GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
3.8

Based on 1.453 opinions finded in 2 websites

site_photo4

Nº 378 in 655 in Greenwich

Nº 28 of 36 Asian in Greenwich

CUSTOMERS TALK ABOUT DISHES WITH..lobsterporkbrothboiledoldnoodlessaladspicysoupchickenprawnprawnsfriedmeatricebunpepper

comment_iconOpinions

The pho is very delicious! The fried chicken wings are also delicious and crispy! The boss is also very nice! A highly recommended store! ! !

site_logo

lin zhou . 2025-03-21

MORE AT Google

The signature fried rice includes barbecued pork, roast duck, and chicken. It is fried with Thai fragrant rice. It is full of aroma. The store’s service is very good👍

site_logo

Daphnie Lin . 2025-03-18

MORE AT Google

The Chinese-speaking staff are friendly and enthusiastic, and the food is delicious!

site_logo

Tracy SY Lee . 2025-03-18

MORE AT Google

Excellent food, menu with clearly listed gluten free options, plenty of space and very well located for thr museums!

site_logo

Margaret Riach . 2025-03-16

MORE AT Google

Very delicious meals, large portions and good prices

site_logo

Mishel Dimitrova . 2025-02-23

MORE AT Google

Lovley place. Small, nice looking and no waiting to be seated. Food was very tasty. The staff were very friendly. Will come again

site_logo

jessica gosling . 2025-02-17

MORE AT Google

The food came without protein, just rice, extremely bad food

site_logo

Brunna Rodrigues . 2025-02-15

MORE AT Google

Very generous and delicious food for a budget! The service was super quick. We really enjoyed our visit :)

site_logo

Carolina Herrera . 2025-02-15

MORE AT Google

Looks like a little bit upgraded asian canteen. Great food, great flavours, fast service

site_logo

Charmaine Lique . 2025-02-14

MORE AT Google

Better go to other pho restaurants in town...

site_logo

MK M . 2025-02-14

MORE AT Google

Ordered chicken thigh rice, well cooked and great flavors!

site_logo

Jessica Lin . 2025-02-04

MORE AT Google

I loveee this place, i always get takeaway from here! Highly recommend the pho tom with prawns and the spring rolls are INSANELY good, best ever. Trust me. Its a really good comfort meal especially when the weather is cold.

site_logo

Dana Shokrollahi . 2025-02-04

MORE AT Google

I love Pho Street. Amazing Pho, genuine and kind staff, and cozy atmosphere. Duc Leanne and Su were absolutely lovely, it was a pleasure.

site_logo

Liliya Abou Ioussif . 2025-01-28

MORE AT Google

Such a lovely restaurant the food and service is always 10/10 can't recommend enough! ❤️

site_logo

Demornay Sauniere . 2025-01-28

MORE AT Google

great selection of food and the staff are fantastic. ambience improving would make it a 5 (the AC is so loud, some traditional viet music & paintings could go a long way 🙂)

site_logo

Charlie Todd . 2025-01-19

MORE AT Google

Super recommended!! We went to the observatory and when we went down we found this Vietnamese restaurant. We ordered soup and a couple of dishes from their menu and we really liked it.

site_logo

Dustin Guzman . 2025-01-08

MORE AT Google

Pho Street restaurant left a very good impression on me! Especially their beef brisket rice, which tastes great. The brisket is stewed very soft and delicious, and the rice is also very fragrant and glutinous. The overall combination is very good. The environment of the restaurant is also very good, clean and tidy, the atmosphere is relaxed and comfortable, making people feel happy while dining. In addition, the portion is very generous, which can fully satisfy the needs of big appetites, and the price-performance ratio is very high!

site_logo

Hanlin Liu . 2025-01-06

MORE AT Google

Excellent food, fast service, average quality/price.

site_logo

Gi De . 2025-01-03

MORE AT Google

We just received a takeaway of two spring rolls and 2 tofu phos. It was terrible, our herbs and lemon came all soggy and they had expired, with them being brown. Our vegetables were all overcooked and the pho was way too salty. One of our worst pho experiences. Won’t be ordering or visiting again.

site_logo

Tina Quinnen . 2025-01-03

MORE AT Google

Hello, I don’t mean to start trouble or drama but I want to put my review for yesterday’s order as I think it’s important. We’ve ordered quite a few dishes and all had to go to waste after only one bite of each. Lobster pho - I’ve eaten quite a bit of lobster and this one was super rubbery and very very bitter. The noodles of both this pho and the “special pho” we’ve ordered were stuck to one another like a block. Was very hard to take them apart. The prawn summer rolls came with one prawn cut in half and were dry and tasteless. I love summer rolls and eat them often but couldn’t take more than one bite. The peanut sauce didn’t really have a taste either. The salt and pepper squid was also super rubbery. The only good bit was the broth of the lobster pho. We’ve reached uber eats for a refund but no answer yet. It’s a shame as the restaurant has so many good reviews so we were really disappointed. I hope for some kind of a refund as we spent 60£ and didn’t eat any of it. We are always willing to admit if something just isn’t to our taste when it’s in place but this time the food really wasn’t edible. I hope this will help for improvement of the restaurant rather than anything else. Best *edit : uber eats have issued us with only 9£! We really hope to get a refund as all food had to be thrown away.

site_logo

Nova Nachtom Mautner . 2025-01-02

MORE AT Google

Good taste, good price, very fast service. Good quality!

site_logo

Gabrielle Cui . 2024-12-23

MORE AT Google

Don’t play with me about pho street, this place is fire, well priced and just overall great. Staff are friendly, food arrives quickly and tastes absolutely magnificent. 10/10

site_logo

Toma puodziunaite . 2024-11-26

MORE AT Google

This is a local of mine and the food is always on point. The lemongrass lamb chops are slept on😍😍 try them. Bun dact biet is also really good and probably better than the original pho

site_logo

Cheila Gongo . 2024-11-26

MORE AT Google

I’m coming here many times from last year but always perfect!! Quick serve and friendly staff:)

site_logo

Airi Takizawa . 2024-11-19

MORE AT Google

I grabbed a beef bánh mì for takeaway and was quite disappointed. Spending £10.25 for something that doesn’t resemble a proper bánh mì felt unfair. I was surprised to find it deconstructed – just bread and beef packaged separately. Where were the vegetables? I also tried the lemongrass chicken bánh mì, and while the taste was good, it was mostly salad and cucumber with very little chicken. Overall, I felt a bit ripped off and wouldn’t return for a bánh mì here.

site_logo

K K . 2024-11-17

MORE AT Google

Service is amazing, kind staff, food came within 5 mins of ordering. The food is perfectly seasoned, and so delicious. The bubble tea is very good too. Highly recommend

site_logo

Anna Kolomeyko . 2024-10-28

MORE AT Google

I cannot rave about this restaurant more! Everything was outstanding, from the salt and pepper chips (best I’ve had in the South) to the noodles and the pho. The bao buns and dumplings were also incredible. Amazing value for money.

site_logo

Dimple Visram . 2024-10-26

MORE AT Google

Average service. Unbearably hot inside. Always nice when you see a kitchen staff member use the bathroom and only rinse their hands with water. Food is not bad, I did enjoy the Beef Pho.

site_logo

Francois Blignault . 2024-10-12

MORE AT Google

Been coming here since 5 years ago. The quality of the food has really gone downhill. Ordered rare beef pho for take away today and when I came home the bag and food container was all bloody. Not rare but completely raw, cold meat? Why??? If I knew my lunch would be like this I could've just bitten the cow in my neighbours farm. Also ordered milk tea with pearls and passionfruit tea with lychee boba but you decided to dump all the pearl and boba in the milk tea?? Why?? Why would you serve people food like these? Never coming back here and I do not recommend.

site_logo

Joanne Sam . 2024-10-12

MORE AT Google

Omg!!!! Bes lt noodles 🍜 ever!!! Guys, don't think, just go and try 😋

site_logo

Natalie Soko . 2024-10-06

MORE AT Google

The portion size here is so generous. Really love the pho and the mixed meat fried rice from here. The price is so good for the portion and the quality you get.

site_logo

Vichea Tat . 2024-10-02

MORE AT Google

I tried their lobster pho and it is so bad. The soup has no taste and the lobster overcooked likes rubber. My wife ordered "Bun Bo Hue" and it also tasted likes the chef has no idea how to cook. So If you are looking for an authentic Vietnamese dish, stay away from this place.

site_logo

Harry Phung . 2024-10-01

MORE AT Google

The food here is Okay Okay, but the staff here is uncouth.

site_logo

Vir Pratap Singh Gautam . 2024-09-29

MORE AT Google

Tuvimos un mal día. Fue maravilloso ir a Pho y ser recibido tan cálidamente. El servicio en general fue excelente! Especialmente para Greenwich, cuando usted es un lugareño y a menudo son tratados en otros lugares como un turista con un aire distinto de "no puede ser molestado". Pho realmente era sólo el boleto. Comida fresca, sabrosa y reconfortante con una encantadora introducción a los platos que no habíamos probado antes. El vino también fue un placer. Justo lo que se necesitaba después de quedarse atascado en la M 25 ; lidiar con la calefacción K y T (los peores fontaneros del mundo) y perderse a nuestro perro recientemente fallecido -a quien le hubiera encantado allí- es dog friendly.

site_logo

fionaboundy2 . 2024-09-26

MORE AT TripAdvisor

Great find. Tasty food. Extremely clean place. Great attendants. I highly recommend it!

site_logo

Leandro Guerra . 2024-09-24

MORE AT Google

I arrived late and couldn't set GMT. I am happy to have JMT rice noodles and egg fried rice. It was spicier and better when I ate it with sriracha sauce. Spicy rice noodles (beef) are not very spicy.

site_logo

Vicky koo . 2024-09-15

MORE AT Google

Very unprofessional staff, no respect fordelivery drives, even they are not responding them in a proper way

site_logo

Sadiq Ali . 2024-09-13

MORE AT Google

Comida vietnamita razonable, no excesivamente cara, por debajo del servicio medio. Cené aquí con mi familia. La comida estaba bien, pero no increíble. Las bebidas eran buenas. El servicio era inferior a la media, pero parecían muy escasos de personal. Para una zona turística como Greenwich, los precios no eran tan malos.

site_logo

Alex C . 2024-09-08

MORE AT TripAdvisor

A friend and I came here for a quick meal on a weeknight. The staff were friendly. I thought it was well priced, delicious and authentic. The food came quickly and was inexpensive and fairly priced. I got the rare beef noodle soup and she got some sort of prawn noodle salad. The beef was thinly sliced with a tender texture and I didn’t have to add any extra sauces to the soup at all as it was already very flavourful.

site_logo

Frankie . 2024-09-05

MORE AT Google

It was the absolute worst. My friend and I went there to have good time and were extremely disappointed with the food. I got vegetarian pho and it was just big chunks of boiled vegetables in bland water. It was flavourless. I have had pho at other places and this is not what it tastes like. My friend Got the fried rice which came with uncooked meat and egg. The guy was rude and refused to get a manager. Waste of money. Don’t recommend this place at all

site_logo

Sweksha Jain . 2024-09-04

MORE AT Google

Pho was very good! Worth the price! The restaurant was pretty quiet, everyone talks softly lol! Highly recommend this place and would def come back again!

site_logo

Deborah Kay . 2024-08-31

MORE AT Google

Excelente tazón de fideos con gambas reales. Salí del ferry y necesitaba un almuerzo tarde. Cocinado fresco, gran sabor. El servicio fue amable y rápido.

site_logo

sam d . 2024-08-24

MORE AT TripAdvisor

It's really hard to find a good Pho place in London. Most of them serve Pho spiced up with MSG and it's just a no go. Pho City is serving pretty nice pho, with no MSG and anyone who has ever eaten Pho in Asia will pick up familiar vibes in this place. It's genuine, a bit like one of shops you can find in Jordan, Mong Kok, or Sham Shui Po -- highly recommended!

site_logo

A B . 2024-08-18

MORE AT Google

Friendly staff + decent food, only came here once but i'm going to go again soon.

site_logo

Michael D . 2024-08-13

MORE AT Google

The main dish should be on the salty side Not bad to eat The service was excellent

site_logo

Teresa H . 2024-08-06

MORE AT Google

This was great. Dropped in with kids (5 and 12) and had a very pleasant and tasty meal. Definitely recommend. The bahn mi was out of this world 😋

site_logo

Ben Tanaka . 2024-08-06

MORE AT Google

A nice Vietnamese place offering all the staples. They are baby-friendly but quite busy on the weekends due to Greenwich tourists traffic so you’ll have to wait a bit.

site_logo

Maria Vasileva - Grinfeld . 2024-08-05

MORE AT Google

We’ve been here twice now, both times I can’t fault anything, first time around we had Vietnamese coffee, certainly one of the best tasting coffees we’ve had, wonderfully presented. This time around we ordered food, I had the sweet and sour chicken and my partner had lemon grass pork belly. Both dishes come with rice which is a huge bonus for us. (Usually have to order separately in other restaurants) Excellent tasting good, the pork belly is a must try. Very flavourful, well seasoned and perfectly cooked. Can’t fault the price, very reasonable for London. We will definitely be returning.

site_logo

Calum . 2024-08-03

MORE AT Google

Fun Vietnamese restaurant, great Singapore fried rice, pho was amazing and their beef stew was great. Can't fault the food in any way, will certainly be returning. Went back a 2nd time had an amazing lotus root salad and delicious pho Edit: Back again, and food is still great Edit: tried their ho fun, and it was lovely

site_logo

Chris . 2024-07-29

MORE AT Google

Bleak looking, tasteless food. Poorest looking Pho ever. Staff is not interested. Every time I pass by, it seems they are mostly empty. No surprise

site_logo

Maksim Valiullin . 2024-07-21

MORE AT Google

Not really Vietnamese.. most workers speaks Cantonese and other languages rather than Vietnamese. Most food are base on Chinese takeaway food.

site_logo

Monkey22k . 2024-07-18

MORE AT Google

Superb restaurant, highly recommended.

site_logo

Li Deren . 2024-07-16

MORE AT Google

Se les negó el acceso con perros de asistencia con Id explicamos que era contrario a la ley por igual la ley de 2010 pero aun así se les negó el acceso y un hombre que estaba en el restaurante les dijo que dirige un negocio y que no pueden negar perro de asistencia y que estaban dispuestos ahora a violar la ley

site_logo

Jemma . 2024-07-14

MORE AT TripAdvisor

The fried beef river pot is full of flavor, super delicious and not greasy, and the milk tea is delicious. It is a rare restaurant in London that combines delicious taste, atmosphere and value for money.

site_logo

Ellen Yin . 2024-07-14

MORE AT Google

I recently had the pleasure of dining at an incredible Vietnamese restaurant, and I can't praise it enough! From the moment I walked in, the ambiance was warm and inviting, making me feel right at home. The highlight of the meal was definitely the pho. The broth was rich and flavorful, simmered to perfection with just the right balance of spices. The noodles were perfectly cooked, and the generous portions of tender beef and fresh herbs made it an unforgettable experience. I also tried their papaya salad, which was a refreshing delight. The crisp, shredded green papaya was mixed with vibrant herbs, crunchy peanuts, and a tangy, slightly spicy dressing that brought all the flavors together beautifully. Each bite was a perfect blend of textures and tastes. The Vietnamese spring rolls were another standout. They were freshly made, with delicate rice paper wrapping around a generous filling of shrimp, fresh vegetables, and fragrant herbs. The accompanying dipping sauce was the perfect complement, adding a burst of flavor that made the rolls even more enjoyable. The service was top-notch, with the staff being incredibly friendly and attentive. They took the time to explain the menu and even offered recommendations based on my preferences. Overall, this Vietnamese restaurant exceeded all my expectations. The food was authentic and delicious, the atmosphere was welcoming, and the service was impeccable. I highly recommend this place to anyone looking for an exceptional dining experience!

site_logo

Kamalapriya Ajay . 2024-07-13

MORE AT Google

I am a greenwhich local who’s been to pho street fairly frequently in the ten years I’ve lived here. I have never left a review before but I find consistently the service in this restaurant to be unlike anything else I’ve experienced. I am a teenager who frequents the shop for bubble tea with friends but often also meals with family and friends and it’s become a running joke over how rude the one older male waiter will be when you visit. To name some examples- I came with my friends for dinner for my fifteenth birthday and we acted in a completely calm manner yet this older waiter would repeatedly come over to our table and threaten to kick us out if we don’t all order main courses- something I found off putting despite the fact we were all in the middle of ordering. About a year later I came for dinner with my boyfriend- his card declined due to a faulty chip but it had said that the money for the food was removed from his card despite this. Instead of dealing with this calmly as we were, the older male waiter came across very aggressively as if we were trying to steal his money and heavily belittled my boyfriend for being bad with numbers. It was a very offputting experince. Aside from these more personal encounters we’ve noticed a constant air of agression directed at customers all around the shop. I have witnessed him be snappy and rude multiple mothers with young children as well as well meaning tourists and not because they cause a commotion but because they ask questions like how spicy a food is. I find myself genuinely fearful to go and order the bubble tea that i enjoy so much bevause so much as asking wether something comes with tapioca will evoke a snappy comment such as ‘read the menue yourself.’ I really enjoy the food and particularly the bubble tea which is some of my very favourite in London but the older male waiter is unbelievably offputting and really needs manners as I feel as if I’m being told off in school every time I eat.

site_logo

camillee . 2024-07-08

MORE AT Google

I had been this restaurant 2 times. First time was 4 years ago. This time, I travelled to London for wimbeldon event. I had a lunch with my friends before we visit greenwich observatory. I think their food is acceptable. One of their staffs is quite impolite. He spoke cantonese with us. Anyway, I think it’s my last time to visit this restaurant.

site_logo

Ken Lin . 2024-07-05

MORE AT Google

Food was very bad, one of the staff members rude, bubble tea was okay. Maybe tea is okay for takeaway but certainly not the food.

site_logo

Ani Nalbandyan . 2024-06-29

MORE AT Google

The signature fried rice, spicy pork chop and spring rolls are all satisfying to the whole family. The portions are sufficient and high quality.

site_logo

Byron & Clarice . 2024-06-29

MORE AT Google

Very hostile staff, dirty tables and food is bland and tasteless, not to mention 2 of us were sick after eating there 🤢 when this was reported they were not even apologetic. Avoid!

site_logo

Candice Freeman . 2024-06-25

MORE AT Google

😋 delicious,definetly coming back

site_logo

Marius . 2024-06-23

MORE AT Google

my friend was refused service due to disability, guide dog (even after showing certification) refused entrance. insane

site_logo

Juan Camacho . 2024-06-17

MORE AT Google

Kind staff and delicious food, a hidden gem!

site_logo

Caitlin O . 2024-06-12

MORE AT Google

It sad to see the food quality of your favorite place gone down hill

site_logo

Phuong Anh Pham . 2024-06-06

MORE AT Google

Takeaway quality food served on a plate. The ingredients used in the dishes are takeaway-level, ie cheap and low-quality. The vegetables are unchewable and the dish is 90% rice. The noodles taste the same as instant noodles. We were tricked by the freshly prepared mint and beansprout sides on display neatly in a row at the entrance to the restaurant, they gave a false impression of fresh ingredients, when in fact the rest of the ingredients are either frozen meat/veg or dried instant noodles. All the customers are probably just tourists coming for the first time.

site_logo

Weili Dai . 2024-06-01

MORE AT Google

The soup river is quite good, the taste is moderate, hot enough, plenty of beef, and the portion is sufficient.

site_logo

Winnie Tsui . 2024-05-30

MORE AT Google

This restaurant locates in Greenwich and definitely is a hidden gem! It has got many choices for Vietnamese cuisine and also Chinese cuisine. And the portion is large. The staffs are super nice and the dining tables is quite cozy to sit in. Most importantly, there is NO service charge required. Their Chinese food reminded me of my home town Hong Kong as it tasted so alike. Drinks are very refreshing too. Very suitable for such a warm day today. Food: - Beef black beans sauce Hon Fun -Salt and pepper spare ribs - Mixed Meat Noodle in Soup Drink: - Good Pho U reg - Tropical Blast Located in Greenwich, this restaurant is an absolute hidden gem! There are many Vietnamese and Chinese dishes to choose from. And the portions are huge. The staff were super friendly and the table was comfortable to sit at. Their Chinese food reminds me of my hometown Hong Kong because the taste is very similar. The drinks are also very refreshing. Perfect for a warm day like today.

site_logo

Judyarr W . 2024-05-27

MORE AT Google

Pho street takeaway experience was fantastic! The Pho Ga and Pho Bo were both flavorful, and the papaya salad was fresh and satisfying. Highly recommended for authentic Vietnamese cuisine.

site_logo

Linus . 2024-05-25

MORE AT Google

The food came very quickly. The restaurant is very nice and quiet. The food was inexpensive and really incredibly good, the best I've eaten in London. Really worth seeing. And extremely tasty.

site_logo

Nico Piereth . 2024-05-20

MORE AT Google

Spring rolls were way too overpriced for what you get. £8 for three thin spring rolls which were overly greasy and definitely not worth £8 Very stingy with the meat with the pho aswell. Two prawns about 3 thin pieces of beef and 2 chunks of chicken. 90% of the rest is noodles and then the broth which did taste good. However I don't think I should be charged £14 for mostly broth and noodles with a bit of meat. Too expensive. Pho needs a lot more meat to justify the price. Felt like I got ripped off which ruined my enjoyment of the meal.

site_logo

Shane Bobey . 2024-05-19

MORE AT Google

Fast and good value Vietnamese in a modern casual atmosphere.

site_logo

Dan O . 2024-05-16

MORE AT Google

tasty Order the raw beef pho The beef will not be too raw in the soup It is recommended not to order it well-done. The spices are good enough And my favorite hot sauce Awesome

site_logo

Sha Sha (Shasha) . 2024-05-15

MORE AT Google

Amazing hidden treasure, great people even better food

site_logo

Taliq Kihondo . 2024-05-13

MORE AT Google

Been there so many times and the spicy prawn vermicelli is always the choice! Authentic food with friendly staff.

site_logo

Clara PK . 2024-05-12

MORE AT Google

Our go-to when in Greenwich. Nothing particularly special but reliably tasty and the salt and pepper chicken wings are very more-ish. A bonus is that they serve fresh iced and bubble teas.

site_logo

Darren Gee . 2024-05-12

MORE AT Google

Delicious, authentic and great value. The green papaya salad was excellent, and I was so pleased with the banh mi. The baguette was crunchy on the outside and soft on the inside, and the fillings were fresh and full of flavour.

site_logo

Stu Prince . 2024-05-11

MORE AT Google

Customer service was poor. The man who took my order was very snappy / rude when I was asking very basic questions about the menu. Seemed like he was having a bad day, which defo put a damper on the experience. I regret not leaving there and then. Food was just average, nothing special.

site_logo

Dillon Thompson . 2024-05-10

MORE AT Google

Very good cuisine We took Singapore fried rice: spicy Pho Bo: excellent juice, a little too many noodles Bo bùn Hue: spicy Bùn cha: perfect 65€\4 people London rate

site_logo

ⵛⵀⵔⵉⵙⵜⵓⵒⵀ . 2024-05-09

MORE AT Google

Chickenwings where roasted nice from the flavours but only the middle part of the wing not worth the price. Hofun was nice in flavour missed some green colour like coriander or springonion no love. The broth wasn’t cooked long enough no enough meat flavour uncle Roger would say no msg inside. Spicy rips perfect prepared with love and passion.

site_logo

Giuseppe Varca . 2024-05-08

MORE AT Google

We had an awesome experience with pho street last night. We was a Chinese family of 4 adults, 1 child and 2 toddlers. They looked after us so well, they have baby child’s and children plates and cutlery The food was really good and authentic !!!! Portions was really good, we recommend the pho ga and wonton noodle soup We had : Pho ga awesome Wonton noodle soup very comforting Sweet and sour and rice great Rice and 3 meats great Summer rolls great Vietnamese spring rolls great Bubble tea great Garlic and broccoli awesome Price was very reasonable for the size of family As a family we shared all the dishes They have a nice huge table in the centre rear of restaurant Dishes came out very quick about 15 minutes after ordering. Which helps with hungry children Toilets are clean and well maintained Most importantly we had a screaming toddler and they accommodated us very very well. If you have children this is a nice safe resting place for food Thank you the uncles and aunties at pho street

site_logo

Vwgti888 Vwgti888 . 2024-05-06

MORE AT Google

Overall good. Did not like the dessert.

site_logo

Pushkal Agarwal . 2024-05-05

MORE AT Google

The healing meal we had in London after we had a long walk in Greenwich Park. Phos and buns are so great. The salt and pepper prawns and spare ribs are surprising. Milk teas are good since not so sweet. However the honey green tea is a little too sweet but I forgot to ask if the sugar can be adjusted. Boss is nice and helpful.

site_logo

Chenyu Yin . 2024-05-01

MORE AT Google

Great rare beef pho. Generous with the noodles, hot and tasty broth, well sliced beef, variety of fresh sides (basil, mint, bean sprouts, red onion, chilli). Would definitely come back (visiting from Australia).

site_logo

Alan L . 2024-04-27

MORE AT Google

The pho was okay, nothing special.

site_logo

Attila Ulbert . 2024-04-24

MORE AT Google

Small portions, bland broth and worst of all I also found a hair in my food. I took this to the owner (I think?) and was unapologetically rude and shouting. Would never come here again when there are so many other local gems in the area.

site_logo

William Chong . 2024-04-21

MORE AT Google

Great food for uni days. Just a bit of feedback- would love to be able to order extra broth. Also would be good if noodles (when ordering delivery) would have a little bit of oil on it to prevent sticking!

site_logo

Viktorija Stankute . 2024-04-21

MORE AT Google

Cold chewy meat after waiting a while for crispy pork baguette. Meat wasn’t quite right at all and had to be left

site_logo

Katie abrahams . 2024-04-16

MORE AT Google

Been here 3 times in 10 years. I always leave very underwhelmed and somewhat regretful. I’ve been to Vietnam several times and also other amazing Vietnamese restaurants in London so I can say the food taste and quality here is just not that great. Papaya salad was horrendous, salt and paper squid was greasy and super chewy, noodle salad was bland, grilled chicken was a yellowish colour. It’s close to the park so I guess they’re quite complacent as they’ll always get the flow of customers. I’d only recommend if you’re really hungry and have nowhere else to go. There’s another smaller Viet place down the road on Trafalgar Rd which is nicer.

site_logo

Bhawana Rai . 2024-04-13

MORE AT Google

Amazing atmosphere with the greatest owners I've ever met. Definitely the best place I've ever been to.

site_logo

Normal Doggie . 2024-04-10

MORE AT Google

Very nice restaurant, has a good vibe and great food. 10/10 service and lovely people. I would love to come again.

site_logo

Doodoo . 2024-04-10

MORE AT Google

Tasty food, great service, welcoming atmosphere; will eat here again and tell others about it!

site_logo

Jasper Livingstone . 2024-04-10

MORE AT Google

Everything is okay, except manager behaviour. So rude

site_logo

Tanvir Islam . 2024-04-03

MORE AT Google

The pho was literally just boiled water poured over noodles, carrots and beans. It had no flavour whatsoever and I did not eat it. We spoke to the waiter and cashier and they offered no refund. The side broccoli was over boiled and falling apart. The summer rolls again no flavour, the dip no flavour. I do not recommend. 1 star for food is an overstatement. Very disappointing. £11.50 for boiled water and noodles. No thanks

site_logo

Olivia Negrean . 2024-03-23

MORE AT Google

Good food and nice atmosphere!! Love their seafood starters, however i do find their chicken dishes to have a certain taste that i wasn’t fond of. Very neat and clean place so will visit again xx

site_logo

Pri . 2024-03-18

MORE AT Google

Had a Vietnamese coffee as I’ve been looking for one near to me. It was really not very nice. Tasted like saccharine and really watery. Not the chocolatey velvety drink I know. Won’t be back.

site_logo

Brian . 2024-02-19

MORE AT Google

We had a really good meal at Pho on Greenwich. The bubble tea was very good and enjoyed by my children. The food portion sizes were very good. We all enjoyed our food and we didn't have to wait too long for it to arrive. The prices felt fair for what we got.

site_logo

Victoria L . 2024-02-16

MORE AT Google

Great little eatery with delicious and freshly made food. Excellent selection of drinks too - and the customer service fantastic. Steve and his crew looked after us and I recommend this restaurant highly if you fancy some Vietnamese cuisine!

site_logo

SimonLovesGolf . 2024-02-13

MORE AT TripAdvisor

Upon being seated at our table, we noticed the table was sticky. The table behind us also found this and wiped it down with their own wet wipes, they didn't stick around for a meal, they left. The food was ok, portion sizes seemed small. We've had larger amounts for the price paid in London. The large bubble tea was a sizable drink but some bubbles seemed overly soft. After we had finished eating, the waitress was clearing our table as her coworker was telling her to hurry up. She said to me they needed to clean up quickly as it gets busy. I said sure that's fine. Then I heard the coworker, not in English, shout over to her to 'tidy first then talk' which I thought was quite rude. This restaurant used to be so much better and I would come here everytime I visisted Greenwich. Unfortunately I won't be returning here in a hurry.

site_logo

Mandy P . 2024-02-12

MORE AT Google

Pho well done Beef tasted amazing as well as then pork chop with rice meal we ordered. The salt and pepper squid is soft which isa really good thing. Will definitely go back here.

site_logo

Laura Litam . 2024-02-04

MORE AT Google

Absolutely perfect food! I went in with a headache, got Singapore fried rice and now... the headache is gone hahaha. Seriously, this is a wonderful place to eat! THANK YOU!

site_logo

Norberto Amaral . 2024-01-26

MORE AT Google

Similary restaurants in London

restaurant_img
3.8

2806 Opinions

location-icon10-11 Nelson Road, Greenwich, London
Asian
outdoor_seating_78667takeaway_78667delivery_78667

ordered pork dim sum which did not taste great, they were very small and looked like sausages? the chicken noodles were tasteless.

restaurant_img
3.6

345 Opinions

location-icon21-22 Elm Ter
Asian
outdoor_seating_74036takeaway_74036delivery_74036

How this place has changed.. it used to be great value with good service. Now.. under cooked food,Pork!! I mean still cold in the middle, with no concern from the staff. Asked to remove from the bill, still added on.. got quite upset when challenged.. unbelievable wine prices.. this place needs a new owner or to be turned into flats!

restaurant_img
3.9

308 Opinions

location-icon9-10 Stratheden Parade
Asian
outdoor_seating_114645takeaway_114645delivery_114645

Average experience. The food was all right in terms of taste, but somehow, we felt it wasn't authentic. The atmosphere and service were average. We tried a few dishes and didn't order more because they weren't authentic enough for us. If you're not bothered about authentic Chinse but want food with a Chinese vibe, this is an ok place. I wouldn't visit again, though.

restaurant_img
3.5

973 Opinions

location-icon17-19 Nelson Road
Asian
outdoor_seating_73308takeaway_73308delivery_73308

It's nice inside. The food is ok. Pretty much what you'd expect from a big chain. A good place for families with a nice conservatory out back. If you're looking for a nice place to go in Greenwich you could find better.

restaurant_img
4.0

518 Opinions

location-icon69 Well Hall Road
Asian
outdoor_seating_76243takeaway_76243delivery_76243

Excellent food, excellent service. That says it all!