GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4,0

Based on 878 opinions finded in 2 websites

3.5Ambience4.0Cuisine3.5Price4.0Service
site_photo4

Nº 1557 in 3097 in Leeds

Nº 3 of 4 Vietnamese in Leeds

CUSTOMERS TALK ABOUT DISHES WITH.. noodlesporkbrothsquidcookedmeatballsspicycurryricesaladprawnchickenmeatfriedsoup

comment_iconOpinions

I dinned here tonight with a close friend. The service was incredibly quick and attentive. Our server was super helpful - recommending dishes and house favourites. Food as the title suggests, was incredible. I’ll be back again at the earliest opportunity!

site_logo

Yasmine W . 2023-09-27

MORE AT TripAdvisor

Been eating Pho for over a decade, with a lot of love for the tasty food normally on offer but with kids in tow on this occasion - I wouldn’t recommend. The noodle option on kids menu was bland and no option to add flavour. Juices were fresh and great combos, which rescued this rating.

site_logo

tommyb079 . 2023-08-10

MORE AT TripAdvisor

Came here as the kids love the beef pho. I opted for the green papaya salad and was very disappointed. I do not believe the dish contained all the essential ingredients that make this a spicy vibrant salad. There was also way too much coriander. Coriander is a garnish not a vegetable.

site_logo

Sari S . 2023-08-06

MORE AT TripAdvisor

Decided to try something new in Trinity Kitchen today so went to Pho and ordered the Chicken and Shrimp fried rice at £8.95. After a wait of over 10 mins the buzzer went and off I went to collect my lunch. What a disappointment to say the least. The portion size was tiny in an oversized box with a green leaf on the top.The rice was salty and greasy and couldn't find the dried shrimp and there was hardly any chicken either.I believe in leaving positive feedback but this eatery does not deserve it.In fact it spoilt my shopping trip with my daughter!

site_logo

lynncY8195QX . 2023-07-29

MORE AT TripAdvisor

All the staff are friendly and the front desk staff are friendly and have a very professional and friendly customer service.

site_logo

Vladimir D . 2023-07-09

MORE AT TripAdvisor

Fancied something different before heading to a concert…. Well, 35 minutes after ordering it arrived- giving us 5 minutes to eat it before rushing off. Place wasn’t even busy! Don't even think they’d started making it until we complained. Won’t be going again.

site_logo

John C . 2023-07-07

MORE AT TripAdvisor

Extremely underwhelming. Can't recall the last time I felt so disappointed after ordering food. Arrived at 11.20 to be told not taking orders before 11.30 even though website states opens at 11am. Didn't have any rice bowls which is why I went. 20 minutes after ordering my order was ready. Don't understand what took so long when everything I ordered would take literally 2 minutes to cook or just need 'plating up'. Glad it wasn't busy. Baby Squid was cooked nicely (crispy coating and tender squid) but the baby Squid was also a baby portion for >£6. Chinese leaf was also a tiny portion (about 2 leaves chopped into tiny pieces) for >£4 and was swimming in the saltiest, cheapest tasting soy sauce. Beef brisket Pho - the soup base had some flavour but was far from amazing yet the beef itself somehow was devoid of taste. Overall I could have made it better myself for 2 people for half the price. I wouldn't recommend and won't return. Lesson learned.

site_logo

Adam R . 2023-07-05

MORE AT TripAdvisor

Visited for my friends birthday lunch have to say we are never disappointed with the range of food as well as the service here. I had the chicken curry and spring rolls. The service is quick, staff are always happy to advise on some of the dishes and its always good value. Cant wait to return

site_logo

97gaile . 2023-06-09

MORE AT TripAdvisor

Ordered 8 starters, got 7, one wasn’t added. 2 mains, the mains were actually fine, as obviously made last. All 7 starters were stone cold. 2 were supposed to be cold. The rest were NOT. Firstly, l asked about the missing starter, manager offered prawn crackers, declined! Said l hadn’t ordered. I did, but it wasn’t on my receipt as the server didn’t add it to our order at the time! My kids are too young to complain , so by the time this got sorted, the squid 🦑 was stone cold. I took mine back. 20 minutes later, after rest of everyone had eaten, l got semi frozen temperature squid sent back! The Rice rolls apparently taste of Kerosene. Got given prawn crackers despite not asking or wanting them and no actual apology for cold inedible food. £70 waste of money. This place used to be fantastic for baby squid. It was rank in my opinion now. So disappointed.

site_logo

SwintonParkSpaFan . 2023-06-06

MORE AT TripAdvisor

Great restaurant in Trinity Kitchen. Had a great experience and particular thanks is due to Alice, one of the staff members there, she was really helpful and had a really pretty smile. Will definitely eat here again!

site_logo

Traveler50792299401 . 2023-04-29

MORE AT TripAdvisor

Terrible. Don’t normally feel need to review but the Beef broth literally smelt and tasted like old dish water. 5 bites is all I could take… charged £9.25 for the pleasure as well. Avoid.

site_logo

Danny B . 2023-04-13

MORE AT TripAdvisor

Brilliant! Very delicious, never disappointed with a Pho lunch! We had chicken thigh rice bowl, papaya salad, chicken curry and pork crispy spring rolls to start. Can't fault it, quick service even though kids are on half term, all food cooked fresh and good value. Always nicely presented. Highly recommended.

site_logo

YorkshireWrights . 2023-04-03

MORE AT TripAdvisor

First of all I was given a buzzer to collect my food, however it never buzzed and after about 15 minutes of waiting I decided to see where my food was and it was just sat on the side waiting, Also the portion sizes were not rather big considering price you pay. The food it self was not the best and there are much better places to eat in the trinity kitchen.

site_logo

Ben M . 2023-02-28

MORE AT TripAdvisor

Purchased the chicken stir fry and got the mushroom one…couldnt even call back to complain as it was after closing time by the time i saw when i got back to the hotel…absolutely heartbroken. Didn’t even eat it…such a waste of my money…I literally didnt even eat because of this mistake. I have the receipt which highlights it should have been chicken as well!

site_logo

sabrinareviews . 2022-11-26

MORE AT TripAdvisor

Busy Leeds - lots of choice in the Trinity but wanted to try Pho for a while. We did have a little wait but i think all the food is cooked fresh so was definitely worth it! We had the spring rolls to share which were delicious. I had the chicken curry and it was soooo tasty! My husband had the beef one which was nice but not as good as mine!

site_logo

K8613GYsamanthac . 2022-10-03

MORE AT TripAdvisor

We went to visit this restaurant for dinner and there is an Asian woman take our orders. We tried to know more about the menu so that we can order the foods. that oriental staff gave us very nasty attitude and being rude. After we...

site_logo

mlB6070AQ . 2022-08-29

MORE AT TripAdvisor

I had the chicken curry yesterday and honestly, it was the most delicious thing I have eaten lately, the staff were great, efficient and friendly, next time I go to Leeds it's on my must do list. I never write reviews but this experience was...

site_logo

D2773AZrobertg . 2022-08-07

MORE AT TripAdvisor

Waste of a £8.50 don’t buy the chicken , teeth were sticking together it was that dry. Don’t come here not worth the money.

site_logo

230burnera . 2022-06-24

MORE AT TripAdvisor

For the second time I’ve had a salad from Trinity Pho that has been grainy/ gritty with dirt on it. I get that this can happen with salads but it ruins a meal! Also i ordered the vegan papaya salad and I paid the same...

site_logo

KamalaEJT . 2022-06-17

MORE AT TripAdvisor

Lovely staff, food fresh and good, not fantastic but very good, I had fish noodle soup, but sure I only got about 5 prawns? Maybe I ordered the wrong thing, hubby had chicken noodles, he liked but he’s also had better, looked popular with deliveroo

site_logo

987flix . 2022-06-07

MORE AT TripAdvisor

Went for first time with my daughter won’t be going again . Chicken noodles was horrid no chicken only gristle noodles mushy . And plate off horrid spring rolls . Yuk what a waste of £27

site_logo

JanetH1890 . 2021-10-18

MORE AT TripAdvisor

Absolutely my favorite Pho in Leeds! Came with fresh ingredients to add extra flavor and crunch! Nice thank you card sent with it too! 👏🏼👏🏼❤️

site_logo

TeenaLyle . 2020-10-17

MORE AT TripAdvisor

Went today for the first time, like Trinity Kitchen for the options but usually go to another outlet as a standard. Really glad I tried Pho, had the summer rolls with peanut sauce, fried squid, and pork rice bowl. All really good, came fast, loved...

site_logo

jmstevens83 . 2020-09-22

MORE AT TripAdvisor

Ordered the Pho Xao w/ chicken. Noodles had a very off putting smell to them. Very little chicken in the dish. Portion was small and quite expensive.

site_logo

williambX9186PL . 2020-08-28

MORE AT TripAdvisor

Just a plate of very salty sticky rice served as fried rice. Will not be dining here for sure. It gets its customers because of the location and convenience.

site_logo

laclee01 . 2020-02-03

MORE AT TripAdvisor

Visited today after a really great previous experience (had my first ever Pho here a couple of years ago) had the steak pho, which was disappointing. It tasted ok, but there seemed to be a lot of excess oil in the broth. I tried to...

site_logo

452kirstyt . 2020-01-25

MORE AT TripAdvisor

Great food and quick service. What more can you ask for? The beef brisket curry was delicious, as were the summer rolls. My second visit here and it won’t be the last!

site_logo

Rezefd . 2020-01-24

MORE AT TripAdvisor

This eating place is in the bang average trinity kitchen space. Its kind of identikit Leeds, trying to be cool when it dosen't know the meaning of the word. I went for the king prawn vermicelli noodles (spicy). They are supposed to be served 'room...

site_logo

StevieGBradford . 2020-01-21

MORE AT TripAdvisor

I would 100% recommend this place. It’s the nicest place to eat in Trinity kitchen and always will be. Vegan and vegetarian options available. Quality of food is excellent and presented perfectly. I always get a fresh juice when I go too which are amazing....

site_logo

deena1991 . 2020-01-19

MORE AT TripAdvisor

Amazing food with loads of options at a low price. great if you're a carnivore or fully vegan! Despite it being busy we waited less than 10 mins for our food which was a pleasant surprise. The relaxed atmosphere and location makes an ideal for...

site_logo

sarahdean494 . 2020-01-06

MORE AT TripAdvisor

Esta habrá sido nuestra tercera vez en PHO en Trinity Kitchen Leeds y nunca deja de complacernos. ¡Después de esta visita se hizo evidente que nunca hemos dejado una reseña! ! !Mi compañero pidió sal y pimienta y para la carne principal Pho y yo pedimos tofu al curry vietnamita. (Si había algo que tenía que elegir, estoy seguro de que la última vez no tuve que pagar por champiñones o frijoles para agregar al curry. Esta vez fue 1 por cobertura). Independientemente de que valió la pena! ! !

site_logo

_loveoffood_95 . 2020-01-05

MORE AT TripAdvisor

Gran cena rápida en Leeds. Fideos frescos y sabrosos. Fantástico, jugo fresco. Servicio rápido y amable y a buen precio.

site_logo

Rezefd . 2019-12-15

MORE AT TripAdvisor

A lovely restaurant, great atmosphere, friendly staff, good service, I recommend this 10/10. Plenty of choice, gluten free on many dishes.

site_logo

Doreen L . 2019-11-08

MORE AT TripAdvisor

If you've been to Trinity Kitchen but not visited Pho then you are missing out, even more so if you have Coeliac then you are in for a real treat. Most of the menu is gluten free and the area itself is immaculate. The quality of food is excellent and the portion size is more than enough. Can't wait to visit again.

site_logo

Tillie C . 2019-09-24

MORE AT TripAdvisor

Came to Leeds with one of my daughters and needed some food before hitting the shops.

site_logo

Clachangirl . 2019-07-30

MORE AT TripAdvisor

Came here with the family for a quick lunch as I enjoy the Pho in Birmingham. The food here was no where near as good. The spring rolls were burnt and had to return them. My sister got a bowl of Chicken Pho which had too much salt in. I ordered the iced coffee which lacked taste and to top it off had large bits of coffee granules in (see attached photo). Will definitely not be coming back here.

site_logo

Jffoodie . 2019-06-19

MORE AT TripAdvisor

Went twice during a two day stay in Leeds and both times we found the food fantastic, great buzz and atmosphere in the food court and would definitely recommend.

site_logo

Honestfoody1001 . 2019-06-06

MORE AT TripAdvisor

Tuvimos un buen almuerzo en Pho. Cada comida envasada en un montón de sabor. Las verduras crujientes hacían que todo se sintiera fresco y liviano, en lugar del estilo a veces más pesado de algunas comidas asiáticas. El menú dejó claro qué alergias fueron atendidas. Tuvimos una amplia variedad de platos sin gluten y opciones veganas que solucionaron la alergia al huevo y al cerdo de uno de nuestro grupo.

site_logo

C4880TIpeters . 2019-05-22

MORE AT TripAdvisor

Fui a Pho en la Trinidad de Leeds hoy y fui atendida por una mujer llamada Alexis. Sus habilidades de servicio al cliente son terribles. Ella y mi pareja nos hicieron sentir incómodos cuando sugerimos que diéramos números para la comida en lugar de los nombres de ellos. Ella hizo como si fuera una tarea correcta. Muy agria, no es nada amigable. En una nota más ligera, la comida era muy buena y sin duda volveremos.

site_logo

Allymaw92 . 2019-05-06

MORE AT TripAdvisor

Hoy estuve en Leeds y realmente me apetecía un Pho. (Vivo en Londres) Así que el viejo google me avisa que hay un Pho y está a 5 minutos de la estación.

site_logo

Tom L . 2019-04-24

MORE AT TripAdvisor

Pho is one of the best for gluten free food, good portion size, clean, fast and always gorgeous! Thank you for having plenty of choice and not all vegan which sadly loads of gluten free options elsewhere always seem to be!

site_logo

Tillie C . 2019-04-13

MORE AT TripAdvisor

I was a little bit dubious at first as I read some of the older bad reviews which are a load of rubbish as we were blown away at how good it was, I thought the food was delicious and really tasty! We are from Manchester and are a big fans of Tampopo and Thaikhun and were looking for something similar and we found it! This will be a meal I’ll be craving in a few days time and I can’t wait to come back!

site_logo

rachelk189 . 2019-04-02

MORE AT TripAdvisor

Seems like the staff have been trained in customer service as there no longer seems to be staff who talk to customers rudely. Initially I was with a friend when I first experienced this situation and I was not dining on that occasion. This occasion I did, The fresh rice paper summer rolls are nice and vibrant, fresh and tasty, this was followed by flash fried steak and garlic Pho, plenty of garlic and meat, the soup base was delicious, definitely the best Pho I've tried in leeds. Timing is crucial as trinity kitchen gets rammed easy so you should be ok with seating as this place has its own designated area. Good food, improved service, well done.

site_logo

HungaryGiant . 2019-03-25

MORE AT TripAdvisor

Love this place when wanting some quick but tasty to eat!! the veggie spring rolls are to die for and the fried rice is just amazing! give it a try- prices reasonable too!

site_logo

KAT2734 . 2019-03-23

MORE AT TripAdvisor

There’s always a queue here at lunch time, so arriving early and seeing only one person in line I took my chance to try this place out!

site_logo

meryll83 . 2019-03-15

MORE AT TripAdvisor

Ill get the negative out of the way first. It is pretty expensive, especially when you consider the prices you pay for the same meal in Asia, but i'm obviously not to disheartened by that. It is just very noticeable LOL.

site_logo

GetHiggyWithIt . 2019-03-05

MORE AT TripAdvisor

Came to The Trinity Kitchen on a rainy Saturday night. Always like Beef Pho so decided to give it a punt. First thing was the queue, probably 20, which moved very slowly. Ordered a steak Pho, morning glory with garlic and spring rolls. Was told that they had run out of beef stock and would chicken do, reluctantly I accepted. Took my food pager and waited around 10 mins for food to be ready. See attached picture of what came. Where's the Pho? I got HALF a take away container bowl of something murkey! The "steak" was like old boot leather in taste and texture. The spring rolls were over fried to the point of being burnt, strategically placed on the underside so could not be seen! Saving grace was the morning glory and garlic Very disappointed for parting with £17 quid. Go elsewhere!

site_logo

. 2019-03-04

MORE AT TripAdvisor

I could eat the food from here all day! Only wish the food didn't come on disposable plates, then I'd be giving 5!

site_logo

. 2019-02-26

MORE AT TripAdvisor

Fun by the bowl Vietnamese street food. Not cheap but worth a try. Popular but soon served, so the queue soon dies down.

site_logo

. 2019-02-19

MORE AT TripAdvisor

I come here from time to time. My only comment and reason for 3 stars is the pho soup. It definitely taste different every single time.

site_logo

. 2019-02-14

MORE AT TripAdvisor

Quick bite for just under £27 for 2 is maybe a little expensive. Tasty was very plain and didn’t transport me back to Vietnam at all. Beer wasn’t particularly cold either . My only positive was the spring rolls that were delicious.

site_logo

. 2019-02-11

MORE AT TripAdvisor

Food was tasty but very disappointed to see the use of take out packaging even when eating in, not very environmentally friendly, very wasteful

site_logo

. 2019-02-10

MORE AT TripAdvisor

I've visited Pho for food many times and it never disappoints. The food tastes amazing, the staff are really friendly and the menu has a lot to offer.

site_logo

. 2019-01-31

MORE AT TripAdvisor

We were going to eat at a usual eatery when we stumbled upon Trinity Leeds. We chose Pho and enjoyed the food which was pretty healthy and filling at the same time. Recommended

site_logo

. 2018-12-29

MORE AT TripAdvisor

Took 30 mins to cook a portion of fried rice and some noodles. Supposed to be quick as from the wok. Ridiculous wait.

site_logo

. 2018-12-22

MORE AT TripAdvisor

Really delicious and unusual flavours and lots of choices for vegans. Not the most ambient dining experience, but a great healthy fast food option before a cinema date or after a busy day's shopping. the rice paper rolls and noodle soup were especially delicious.

site_logo

MangoLycheeA . 2018-11-15

MORE AT TripAdvisor

Muy satisfecho con las opciones veganas disponibles, pero me decepcionó el tamaño de la porción pequeña (arroz frito con champiñones shitake). El spritzer especial de la casa era demasiado caro para una pequeña taza de agua de soda y no tenía sabor a mucho más. Pedí una alternativa al tenedor de plástico de un solo uso y me ofrecieron una cuchara de plástico de un solo uso. Mi spritzer fue servido en un vaso de plástico con una pajita de plástico. Un miembro del personal me dijo que todo se reciclaba, así que me llevé a mi casa para tratar. No volvería a comer allí de nuevo.

site_logo

SpinalTaff . 2018-11-14

MORE AT TripAdvisor

Tenía los rollitos de primavera de cerdo seguido de pollo y cerdo wok fritos fideos. La presentación de la comida era pobre. Parecía que me gustaban los fideos que se habían tirado en el plato. En cuanto al sabor, estaba muy condimentado y fue una gran decepción. Hay mucho mejores lugares para comer.

site_logo

mffn . 2018-10-26

MORE AT TripAdvisor

My better half has been craving some genuine Vietnamese Pho for ages, and we finally found a place that scratches that itch! Reasonably priced, thoroughly delicious and easily the best I've had in a long time :D recommend to anyone

site_logo

murryl2015 . 2018-10-20

MORE AT TripAdvisor

Just has the tender beef noodles. The amount of salt was overwhelming and I couldn’t eat it. The beef was like boot leather.

site_logo

simonaidan . 2018-10-07

MORE AT TripAdvisor

Es un accesorio permanente en Trinity Kitchen con buena comida vietnamita de la calle. Tienen su propia área de asientos, lo cual es genial si quiere quedarse y comer, o sentarse mientras espera que su comida esté preparada. Tienen una buena variedad de opciones veganas, ¡y la comida que comí estaba deliciosa! El tofu fue preparado muy bien, y los jugos frescos son deliciosos. El personal era muy amable, gran experiencia! Volvería:)

site_logo

hypnotism . 2018-10-06

MORE AT TripAdvisor

I want to like Pho so much because they have a good range of vegan food, but continually their attention to detail lacks. I ordered the summer spring rolls (Gòi Cuõn) and a salad (Gòi Chay) and ordered it via Deliveroo. The salad was in edible because every mouthful I could taste grit and sand and dirt between my teeth. I contacted the Deliveroo chat line and was told that apparently it was my ‘personal taste’?! Had I have been in Pho, I would have taken it back immediately - there is no excuse for not washing salad properly. I picked these grains out in the picture which is not personal taste! Don’t get me wrong I know all fresh food can have this, but the scale of this made it inedible as the grains were in every bite.

site_logo

KamalaEJT . 2018-09-16

MORE AT TripAdvisor

Went to Pho for lunch with my husband on a busy Saturday. We queued for ages to order and waited again for food. The food was average. Some nice flavours but not really worth the money. The drinks were very expensive as well. A shame as it always looks lovely, though perhaps we both ordered not great meals. It’s worth a try but I don’t think we will go back again.

site_logo

natalielonglegs . 2018-09-08

MORE AT TripAdvisor

Decent choice of vietnamese dishes. Had the chicken pho, chicken was a touch on tbe bland side but noodles and dressing was tasty. Just under 7 quid. Nice selection of Vietnamese beers as well.

site_logo

yorksboy127 . 2018-08-30

MORE AT TripAdvisor

We visited on a busy Saturday to try out the Vietnamese Pho. It was the first time I tasted the dish and I really liked it. I will come back in the future. Service was good as well as the portion size. Would recommend it to everyone.

site_logo

V_Jaksics . 2018-08-26

MORE AT TripAdvisor

Love the food from here. I like my food very spicy which is good as a lot of the dishes here have quite a kick. Have been multiple times, very authentic and tasty

site_logo

Tabitha D . 2018-08-20

MORE AT TripAdvisor

Ordered veggie summer roll and after eating two realised they had prawn in. As a vegetarian obviously I was annoyed & when I took them back they just acted surprised that I wasn’t happy & asked what exactly I wanted. I said I didn’t want a replacement so they offered the £3.50 by the manager in a completely rude way as if I was an inconvenience. This place has gone massively down hill & the service is shocking. Especially the guy with blonde hair & an American accent.

site_logo

Sarah E . 2018-08-11

MORE AT TripAdvisor

I ordered the Super Green pho which consists of morning glory, green beans, pak choi, fresh lime & Thai basil in veggie broth with garlic. I added chicken to it and it was delicious!! I also added lime juice for extra flavor. I will come back to order this again

site_logo

DaisyNJud . 2018-07-10

MORE AT TripAdvisor

Com Tam Rang rice with chicken is delicious and the staffs are friendly. Their fresh-made juice is quite good too.

site_logo

Alice C . 2018-07-01

MORE AT TripAdvisor

While shopping in Leeds, I came across Trinity Kitchen, a collection of funky food outlets and was extremely pleased to find this restaurant. There aren’t many things as satisfying as a delicious bowl of Pho- Vietnamese noodle soup. On the menu they have different broth options - Beef, chicken and veggie, and various protein options . I chose some Vietnamese spring rolls to start- 3 rolls, full to bursting with delicately spiced pork , veg and herbs, and with a choice of dips -I chose chilli/shrimp paste.

site_logo

joemcgann . 2018-05-05

MORE AT TripAdvisor

Three of us The other two were more happy than me. I was not impressed with the taste, the portion size or the temperature of the food. Tried Vietnamese coffee. Nice but tiny.

site_logo

Graham J . 2018-04-26

MORE AT TripAdvisor

I had to pay extra for rice and the order should have come with broken rice as standard. Menu item no 13. Cari chicken

site_logo

pbraekevelt . 2018-04-12

MORE AT TripAdvisor

My drink and lunch cost me £8.60. The portion is small and I am still hungry. Thought I’d give this place a try. Sorry be I won’t be returning.

site_logo

mstephens . 2018-03-26

MORE AT TripAdvisor

Ordered the chicken noodles and was delicious but £1.70 for a can of coke is taking the Michael. Staff were miserable as hell as well.

site_logo

Shaun H . 2018-03-16

MORE AT TripAdvisor

I had the green spicy pho with chicken and it was so delicious. It was spicy and had a good flavor to it. The service was great. We will come back to eat here.Perfect for a cold and snowy day!

site_logo

DaisyNJud . 2018-03-06

MORE AT TripAdvisor

If you like bad food go here. I’d say bad Vietnamese food but this food doesn’t vaguely resemble Vietnamese cuisine. If you want to try Vietnamese food (which is also good) then head over to VietGuy.

site_logo

Boat1234 . 2018-03-03

MORE AT TripAdvisor

"Spécialiste" auto proclamé des pho j'ai voulu goûter à celle ci bien sûr.

site_logo

DAB06 . 2018-02-26

MORE AT TripAdvisor

The food is ok but not that great, especially the kids meals. There wasn’t much variety for them. It’s just a normal Vietnamese street food.

site_logo

Richard Q . 2018-02-07

MORE AT TripAdvisor

I knew I was hungry, but didn't know what I wanted? I was in the Trinity Shopping Centre, and stumbled on the Trinity Street Food Kitchen - something for everyone. As Vietnam is on my list of places to visit I decided to try

site_logo

Billiedoux . 2018-01-13

MORE AT TripAdvisor

Pho has the potential to be really good but the standard of food isn’t consistent, I’ve never had to send anything back but at times it’s a little lacklustre flavour wise. I also think it’s a touch overpriced for what you get. I’ll keep eating there just for the squid which is always outstanding!

site_logo

JD2678 . 2018-01-12

MORE AT TripAdvisor

We come here for lunch every time we are in Leeds and always really enjoy it. The food is so tasty and full of flavour. Would definitely recommend

site_logo

Timetotravel1989 . 2018-01-04

MORE AT TripAdvisor

I love Pho and have eaten them in the UK and luckily in the Far East. The food at Pho trinity kitchen is pretty good but it's just not value for money. My spicey prawn dish I had tonight was good but I just think it could have been a bit more interesting. Needed a few more different veggies in it. Was just missing something. It was hot though and if you are rushing around shopping and don't have long it's a good place to stop. A lot healthier than other fast food joints in there. We also had the pork spring rolls which we wrapped in lettuce. Flavoursome and crispy. Worth a try.

site_logo

660lynnel . 2018-01-02

MORE AT TripAdvisor

Early evening meal just before Christmas.

site_logo

basilfawty . 2017-12-26

MORE AT TripAdvisor

Visiting my friends in leeds, we go for a walk in this shopping place and came to the trinity kitchen to have dinner. There are loads of food selection here, one of them is pho Vietnamese cuisine. Noodle soup in the cold winter day always the best option. Spicy green with beef broth noodle was the best!!!

site_logo

f00dl0v3r5 . 2017-12-13

MORE AT TripAdvisor

Pho would definitely get 5/5 if it wasn't for the spring rolls not being gluten free anymore!

site_logo

BigTribe . 2017-11-23

MORE AT TripAdvisor

Reasonably priced, standard menu as one of many outlets in Trinity Kitchen. Nothing compares with the real thing but the taste is ok here. One thing is to give a bigger spoon to eat the Pho with! A big queue on Tuesday night but once ordered the wait wasn’t long.

site_logo

Penny C . 2017-11-21

MORE AT TripAdvisor

Popped in during a visit to the trinity shopping centre and had chicken Vietnamese curry with rice pork spring rolls and prawn crackers and was amazing and so enjoyed the food

site_logo

Linzi Ann H . 2017-11-20

MORE AT TripAdvisor

Our daughter has just started at Leeds uni & we went to visit & she insisted we went to Trinity Kitchen. Absolutely loved it. So much choice. We choose Pho. Spicy chicken soup, spicy noodles & spring rolls.

site_logo

KJCxxx . 2017-11-18

MORE AT TripAdvisor

We have been eating here for the last few years probably every 3 to 6 weeks, never cheap but always excellent, until yesterday. I don't know what's changed but the food was bland and lacked flavour, both my wife and I agreed it wasn't anything like as nice as usual, my son usually has a burrito from then place opposite, we will probably join him next time. Very disappointed, Pho was our go to, don't need to think good food place.

site_logo

yellowsantacruz . 2017-11-17

MORE AT TripAdvisor

Went around the great variety of Trinity food stalls twice before settling on Pho and we were so happy to do so. Service isn't the fastest but when waiting for fresh food that isn't a problem. We had a tofu noodle dish and a chicken rice bowl. I tried the noodles and they were fab ,but my rice bowl was just amazing! I have trawled the internet sites looking for the recipe (sad I know), and have just tried to recreate my own version, which was pretty lush i must say. I think this could now be my favourite dish ever. Please come to Newcastle soon and open a restaurant. I will be a very regular visitor.

site_logo

juliewils . 2017-10-28

MORE AT TripAdvisor

We visit the restaurant each time we visit Leeds. We always go for Pho (Vietnamese noodle soup) with Steak ! Always great quality, speedily served and representative of the price charged. We have never had quality or service based issues. It makes a nice change for the staff to be aware of what is on the menu and to make good recommendations.

site_logo

EYorksTravelMan . 2017-10-27

MORE AT TripAdvisor

Love this place always visit when in town the pho bowl which is a soup is delish and fresh and the fried spring rolls are to die for you have to try

site_logo

Kelly W . 2017-10-19

MORE AT TripAdvisor

Called in for lunch whilst shopping in Leeds, menu looked interesting but the end result wasn’t that good.Main courses we’re tasty but small portioned for the money. 4 very small spring rolls for £5 was close to a rip off. Ordered home made lemonade for £3 a drink and although refreshing, because of the amount of ice in the drink, one long sip and it had gone.The soup dishes looked much better than the noodle dishes. Might have chosen the wrong option. Don’t thing we would return

site_logo

Dazff . 2017-10-14

MORE AT TripAdvisor

Visited with my mom and brother at Leeds Trinity. Half way through eating, I found the girls hair who was handing the food out. Told the girl who seemed to be the manager/supervisor and she did not offer any apology. Just asked if we wanted the money back. Very bad customer service as it wasn’t about the money, but was very annoyed I ate food that had some other girls hair in it so I was left feeling sickly and still hungry :(

site_logo

riani g . 2017-10-11

MORE AT TripAdvisor

Visited twice and loved it both times! Always quick service and always friendly. The noodles are tasty and we love them. Would definitely recommend! Student discount here too.

site_logo

louuise_xxx . 2017-10-11

MORE AT TripAdvisor

This is really a review about Trinity Kitchen in Trinity Shopping Centre, Leeds.It's a collection of street food 'pop up' restaurants, some visiting and some apparently permanent. In two visits we sampled:Pho - beautiful food beautifully presentedGrilled Cheese - the most descriptive restaurant name I've seen - that's all they did! Cheese plus lots of options grilled between two doorstops. The 'artisan' presentation is very much part of the attractionBaked in Brick - Outstanding. The curry was superb and fantastic valuePizza - again, cooked to perfectionThe place was packed with local students and business people so we were pretty sure it would be good. Almost too much choice. The only downside is the plastic cutlery - it's hardly up to the job.I wish other large centres would adopt this approach. Food choice is improving beyond the standard big name fast food chains but something like this provides much greater variety and choice without compromising on quality. I'd hate to be a parent bringing a bunch of kids here all with different tastes though!If I was in Leeds for lunch, I'd choose here.

site_logo

oldsoutherner . 2017-10-07

MORE AT TripAdvisor

Superb Thai noodles in the Trinity kitchen. Quick and efficient service. Very tasty chicken breast. Well worth enjoying!

site_logo

Dave P . 2017-10-06

MORE AT TripAdvisor

I ordered the spicy mango salad. There appeared to be no mango in this salad so I don't know why it was named as this on the menu. The salad was extremely salty, so full of fish sauce that even the raw onions in it lost their flavour...or perhaps the same could be said about the mango.I was served by Lauren who was unenthusiastic and rather bored at the till point. If I return to the Trinity Kitchens I will avoid Pho unless I fancy a fish sauce salad.

site_logo

Kiwi2210 . 2017-10-05

MORE AT TripAdvisor

Do they have halal certificate? How do they stop cross contamination with pork? They say that chicken is halal but no proof.

site_logo

jabeen24 . 2017-10-02

MORE AT TripAdvisor

We visited yesterday and were enticed in by the delicious smell. I placed our order then was given a buzzer that would alert me when the food was ready.The pho was massive. A huge big steaming bowl that could easily have been shared as it was so big. Very tasty. Cost about £7 but had me stuffed for the rest of the day.

site_logo

Abi S . 2017-09-27

MORE AT TripAdvisor

Similary restaurants in Yorkshire and The Humber

restaurant_img
4,3

678 Opinions

Nam Song New Briggate
location-icon57-59 New Briggate Merrion Street, Leeds LS2 8JD England
Vietnamese

Lovely little restaurant,serving delicious food and drinks. My only gripe was that, although the food is delicious, there are other places in town that serve bigger portions for the same/less money. I

noodlesporkbrothsquidcookedmeatballsspicycurryricesaladprawn