GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.0

Based on 879 opinions finded in 4 websites

site_photo4

Nº 571 in 1033 in Croydon

Nº 16 of 46 Chinese in Croydon

CUSTOMERS TALK ABOUT DISHES WITH..cookedchillichickenfriedprawnsspicynoodlesrice

comment_iconOpinions

The box was the perfect mixture of spices and deliciousness! Very recommended.

site_logo

Sowmya Manu . 2024-10-29

MORE AT Google

Great chinese food. Always have it.

site_logo

Fatima Kazmi . 2024-10-27

MORE AT Google

I go to Oodles in Croydon most weeks because it's great! Food is very tasty and lots of options to mix and match to keep trying new combos and it's goos prices too. But the best thing about the place is the staff, they are super friendly and always very helpful. Would recommend to anyone in the area

site_logo

Tomas O'Hanlon . 2024-10-25

MORE AT Google

delicious food, friendly staff!

site_logo

Jesse Librack-Balroop . 2024-10-17

MORE AT Google

Staff was too lazy don’t have much manners

site_logo

Ab_ihsan . 2024-10-15

MORE AT Google

I’ve always loved their food but sorry, they’re really slow during lunch time. I spent 30 minutes waiting for my food. They should’ve prepared for the dishes beforehand if they knew it’s gonna be packed.

site_logo

Crystal Choi . 2024-10-15

MORE AT Google

Really tasty food for an exceptionally reasonable price (something that’s usually hard to find in London). It cost £6ish for a good portion of food. Employees are really friendly too, today they ran out of the protein I wanted so they gave me an extra drink on the house!

site_logo

Ismaeel Khan . 2024-10-11

MORE AT Google

The service was so good!! The food was fast and also very tasty!

site_logo

Silvis Giraldo . 2024-10-08

MORE AT Google

Stuff is amazing and the food is delicious

site_logo

Lirim Thaci . 2024-10-07

MORE AT Google

Excellent food in reasonable pricing. Got free drinks during lunch time as well 😋

site_logo

Asad Zaman . 2024-10-05

MORE AT Google

I hated the food was cold and not nice

site_logo

Fayiza . 2024-09-29

MORE AT Just Eat

Extremely slow service, just two guys working, self service machine doesn't work properly, Chinese food not cooked by Chinese people, horrible taste

site_logo

Irene Martínez . 2024-09-29

MORE AT Google

The staff is very friendly and the atmosphere is clean and quite, will definitely visit again

site_logo

H M . 2024-09-27

MORE AT Google

Food was made with great attention. I will be ordering again. Moreover attending restaurant. Very happy customer will share with my followers:)

site_logo

Brenda . 2024-09-18

MORE AT Just Eat

Very inviting staff and comforting environment. Food smells amazing and easily the best restaurant around

site_logo

Kye Green . 2024-09-18

MORE AT Google

Service team was very friendly and supportive. Food is very nice and also did not take long to cook. Would definitely recommend this place 100% I would come back again!

site_logo

Simone’s Vlogs . 2024-09-15

MORE AT Google

the best chinese me and the missus have ever had. great value for the money will be ordering again from oodles real soon. thank you

site_logo

Aaron . 2024-09-07

MORE AT Just Eat

I always come to Oodles. Love the food, decent quality and at affordable price

site_logo

Afiq Safwan . 2024-09-07

MORE AT Google

I recommend their schezuan rice. Regular portion size is pretty filling.

site_logo

Mary Amado . 2024-09-02

MORE AT Google

Service Team is very friendly and supportive. Food did not take long at all and tasted incredibly well. Not to spicy, just perfect. Would recommend and return anytime if i am back in Croydon again!

site_logo

DanielJ.Schmidt . 2024-09-02

MORE AT Google

Simply perfect for anyone visiting Croydon. Food was damn tasty, value for money was great, service was great.

site_logo

Julio Leistner . 2024-09-02

MORE AT Google

Food is very filling and the pricing is good too I've came back 3 times already and I'm always leaving satisfied thank you very much 😊

site_logo

Joy April . 2024-09-02

MORE AT Google

Really good food filling and cheap

site_logo

Jamie Clark . 2024-09-01

MORE AT Google

The environment is clean and comfortable. Although there are some problems with the ordering machine, the staff is very friendly. The food is convenient and tastes good, and the price is very reasonable.

site_logo

Enoch li . 2024-08-26

MORE AT Google

The rice wasn’t cooked properly. I couldn’t work out what was meant be crispy chicken? And BBQ chicken. Chips were nice.

site_logo

Pauline . 2024-08-24

MORE AT Just Eat

Noodles was missing from my wok

site_logo

Geetika . 2024-08-24

MORE AT Just Eat

I had an amazing experience at this noodles bar! The food was absolutely delicious, with each dish bursting with flavor. The service was top-notch, and the staff was incredibly friendly and attentive. Special thanks to Rahim at the front for his warm and welcoming service, and to Chef Abhishek for preparing such delightful meals. Highly recommend this place to anyone looking for a fantastic dining experience. Love it!!!

site_logo

Gul Gul . 2024-08-15

MORE AT Google

Guys, you are making a bargain about the mistake you did? I should have got a free meal when I created a box meal. I haven't received it and I made a complaint. Now you want to pay back half of it? Shame on you. It was the first and the last time I ordered from this restaurant. The food wasn't great either; too much tasteless rice, and just a few meat. I can get much more for the money I paid.

site_logo

Helga . 2024-07-31

MORE AT Just Eat

What a lovely place with clean and beautiful atmosphere to enjoy a meal.. and super customer service..

site_logo

Sashini Thilakarathne . 2024-07-29

MORE AT Google

very small portion for price. but tasted good nontheless

site_logo

Alp . 2024-07-28

MORE AT Just Eat

I'd give more stars but a few times now, my notes have been ignored and I end up with something I don't enjoy. I'm fussy and don't like peas and carrots. Ask for none and get loads. Otherwise it's lovely food.

site_logo

Marcus . 2024-07-23

MORE AT Just Eat

We ordered food and they completely messed up and we asked them to changed it but they refused it. They completely lied to our face. Poor customer service.

site_logo

Aminah Mahmood Shaikh - AMS . 2024-07-22

MORE AT Google

We tried to call to change order Line kept cutting

site_logo

Anam Hanif . 2024-07-22

MORE AT Google

Initially I was caught off guard by the size of the regular boxes which looked rather small but I needn't have worried - they were the perfect size and filled to the brim with delicious food. Anything bigger and I'd have struggled to finish the meal! I ordered the Manchurian chicken and crispy chicken with chips and egg fried rice. They tasted very different to the flavours I had been craving but were so well-made I didn't regret my purchase. The food was piping hot, cleanly packaged and the delivery time was also reasonable. I was very pleased to see that they did not scrimp on the chicken either. Above all, the price was excellent - just under £15 for 2 regular boxes. I am looking forward to ordering from this restaurant again and I hope that they maintain their excellent standards.

site_logo

Hennah . 2024-07-20

MORE AT Just Eat

very nice food amazing staff thank you very much

site_logo

Gajanan . 2024-07-14

MORE AT Just Eat

I expected this order to be as great as my previous one but unfortunately it fell short of expectations. Chips were overcooked and all my 12 tempura prawns were almost burnt and very oily. I had to remove the breading to be able to eat it. I have had better from you Oodles and I know you can do better.

site_logo

Edward . 2024-07-05

MORE AT Just Eat

ordered for the very first food was good but barr cola was missing which i paid extra phoned and sold out of barr cola apologized but still paid for cola

site_logo

michael . 2024-07-03

MORE AT Just Eat

Absolutely disgusting, couldn't even eat it. Don't believe the 5 star reviews which they give out free food in exchange for. Shouldn't be allowed, very dishonest.

site_logo

Ali Standley . 2024-06-30

MORE AT Google

Ordered coconut ice cream, they sent me chocolate ice cream. Ordered sweet and sour chicken, got a soak of food colouring and undercooked chicken.

site_logo

Andrew . 2024-06-29

MORE AT Google

regular customer, favourite takeaway! 👌

site_logo

Sophie . 2024-06-29

MORE AT Just Eat

Food was hot and very delicious. Delivered in time. Portions were good. Fantastic overall

site_logo

Edward . 2024-06-29

MORE AT Just Eat

On app clearly saying buy on get on free box order box came one amd person in shop v unhelpful and rude hang up the phone food totaly cold

site_logo

fasy . 2024-06-25

MORE AT Just Eat

Tried their food and it was good 👍

site_logo

Umme Umar vlogs . 2024-06-23

MORE AT Google

The packaging was a poor cardboard box which arrived spilled. Portion size are also small. Most disgustingly, there was a bandage inside the food which meant that the whole meal was contaminated. This was shocking and it suggests a flagrant disregard for hygiene standards. I won't be ordering again.

site_logo

Sultan Kazi . 2024-06-23

MORE AT Google

Oodles has become our go to takeaway place, food and portions are excellent. Special shout out to Rahim who always goes above and beyond when serving us and I'm sure others.

site_logo

Amzod Ali . 2024-06-21

MORE AT Google

only upset with the product. one item was large and they gave us a small pack. please send another large pack

site_logo

David . 2024-06-20

MORE AT Just Eat

Good ok. It's very much like chopstixx. To much spice

site_logo

Aaron . 2024-06-18

MORE AT Just Eat

The food was really really good , definitely would recommend to every and anyone, will definitely be coming back often !

site_logo

Ron Branford . 2024-06-15

MORE AT Google

Food was really tasty and customer service was on point.

site_logo

Zahria Williams . 2024-06-15

MORE AT Google

Service was quick and it’s always clean.

site_logo

JB . 2024-06-12

MORE AT Google

Best Chinese place outside of my local one would recommend

site_logo

Josh Cox . 2024-06-12

MORE AT Google

Buy one get one free offer Only 1 meal delivered

site_logo

Tracey . 2024-06-10

MORE AT Just Eat

Fantastic food good value great service

site_logo

Sebestyén Balazs . 2024-06-08

MORE AT Google

Must visit place. Friendly staff and nice food.

site_logo

Ruhi Pavaskar . 2024-06-07

MORE AT Google

although food tasty, id paid for large and it was tiny.id ordered chicken in black bean sauce but there was no sauce it was dry and my veg noodles had no veg except for 2 slivers of bell pepper!! it cost 12pound took ages and now im still starving.im disabled and no car so cnt just pop out easy.i feel really ripped off!

site_logo

jackie . 2024-06-06

MORE AT Just Eat

Food is always fresh, tasty and affordable. Excellent staff and service!!!

site_logo

Tapiwa . 2024-06-05

MORE AT Google

I went there as a one year anniversary of Oodles. I had a cut price deal of fried rice, noodles, chicken in black beans sauce and beef chilli. Made to order even though they ran out of ingredients. Great flavours in the takeaway carton.

site_logo

Ray M . 2024-06-05

MORE AT TripAdvisor

Fantastic service from kishan and rahim!!! Thank you

site_logo

Olga Jachim . 2024-06-05

MORE AT Google

Amazing service and food, no complaints :)

site_logo

Zak Guimaraes . 2024-06-05

MORE AT Google

Very yummy food and nice environment

site_logo

Sombel Mudassar . 2024-06-05

MORE AT Google

quick and efficient service and food is always top quality

site_logo

salema bi . 2024-06-02

MORE AT Google

Amazing food! We always order the large box with kung po chicken and chicken manchurian and its the best thing ever!! The servers are also extremely sweet. Coming here for the 25th time!!

site_logo

farsana sadiq . 2024-06-02

MORE AT Google

Good food . arrived hot and was tasty. Will order from here again

site_logo

Denise . 2024-05-31

MORE AT Just Eat

They have the best garlic chilli chicken. Love their service.

site_logo

Pihu Kalra . 2024-05-29

MORE AT Google

Absolutely disgusting service from your driver for this delivery. He picked my order up then went so many other restaurants resulting in my food cold. Driver was rude when eventually turned up

site_logo

Power . 2024-05-29

MORE AT Just Eat

2nd time ordering from Ubereats and the noodles came dry. No sauce.

site_logo

MrOkMahn . 2024-05-26

MORE AT Google

Slow even when not busy but hope the food is good

site_logo

TTskin . 2024-05-25

MORE AT Google

Great food and service - been here a few times. Highly recommend

site_logo

MJB . 2024-05-18

MORE AT Google

Food is very tasty and has the right amount of spices. The workers are very friendly and service is great. Good value for money 😀

site_logo

He Meiqin . 2024-05-18

MORE AT Google

good food and relatively cheap 😄😄

site_logo

lily . 2024-05-15

MORE AT Google

Very tasty meal.. Any day .. Any time ..

site_logo

Sandra Adora . 2024-05-10

MORE AT Google

So good. Really good value. Went for the meal for one and got the wok wings on the side... The tastiest wings I've ever had. And the noodles and egg fried rice with chicken bites and chilli sauce were amazing. Great service. Definitely coming back.

site_logo

Reece Hayes . 2024-05-01

MORE AT Google

Drink missing along with ice cream

site_logo

Keith . 2024-04-26

MORE AT Just Eat

Great as always, great music too

site_logo

Ishika Singh . 2024-04-25

MORE AT Google

Do not waist your money and your health.I had a food poisoning.

site_logo

Ksenija Z . 2024-04-24

MORE AT Google

The food was OK but thought the boxes would be bigger. It was fine in taste albeit fried heavily for the tempura prawns. The rice ended up mushy however the price was alright given the quantity ordered.

site_logo

KW . 2024-04-22

MORE AT Just Eat

Nice food but everything is so tightly packed in a rather small box that it all turns into a bit of a mush and each item's taste combines with another's. You need to pack differently in a different type of box. The prawns weren't crispy, they were soggy. The vegetable noodles were a bit too spicy with no spice indication in the menu. We also tried to order 1 large box but the app kept forcing us to order 2 so we had to create our own instead. You could do well to add an explanation of how exactly the box will look as it was a bit odd to receive a rice base with noodles directly on top of it. It's not what we were expecting. The prawns were just combined with the chicken. In the other box chicken combined with cod. A stupid way to present the meal. You need to improve this.

site_logo

Nadeem . 2024-04-21

MORE AT Just Eat

Very nice food… but the spicy chips just don’t work for me.

site_logo

Chris . 2024-04-21

MORE AT Just Eat

First time here and it was on the lunch deal great value. The food was tasty, but my god it was so slow... The place was not that busy and they had plenty of staff who seemed to have plenty of friends to chat to, but it took 25 mins to deliver two small boxes of stir fried food. If you serve a lunch deal it is at lunch so folks might need food quickly... This would be great as a decent lunch but not of it continues to serve food at a snails pace

site_logo

John P . 2024-04-19

MORE AT TripAdvisor

This is the second time that I have tried here. Both meals were delicious. The noodles were cooked while waiting . The customer service provided was excellent. I was given sample to try . Rahim had a good knowledge and recommended a crispy chicken which was great. The price is good compared to other similar food chain . Would recommend to anyone. It is also halal which also suits my dietary needs.

site_logo

Chowdhury Sultan . 2024-04-12

MORE AT Google

Delicious, fresh food arrived hot and very generous portions!

site_logo

Tania . 2024-04-04

MORE AT Just Eat

Food was great unfortunately the tempura prawns were missing from my order and the delivery time was not good I will order again hopefully next time the review will be perfect as the food quality was fantastic packing the order incomplete and delivery being late let you down

site_logo

Samantha . 2024-04-02

MORE AT Just Eat

I come here often and love the food here! Suresh and Hanish are great staff very friendly. I love Coming on the special offer it’s so worth it! Really good lunch time deals! Yummy food! Love it!!

site_logo

K Feruc . 2024-03-25

MORE AT Google

Suresh and Anish was absolutely fantastic. Brilliant smile and services

site_logo

Mustapha Jabang . 2024-03-25

MORE AT Google

I’ve tried food from Oodles in a couple other stores of theirs, so when I found out one has opened in Croydon I had to give it a go, & also had the opportunity to let me my mum try it. Unfortunately it doesn’t compare to their other stores. Bearing in mind it’s advertised as two options one dry & one gravy, they were both dry. There was hardly any gravy at all with the Manchurian chicken & the crispy chicken was far too over coated with sesame seeds. The rice was okay but far too dry because it lacked the gravy to compliment it. It’s a shame really as I’ve had nothing but 5* experiences from their other stores. This one is just lacking, and I’ve been there on two occasions now, both were underwhelming. Both times the food trays were empty. Don’t get me wrong having food cooked fresh is a benefit for items like rice etc, but the options which are supposed to be in a gravy suffer because they’re dry. I give everything 3 attempts, so no doubt I’ll give them the benefit of the doubt & go back once more, but I’m not hopeful.

site_logo

Keith Clayton . 2024-03-20

MORE AT Google

Food was barely warm and didn't have much flavour

site_logo

nicola . 2024-03-20

MORE AT Just Eat

So friendly and brilliant service!!!

site_logo

Zoe Chichester . 2024-03-19

MORE AT Google

paid 15 quid for a large, what came was a small box of sodden, sweaty chips with about 5 small chunks of chicken and 3 prawns that cost extra

site_logo

Storm . 2024-03-16

MORE AT Just Eat

They give out free food if you write a nice review

site_logo

Rhoyalé PriesthoodIntl . 2024-03-16

MORE AT Google

It was really amazing and the food was a 10/10

site_logo

Emmanuel Idajili . 2024-03-16

MORE AT Google

delicious food and wonderful service. will definitely be back!!!

site_logo

Precious . 2024-03-15

MORE AT Google

Great lunchtime value box offer at the moment! Had the Malaysian Chicken and Sweet & Sour Chicken meal which was delicious for the price.

site_logo

Timothy S . 2024-03-15

MORE AT Google

Atmosphere was amazing very clean staff was very friendly

site_logo

Aysha Harris . 2024-03-15

MORE AT Google

My first time coming, went for the value box and served by a lovely member of staff at till!

site_logo

phillippa imobio . 2024-03-15

MORE AT Google

wao what a great taste and delicious

site_logo

Ahsan Tariq . 2024-03-14

MORE AT Google

Very tasty food & good service I will come again😉

site_logo

Cyriac Varghese . 2024-03-14

MORE AT Google

Everyone is really nice and helpful.

site_logo

Arsema Tesfay . 2024-03-13

MORE AT Google

First time ordering. arrived hot. really enjoyed the food. I would recommend.

site_logo

Anthony . 2024-03-13

MORE AT Just Eat

Friendly efficient service and great food!

site_logo

Daniel D'cruz . 2024-03-12

MORE AT Google

Pipping hot food, awesome flavour meal boxes and the tempura prawns where delicious ... Spicy chips are a welcome freebie.

site_logo

Marcus . 2024-03-10

MORE AT Just Eat

Similary restaurants in London

restaurant_img
4.0

1 Opinions

location-icon24 Weston Hill
Chinese
outdoor_seating_111833takeaway_111833delivery_111833

Fantastic delivery/take away, never eaten in.

restaurant_img
4.0

77 Opinions

location-icon103-105 High Street
Chinese
outdoor_seating_240093takeaway_240093delivery_240093

After a day at the hospital, my son and my friend and i had thought we would like a chinese, so we opted to try Wei Dao, croydon after having a look at the menu , and was disgusted at the price of the rice at £10 !!! RICE A TENNER!! i was horrified, and then we found out that two dishes would cost £25 per head, and that woudl cost £75.oo without drinks, !! this is croydon , not lomdon, and its not even a top restauraunt! we walked out and i decided id never want to even try it as its noting but a huge rip off, and the restaurant was empty, anhow, im not st all surprised !! they can sitck their food and their prices in the cost of living crisis !!!

restaurant_img
4.0

48 Opinions

location-icon29/30 Dingwall Road
Chinese
outdoor_seating_154816takeaway_154816delivery_154816

I'm really writing this review to commend Manoj on his excellent customer service at the restaurant and bar. Management was great but Manoj really stood out here. Keep up the good work Manoj. I'd definitely recommend checking out Hampton by Hilton Croydon. Cheers

restaurant_img
4.0

1404 Opinions

location-icon1453 London Rd
Chinese
outdoor_seating_73924takeaway_73924delivery_73924

Food never arrived Driver has taken food and saying it arrived Resturant unhelpful says nothing to do with them

restaurant_img
4.0

965 Opinions

location-icon292 Lower Addiscombe Road
Chinese
outdoor_seating_194937takeaway_194937delivery_194937

took my money on the website gone to the shop and it’s closed?? it’s a monday and it says there open other than tuesdays.. joke