GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.4

Based on 774 opinions finded in 4 websites

site_photo4

Nº 167 in 553 in Colchester

Nº 8 of 13 Asian in Colchester

CUSTOMERS TALK ABOUT DISHES WITH..mustprawnpaydumplingscurrychickenspicyriceprawnsmeatnoodlescookedsquidchillicoconutasparagusfriedporkribssoupduck

comment_iconOpinions

Nice food,delivered on time at a fair price

site_logo

Corrina . 2025-05-30

MORE AT Just Eat

First time ordering and we were so impressed! The Char Kway Teow was spot on – full of flavour and really authentic. My husband, who’s usually picky, loved the Sweet and Sour Chicken and Chow Mein too. Great intro to proper Asian food – we’ll definitely be back! 👏🍜

site_logo

Lynn . 2025-05-30

MORE AT Just Eat

Always good food and a big Asian menu

site_logo

Daniel Smith . 2025-05-15

MORE AT Google

The pork with chilly and garlic not spicy at all? I missed the spicy, even though the foods arrived fresh and still delicious🙏

site_logo

Moni . 2025-05-13

MORE AT Just Eat

I always order spicy pork, but compare to the very first, no spicy at all and it tasted more sweet rather than spicy.

site_logo

Moni . 2025-05-13

MORE AT Just Eat

The spicy of the pork has gone? It tastes more sweet rather than spicy.

site_logo

Moni . 2025-05-13

MORE AT Just Eat

The roast chilly and garlic pork has not spicy at all? However, the foods are awesome, hot and delicious but i missed the spicy of the pork😔

site_logo

Moni . 2025-05-13

MORE AT Just Eat

Food was great and the level of spice was perfect with great flavours. Highly recommended. Would order again

site_logo

Nick . 2025-05-06

MORE AT Just Eat

Ordered for 5.55. Message said 6.05. Then nothing until I contacted them. It then arrived at 6.35.

site_logo

Gareth . 2025-05-05

MORE AT Just Eat

It was cold when it arrived. Was late. Portions were smaller than usual.

site_logo

Ruby-Tia . 2025-04-21

MORE AT Just Eat

Amazing food !! The best Chinese I’ve ever had , will be making it a regular thang !!!!

site_logo

Dale . 2025-04-18

MORE AT Just Eat

Great food friendly staff always good portions definitely worth it and will be a returning customer

site_logo

Jason . 2025-04-17

MORE AT Just Eat

As they cook everything from fresh the wait time for delivery was about an hour but it was completely worth the wait, just a note for others who may order from this restaurant they use their own careers so tracking within the app may not always be available, food was delivered nice and hot decent portion sizes great value for money

site_logo

Jason . 2025-04-15

MORE AT Just Eat

Can't fault the food or service here, best in Colchester!

site_logo

Laura . 2025-04-05

MORE AT Just Eat

fantastic flavour and texture, highly recommended

site_logo

Richard . 2025-04-01

MORE AT Just Eat

The food was cold unfortunately and arrived late, we have orders from here before but this time was disappointing.

site_logo

Samantha . 2025-03-31

MORE AT Just Eat

I order from them every time. Excellent 👌

site_logo

Robin . 2025-03-17

MORE AT Just Eat

Duck pancakes did not come with any sauces so was dry and unpleasant. For 14 pounds this was disappointing.

site_logo

Eleanor . 2025-03-08

MORE AT Just Eat

Has a very nice mixture of cultured food, so you will deffinitely find something that you like here out of the menu. We ordered the Grilled Dumplings for starter and it was so good. I always like some Dumplings myself, so it is my first choice every time. Staff are very friendly and very attentive when you need something. Overral me and my family had a wonderfull time and would recomend trying it for yourselfs. 100% will be coming back if we are in the area.

site_logo

Miguel Pereira . 2025-03-08

MORE AT Google

The best in Colchester, everyone needs to try this place. Food is very authentic it’s like being back in Malaysia, just perfect. Staff are incredible every single one of them making the overall atmosphere an incredible experience. Thank you noodle zone, it’s my go to place from now on, I will not go anywhere else.

site_logo

leniya nepali . 2025-03-08

MORE AT Google

Love the food and drinks and building is so nice and old fashion/old school

site_logo

Yam Nepali . 2025-03-08

MORE AT Google

We are new to the area, and it's the first restaurant that has made our mouths water, even just reading the menu. We have had a takeaway and ate in, Both meals were fantastic, both times staff were very friendly and hospitable.

site_logo

Matt Allen . 2025-03-05

MORE AT Google

Took an hour for food to come, yet all the food was horrible. it was all cold and soggy.

site_logo

Kai . 2025-03-03

MORE AT Just Eat

was meant to be nearly an hour wait to start with, ended up being closer to 2 hours. Food was fine, but not worth the wait.

site_logo

Charlie . 2025-03-02

MORE AT Just Eat

I was told it would be 1:30 minutes which is bad enough but it turned into 2:30 minutes and was cold

site_logo

Reece . 2025-02-28

MORE AT Just Eat

food was missing and what did turn up was cold.

site_logo

Daisie . 2025-02-22

MORE AT Just Eat

Really good quality food, lots of Meat included in dishes

site_logo

Colette . 2025-02-22

MORE AT Just Eat

Placed order to arrive at 6pm, it arrived at half 6. Was already cold so I'm presuming it was either sitting at the restaurant for ages or delivery driver got to us last. Food was very disappointing, a huge step down from the amazing orders we've enjoyed here in the past. Chips were half cooked and lacked that delicious seasoning that's usually added to them. Everything was very bland and my dumplings were caught (nearly burnt) on one side.

site_logo

Maria . 2025-02-16

MORE AT Just Eat

food didn't arrive can't get through to restaurant

site_logo

Charlie . 2025-02-14

MORE AT Just Eat

The food wasn’t very warm. Really nice once warned up.

site_logo

Paul . 2025-02-09

MORE AT Just Eat

Terrible portion sizes for the amount it costs & items were missing!

site_logo

Tori . 2025-02-02

MORE AT Just Eat

Awful food. Very poor quality. Avoid

site_logo

John . 2025-01-31

MORE AT Just Eat

The food was cold and inedible. You have offered a £4.20 refund on an order that was£25 ??

site_logo

Sue . 2025-01-25

MORE AT Just Eat

Nice staff and quick service. Variety in the menu

site_logo

Ana M . 2025-01-17

MORE AT Google

Amazing actually came here as knowhere else was open but was not disappointed the food was incredible, the service was great, the guy serving us was happy and smily, really did have a nice time and will 100% be returning, thank you

site_logo

cbreaze . 2024-12-26

MORE AT TripAdvisor

The quality of the food is not as good as it was a year ago - less of the protein in the dishes and a lot more veg and no free prawn crackers

site_logo

Jane . 2024-12-21

MORE AT Just Eat

We recently ordered food from noodle zone. It was really amazing and full of flavours, highly recommended

site_logo

Gabriel . 2024-12-13

MORE AT Just Eat

Food not as hot as it could have been felt it had been hanging about before delivery

site_logo

Susan . 2024-12-07

MORE AT Just Eat

we love the food, but it always takes a long time for delivery 2 and half hrs this time, and 30 minutes late

site_logo

Kelly . 2024-12-07

MORE AT Just Eat

The best delivery we have ever had, food was presented in the foil tray, with a clear plastic lid, it was fresh and extremely flavourful!

site_logo

Mark . 2024-11-12

MORE AT Just Eat

Great tasty food that arrived hot.

site_logo

Nicky . 2024-11-09

MORE AT Just Eat

Took almost 2 hours for delivery and Rice is missing.

site_logo

Jason . 2024-11-02

MORE AT Just Eat

Food was great but waiting an hour and a half on a Sunday evening isn’t really very good at all.

site_logo

Amber . 2024-10-28

MORE AT Just Eat

Enjoyed the meal, full of flavours.

site_logo

Robin . 2024-10-21

MORE AT Just Eat

We stumbled past this place while looking for somewhere to eat. We were greeted by a very friendly waiter.We went for the £15.90 set menu. The food came really quickly, all the dishes tasted really good especially the mixed starters for 2 and the portions were a good size. I would definitely recommend this place.

site_logo

Nirujaa Kunaruban . 2024-10-18

MORE AT Google

The ramen soup was spilt in the bag

site_logo

Ieva . 2024-10-05

MORE AT Just Eat

I have ordered food even after payment. I haven't received my order. when I checked it shows it's been delivered. I was a bad experience.

site_logo

Richy . 2024-09-25

MORE AT Just Eat

Not great and found the sauces really bad tasting.

site_logo

Ash . 2024-09-21

MORE AT Just Eat

Never received my food. Ordered food around 7.30ish, given a 55 min delivery time. By 9.20 I was calling the restaurant to ask where my order was to be told it hadn't even been collected by the driver.

site_logo

Hannah . 2024-09-21

MORE AT Just Eat

Brilliant place go all the time, cheap and tastes amazing.

site_logo

McKenzie Finnerty . 2024-09-15

MORE AT Google

Little amount of meat, asked for house special noodles and all I got for the second time is just noodles, onion and beanshoots. It's the last time I order from them

site_logo

Peter . 2024-09-11

MORE AT Just Eat

Aromatic duck was like mush, no crispy skin. Food was generally very disappointing, dry noodles, flavourless wings and other dishes and was not good value for money. Was my daughter’s 11 birthday meal and very dissatisfied and disappointed.

site_logo

Richard . 2024-09-08

MORE AT Just Eat

A hidden gem for lunch. 2 course lunch deal was great value

site_logo

Centh “Wolpheuz” Mcgee . 2024-09-05

MORE AT Google

This place is AMAZING... I Had a personal issue with the restaurant... May I add it was NOT the restaurants fault.... I called them and they promised I would be able to have a meal for free.... I've called this evening and they are honoring their promise of a free meal.... The person I spoke to on the phone was so kind calling me mam he told me he remembered me which was lovely... let me just add their food is bloody awesome... I will 100% order from here again.... Thank you for such a brilliant service xxx

site_logo

Lorraine Kelly . 2024-08-24

MORE AT Google

Food delivered earlier than expected, tasty as always and super hot

site_logo

Anna . 2024-08-24

MORE AT Just Eat

Hugely disappointed, normally my go to place. I have left excellent feedback in the past, but on this occasion it was a massive let down. Lateness, then I got plan noodles but not the house special as requested, think I got the teriyaki chicken noodles but didn’t taste of it and very small bits of chicken (3/4). The notifications via the app was disturbing as it said delivered and enjoy but nothing arrived at that moment and I called several times and then got a call back but no apology.

site_logo

Nathaniel . 2024-08-21

MORE AT Just Eat

Delivery time advertised was 40-55 mins. When I put in my order, the delivery time I was given was 75 mins. When it finally went out for delivery, it then estimated it would arrive 70-90 minutes after I had placed the order. the order arrived 10 minutes after this window, 100 minutes after I had placed the order. Didn't end up eating until 9 at night, even though I ordered around 7. Very unimpressed, not even an apology from the delivery driver.

site_logo

Samantha . 2024-08-11

MORE AT Just Eat

Excellent delivery and food. Very happy.

site_logo

James . 2024-08-10

MORE AT Just Eat

I have taken photos it doesn't let me post it. I must remember not to order from here again. Both myself and my son ended up throwing away 80% of it.

site_logo

Peter . 2024-08-08

MORE AT Just Eat

very happy with food really nice would recommend it to anyone

site_logo

Richard . 2024-08-06

MORE AT Just Eat

Food was lovely when it arrived we where kept informed and food was hot and yummy 🙏

site_logo

Leanne . 2024-08-04

MORE AT Just Eat

food took an hour and 40 minutes to arrive. Great quality but excessive waiting time.

site_logo

Scott . 2024-08-01

MORE AT Just Eat

Main dishes were too runny and chicken dish did not contain enough meat

site_logo

Jules . 2024-07-19

MORE AT Just Eat

Lovely food again. Highly recommended. Delivery was on time

site_logo

Jade . 2024-07-15

MORE AT Just Eat

Absolutely awful! I ordered take away. What I received you would not serve to your dog. The bok choi garlic and broccoli garlic were up to the brim SWIMMING in a thick sickly gloop. The supposed "massaman simbal curry" was not even a close resemblance of this dish. It was also swimming and similar taste to the vegetable's own gloop just a slightly different colour. INEDIBLE. I am never ordering from here again.

site_logo

Charlotte Lewis . 2024-07-10

MORE AT Google

Starters were cold, lamb for pancakes was cold and very fatty, mains were pretty tasteless to be honest, not a great meal

site_logo

Debbie . 2024-07-06

MORE AT Just Eat

Lovely food and have ordered many times since and will continue

site_logo

Jade . 2024-07-05

MORE AT Just Eat

All dishes taste different, the quality and size of portions have been changed dramatically. Even the rice had carrots in that usually doesn't. This is something I noticed not only with this order but with the last 4 orders.

site_logo

Nikolaos . 2024-07-05

MORE AT Just Eat

This restaurant deserves to do well. It serves great value meals in an atmospheric setting. The staff are all perfectly attentive and caring. the taste of the food is outstanding. I had Crispy Chicken Salad and loved it. My husband had Satay Chicken and said it was a 'have again' dish

site_logo

June S . 2024-06-29

MORE AT TripAdvisor

Good place for a cheap and cheerful Chinese lunch/dinner

site_logo

Catherine Wyse . 2024-06-18

MORE AT Google

Food was quite nice, the service was slow… well over an hour on a Monday night between ordering at it being despatched. Not good enough! :-(

site_logo

John . 2024-06-17

MORE AT Just Eat

Outstanding food, very fresh and tasty I will definitely be using them again.

site_logo

Steven . 2024-06-15

MORE AT Just Eat

So friendly and helpful plus the food is authentic and very good! Lovely people who helped myself and a friend when they became ill suddenly. They couldn't have done more! We've eaten here regularly and will continue to do so

site_logo

Sue Baynes . 2024-06-12

MORE AT Google

Very small portions for the price you pay and on top of that, the prawn crackers were missing which left me very disappointed because they were something I was looking forward to …

site_logo

Elena . 2024-06-08

MORE AT Just Eat

Crispy chilli been wasn’t crispy and the wine tasted like it had gone bad….. not just cheap wine, actually rank. Rest of order was ok x

site_logo

Nicola . 2024-05-29

MORE AT Just Eat

marked as delivered when it wasn't because it was late so we thought it had been delivered to the wrong house.

site_logo

laura . 2024-05-27

MORE AT Just Eat

Absolutely terrible, avoid if you like your meal hot! Food was cold, I don’t mean it wasn’t piping hot from the oven, it was actually cold. Just eat doesn’t offer tracking service for this restaurant but from when Order status changed to Delivering your Order it took over half an hour to arrive, by car at 10 at night I am 5 minutes away. Just eats refund of less than 50% is no more than a good will gesture, should have been 100% will never use again.

site_logo

Dan . 2024-05-22

MORE AT Just Eat

Great quality, very enjoyable, many thanks

site_logo

T . 2024-05-21

MORE AT Just Eat

Appalling, i am absolutely starving, i called the restaurant and nothing has turned up, i worked all day and ordered this food over an hour ago. Please can i have a full refund, i will have to go to bed hungry now

site_logo

Caron . 2024-05-11

MORE AT Just Eat

Great service! First time ordering would order from here again!

site_logo

Alice . 2024-05-05

MORE AT Just Eat

Beautiful restaurant, amazing service, great prices, and food to die for. I ordered lychee juice and pork ramen and paid £14.70 for a huge bowl I could barely finish and a cup of lychee juice that they'd given me 4 whole lychees in too. The texture of the noodles was genuinely incredible and the broth was absolutely perfect. We were also given a large bowl of complementary prawn crackers. I went there with a friend and we could barely even speak to each other because we were too busy enjoying our meals. Could not recommend more

site_logo

Jessica Richards . 2024-04-25

MORE AT Google

Great food, always. Delivered promptly and on time!

site_logo

Jonathan . 2024-04-20

MORE AT Just Eat

Food ordered at 21:45 and arrived at approx 22:00. The ETA changed due to delays. The chow Mein was meant to be without bean sprouts but contained them. This was a big part of the meal and was disappointing. The sweet and sour chicken balls were more batter than chicken - and that was extremely over cooked.

site_logo

martin . 2024-04-15

MORE AT Just Eat

I ordered King Prawns and broccoli in a garlic sauce. There were 4 prawns and the sauce wasn’t a garlic sauce just a tasteless runny gravy. First and last time I shall visit. I should have stuck to full house 88

site_logo

A . 2024-04-14

MORE AT Google

Crispy chilli beef was chewy and tough not like last order which was perfect

site_logo

Jules . 2024-04-11

MORE AT Just Eat

Best chines I’ve ever had, we had the dine in but also we always order on Uber Eats, is just delicious.

site_logo

Alexandra Cristina . 2024-04-09

MORE AT Google

All muslim needs to be aware that they calim to serve halal food whereas they are serving pork hence it can not be a halal restaurent ...

site_logo

Muhammad Azhar Ejaz Lodhi . 2024-03-23

MORE AT Google

Been here at least 9 times and the food is always spot on

site_logo

Bailey Finnerty . 2024-03-09

MORE AT Google

Very late! Not good quality. And stone cold!

site_logo

james . 2024-03-08

MORE AT Just Eat

in one word - Fantastic! I'm a regular dine-in customer and have never been disappointed. Great food, friendly staff. Will being going again soon.

site_logo

Daydream25377857313 . 2024-02-22

MORE AT TripAdvisor

Every part of this meal was absolutely delicious. One of the nicest take outs for a very long time.

site_logo

Kerri . 2024-02-15

MORE AT Just Eat

Food was lovely and was still hot when it arrived, really good portion sizes as well.

site_logo

Georga . 2024-02-13

MORE AT Just Eat

one of the best chinese in colchester, definitely will order again..

site_logo

Saphal . 2024-02-10

MORE AT Just Eat

Just ordered Noodle Zone via Ubereats… AMAZING!! BEST Chinese take out I’ve had locally… shiitake udon noodles were absolutely delicious. Chips crispy. Veg spring rolls crispy and delicious. Definitely be ordering again!

site_logo

Helen B . 2024-02-10

MORE AT TripAdvisor

Yet again best Chinese we got, even though they were very busy dine in they prepared my collection on time. Thank you

site_logo

Gabriel . 2024-02-06

MORE AT Just Eat

Both soups, tom yom and laksha were delicious! Will defo order again

site_logo

Inthuja . 2024-02-02

MORE AT Just Eat

Absolutely delicious, best meal in ages. Thank you

site_logo

J . 2024-01-31

MORE AT Just Eat

Everything was delicious & just that bit different from other takeaways, a serious contender.

site_logo

Gary . 2024-01-27

MORE AT Just Eat

Lovely food but unfortuately one of them had a staple in it.

site_logo

Gary . 2024-01-24

MORE AT Just Eat

Tip top food, value and service. Give it a go, you won't be disappointed.

site_logo

Steven Pennington . 2024-01-13

MORE AT Google

Similary restaurants in East of England

restaurant_img
4.5

218 Opinions

location-icon90 Coggeshall Road
Asian
outdoor_seating_89807takeaway_89807delivery_89807

First visit to this Indian restaurant and we were not disappointed the food was good and well presented. The only negative was the service which was very hit and miss and the restaurant was smaller than I expected. Overall I enjoyed our experience and it's the food that is important, I would visit again.

restaurant_img
4.5

465 Opinions

location-icon44 Osborne St
Asian
outdoor_seating_71168takeaway_71168delivery_71168

Great food, best onion bahjees in town!

restaurant_img
4.6

1404 Opinions

location-iconQuayside Drive,
Asian
outdoor_seating_207909takeaway_207909delivery_207909

Place is amaising, food, service and..

restaurant_img
4.3

783 Opinions

location-icon73 Crouch Street
Asian
outdoor_seating_89775takeaway_89775delivery_89775

10 of us went out for no better reason than to celebrate friendship. They couldn't accommodate us until 8.15 pm. It was buzzy and had a good vibe . Our round table with a lazy Susan was great for our group. Service was excellent. Quick and efficient . We ordered the wine and water it was here by return .We had 2 who wanted to order their own choice. Fine, the other 8 shared menu C for 5 people . It was plenty. Particular highlights were for me, the Sesame toast, Duck pancakes and Sweet and sour chicken " Great evening. Just note, a £10 per head deposit was requested . More than most places but it stops people from being no shows and was automatically taken off the bill with no issue.

restaurant_img
4.7

2826 Opinions

location-icon2 North Hill
Asian
outdoor_seating_89653takeaway_89653delivery_89653

Great place to go, food delicious and a great choice, highly recommend