Eat

I recommend this Indian restaurant to every single person in south east London. The food is unreal and exceptional service. Delicious and tasteful dishes. I leave here wanting to come again and again. Thank me later. Thank you to all the staffs and chefs.

site_logo

Kevin Galvez . 2024-04-27

MORE AT Google

Great family restaurant in Blackheath, nice size, great staff, great menu, really good experience. We went for a Curry after the marathon.

site_logo

Alan . 2024-04-22

MORE AT TripAdvisor

Visited on Sunday with the family and was very impressed with the food and service. Will definitely be visiting again. Leza was a fantastic host.

site_logo

Abigail Adeyemo . 2024-04-21

MORE AT Google

Lovely food and lovely delivery driver

site_logo

Shahima . 2024-04-18

MORE AT Just Eat

Best Indian restaurant in Blackheath Village! The staff are sublime, the space is great, the food is delicious. Authentic grub with a smile - love it

site_logo

Jamie Currier . 2024-04-14

MORE AT Google

The manager literally pressured us into writing the review as soon as we ordered, and when we did he made us change it into something more specific according to his own liking. Food: couldn’t finish the butter chicken as it felt like the gravy was few days old. It had a tangy flavour to it, whereas it should be on the sweet side. Overall experience was just disturbed.

site_logo

Omkar Pawar . 2024-03-18

MORE AT Google

Not as good as previous time I ordered from here. The korma was bland and watery. The onion bhaji were dry and clumpy.

site_logo

James . 2024-03-13

MORE AT Just Eat

Everything was absolutely delicious!

site_logo

Sonia . 2024-03-09

MORE AT Just Eat

Excellent food Paid another visit to " taste of Raj" Yesterday 26 Dec food was excellent, 5 stars all round. I will definitely be going there again. Paid another visit yesterday, " the taste of Raj" 7march my friend and I had the lamb biryani food was absolutely delicious, I will definitely be paying another visit to the taste of Raj.

site_logo

Robert Brownlow . 2024-03-08

MORE AT Google

Soggy cardboard would make a more interesting meal. Possibly the worst indian food I've ever had. No flavor incredibly bland. Was basically was just some chicken in nondescript orange paste allegedly Tikka Masala Was also late to arrive. Very disappointing.

site_logo

Benjamin Watkins . 2024-03-08

MORE AT Google

By far the best Indian food I’ve had in London! Taste of Raj is a hidden gem with not just an excellent menu, but the warmest of hospitality. All the staff members make you feel especially welcome and at home; Tawhid, Zakir, and Rubina were super helpful and friendly! Would definitely keep visiting!

site_logo

Shreya Sharma . 2024-03-05

MORE AT Google

Excellent food. Well prepared. Very tasty.

site_logo

Talabi . 2024-03-03

MORE AT Just Eat

The food was great and the delivery came earlier than advised. I will definitely be ordering from here again!

site_logo

Rebeka . 2024-02-27

MORE AT Just Eat

Taste of Raj in Blackheath is a GREAT place to get a curry. I have been visiting there many times since 2013 onwards and the service is always excellent. There is the standard curry dishes as well as some house specials. The tables are clean and nicely set, the service has always been quick and I have enjoyed a full range of their curries. Finding a good restaurant at a reasonable price in London is increasingly difficult. Friends and family I have brought here have all said it's brilliant. Taste of Raj has never failed and I hope it continues to maintain these high standards long into the future. I will make an effort to visit every time I return to the area. I recommend the lamb chop starter.

site_logo

colin_coulter . 2024-02-26

MORE AT TripAdvisor

Similary restaurants in London

restaurant_img
4.3

154 Opinions

location-icon171 Brockley Road
Indian
outdoor_seating_109078takeaway_109078delivery_109078

Received food piping hot and 30 mins early!! :-D. Love this resturant, best Indian food in SE4!!

restaurant_img
4.3

65 Opinions

location-icon25 Lee High Road
Indian
outdoor_seating_189547takeaway_189547delivery_189547

Great masala dosa for an incredible price, with a great smile. Tried the next door south Indian dosa too but the price was more expensive and I didn't like it as much as I like the one from this shop. I would highly recommend here to everyone in the area.

restaurant_img
4.4

2318 Opinions

location-icon119 Brockley Rise
Indian
outdoor_seating_78795takeaway_78795delivery_78795

I’ve been coming to Babur for years. The service and the atmosphere in the restaurant has gone from strength to strength. Easily the most stylish Indian restaurant I’ve been in (and I’ve tried hundred in many continents) I’d say tonight the drinks were better than ever (pineapple Hookah a cardoman-y Smokey delight, steering well clear of the traditional sweetness of Indian cocktails) Food a little off its best I felt. Scallops a bit tough and monkfish a bit bland. I’ll still be back though. I like their style and they’ve definitely improved the way they treat female customers - even those who are dining alone (last minute cancellation by my friend but I decided to enjoy the treat anyway)

restaurant_img
4.3

1206 Opinions

location-icon37 Deptford Broadway
Indian
outdoor_seating_82946takeaway_82946delivery_82946

Is this place going to reopen?? Missing ordering from here

restaurant_img
4.4

2728 Opinions

location-icon466 Bromley Road
Indian
outdoor_seating_152613takeaway_152613delivery_152613

Pre-ordered for 6pm delivery so we could all eat before the kid’s bedtime. Didn’t arrive until 6:45pm so had to quickly cook something for the kids and leave the take away until after they had gone to bed. Completely defeats the purpose of ordering a takeaway! Very disappointed