GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
3.8

Based on 2.788 opinions finded in 3 websites

site_photo4

Nº 597 in 1011 in Barnet

Nº 22 of 50 Chinese in Barnet

CUSTOMERS TALK ABOUT DISHES WITH..prawnporkcurryduckricespicysoupnoodleseggcookedchickenprawnsfriedmeatchillilady

comment_iconOpinions

Ming Restaurant? More like Ming’s Museum of Leftovers! I recently got takeaway from here, and it felt like I’d been served a curated exhibit of reheated, stale, and possibly cryogenically unfrozen food from the last decade. The salt and pepper chicken tasted like cardboard seasoned with disappointment, and the duck pancakes had the rubbery feel of an old bike tire. To top it all off, the entire meal was lukewarm, like someone tried warming it up with a hairdryer on its lowest setting. Honestly, I wasn’t sure whether to eat it, donate it as a science experiment or use it as construction material. If you’re craving disappointment, Ming Restaurant is the place for you. Otherwise, just eat dry toast at home, it’ll have more flavor and fewer trust issues!

site_logo

Ronnie . 2024-12-25

MORE AT Google

2 years ago we ordered a take away & it was decent. This evening I ordered a take away for 2, which consisted of: Prawn & veg in black bean sauce Egg fried noodles Sesame prawn toasts Veg spring rolls Sweetcorn soup I am absolutely disgusted with all the food delivery this evening, the food was absolutely disgusting & so awful. Prawn toasts were so thick, heavy & drenced in oil. Spring rolls were so bland and drenched in oil with no taste. Sweetcorn soup was so thick, heavy & gloopy which was disgustingly sweet, some sort of syrup or artificial sugar was added, it was horrendous! Prawn & veg in black bean sauce & noodles were absolutely horrible, no taste, very thick egg noodles, sticky. Very bland food and cheap oil used. They charged me extra for chilli oil and sweet & sour sauce, which was so so awful so thick & full of oil. So disappointed with the service, lady was so rude on the phone when I called the restaurant. Food & overall restaurant very awful. We will not be returning or getting a take away again. £25 just down the drain & feeling very nauseous. We barely ate any of the food..

site_logo

Puja . 2024-11-16

MORE AT Google

The place is only for take away but the taste of the food is heaven.

site_logo

Gheorghe Casaneanu . 2024-10-02

MORE AT Google

My go to takeaway for Chinese food Roast duck with fried rice is delightful

site_logo

Kingsley Tong . 2024-07-31

MORE AT Google

My noodles were so spicy ! No clue why chilli was added could barely eat them

site_logo

irene . 2024-07-08

MORE AT Just Eat

Ordered a large order and it brought back great memories. The Ho Fun and chilli oil were amazing. Only thing that let it down slightly was my egg fried rice had no egg and the beef in the beef ho fun was very tough and chewy, as if not fresh. All the same, I will order again and give it another chance. Thanks EDIT: Ordered a big order and everything was hot, perfectly cooked and delivered early. Thank you for the delicious food ⭐️⭐️⭐️⭐️⭐️

site_logo

A Haider . 2024-07-03

MORE AT Google

beautiful food delivered on time. lovely delivery man too. thanks for all the delicious food!

site_logo

Ahmed . 2024-07-02

MORE AT Just Eat

excellent service delicious food, thank you

site_logo

Yvonne . 2024-07-02

MORE AT Just Eat

Super polite, super tasty and absolutely superb value, my new go to. The pork was perfect!

site_logo

Benjamin . 2024-06-29

MORE AT Just Eat

Ordered stir fried noodles with pork... not tasty at all...wasn't even stir fried...cheap oil covering the noodles and pork was overcooked, very bland with a huge lack of asian seasoning. I was told to throw a plastic container (my order) into the bins located outside the street. Rude young Chinese female, not worth visiting.

site_logo

Eric Altamirano Girao . 2024-06-12

MORE AT Google

Large portions, freshly cooked very tasty.

site_logo

PETER . 2024-06-08

MORE AT Just Eat

It was my first time coming here, as I was on my way home, however my toddler wanted some noodles so we order a regular chicken chow mein. It's safe to say he enjoyed it! The lady at the till was friendly and accommodating. In terms of cleanliness, they were in the process of doing a deep clean, from what I could see, which is always a good thing and appreciated! Overall, ill be coming back to try some other menu items! Thanks again!

site_logo

naturalzzz sis . 2024-06-02

MORE AT Google

food tasted like it’s been through a dishwasher and old. very disappointed especially since it’s on the higher end on price

site_logo

Josephine . 2024-05-20

MORE AT Just Eat

Tasty food, friendly service and delivery drivers. Decent priced food.

site_logo

C Clarke . 2024-05-10

MORE AT Google

Amazing food & as it was arrived an hour earlier than stated, exceptional delivery time, thanks

site_logo

Kara . 2024-05-05

MORE AT Just Eat

Always great food and experience

site_logo

Nicole Richer . 2024-05-03

MORE AT Google

Really good, fresh food, tasty. Good price. Many thanks.

site_logo

Florin . 2024-04-25

MORE AT Just Eat

I love this place, but this order was greasy and cold, very disappointed

site_logo

Lesley . 2024-04-05

MORE AT Just Eat

hey not complaining about it being early. Got message driver on way and food arrived piping hot by very polite driver. As usual food delicious. My Favourite takeaway scores a 10 again. thank you Ming.

site_logo

Cass . 2024-04-05

MORE AT Just Eat

Only negative was that I called and asked for NO beansprouts and NO mushrooms, and the 2 noodle dishes came with BEANSPROUTS, after the person answering the phone assured me there would be NO mushrooms or beansprouts!

site_logo

Deborah . 2024-03-23

MORE AT Just Eat

The second time I'm eating from this restaurant My mother is sick from last night 20.3.24 - 21.3.24 still sick as a dog. We didn't eat all of it.

site_logo

Preciousme Campbell . 2024-03-21

MORE AT Google

Friendly customer service and tasty food, I had to order a 2nd round of veg chow mein noodles, very tasty and the spice just made it even better, thank you guys for making me delicious noodles ❤️

site_logo

Khalid Hakimi . 2024-03-21

MORE AT Google

I've got to be fair I've never had a complaint b4 but on the 20.03.24 I tucked into it as per normal on the third . I realised it was off. Then my daughter comes running upstairs and saying that her meal is off also. Cut along story short. I did call them last night. Rude young lady answered me and hang up. So it looks like when I'm finished coming off the toilet sometime today? I will be returning the food we didn't eat. Just my money back

site_logo

Maxine Nathan . 2024-03-21

MORE AT Google

Ordered the food at 18:37 food arrived at 20:15. The food was just about warm and not hot. Very disappointed and I think this restaurant has served its last order with us.

site_logo

Dan . 2024-03-10

MORE AT Just Eat

Very tasty and presented perfectly. A place to sit as well...warm atmosphere

site_logo

m app . 2024-03-08

MORE AT Google

I ordered a delivery from Ming Chinese via Uber Eats on 9th February and the order was IMMEDIATELY CANCELLED BY THE RESTAURANT. I was not contacted and they have charged me the full amount. No refund. No contact or apology. I shall be taking this further…

site_logo

Wendy N . 2024-02-19

MORE AT TripAdvisor

Fresh,hot and perfect food like always...I do recommend this takeaway restaurant 💯💯💯

site_logo

Mihaela . 2024-02-10

MORE AT Just Eat

Always tasty, hot, correct orders and delivered with great customer service!

site_logo

Marie . 2024-02-03

MORE AT Just Eat

Another quality Chinese, thank you

site_logo

Alice . 2024-01-25

MORE AT Just Eat

The food was delivered hot and by a polite gentleman. The food was really tasty. Thank you

site_logo

Simone . 2024-01-24

MORE AT Just Eat

This order got delivered to the wrong address at 164. Good job my neighbours are honest.

site_logo

Stephanie . 2024-01-21

MORE AT Just Eat

Great food, very satisfied with portions and quality

site_logo

Jay . 2024-01-19

MORE AT Just Eat

Every order we place is hot,delicious and delivered when stated or before. Highly recommend

site_logo

Jane . 2024-01-08

MORE AT Just Eat

top shelf Chinese food as always, only place I order from in this area, never disappointed 🍜😋

site_logo

Alex . 2024-01-08

MORE AT Just Eat

I enjoyed the meal , it was a first buy from this restaurant and very pleasing

site_logo

derek . 2023-12-23

MORE AT Just Eat

I ordered chicken curry. Too many mushrooms and onions virtually no chicken! I also ordered beef in black bean suace. Beef really tough and chewy - totally inedible VERY DISAPPOINTING AND A WASTE OF MONEY

site_logo

Andy . 2023-12-07

MORE AT Just Eat

Food always lovely and piping hot, thank you.

site_logo

Ojay . 2023-12-02

MORE AT Just Eat

Delicious. I look forward to ordering again, thank you!

site_logo

Sarah . 2023-11-30

MORE AT Just Eat

Best Chinese in the area. Great taste and good portion sizes.

site_logo

Ahlam . 2023-11-25

MORE AT Just Eat

Food absolutely fantastic we all enjoyed it

site_logo

paul . 2023-11-24

MORE AT Just Eat

Was very oile the food,next time I will not order anymore

site_logo

Ancuta . 2023-11-23

MORE AT Just Eat

Lovely food and rapid delivery time. I wasn’t expecting the food for at least 45 minutes and it turned up after 20 minutes.

site_logo

Stephen . 2023-11-19

MORE AT Just Eat

Beautiful fresh and great size

site_logo

NIcola . 2023-11-11

MORE AT Just Eat

Really pleased with this Chinese Takeaway. After using the same Chinese restaurant for many years, sadly it closed and have tried several other local ones that fell very short. But now our 2nd delivery from Mings and looking to be our new Takeaway. Food looked good, tasted good and was piping hot too.

site_logo

Lorraine . 2023-11-11

MORE AT Just Eat

The food was great, hot and tasted amazing!!

site_logo

Paola . 2023-11-08

MORE AT Just Eat

Always good quality food, has been for 10+years.

site_logo

antony . 2023-11-07

MORE AT Just Eat

The food was tasteless, more onions in chow mien than anything else. Chicken was pale and lacked any flavour.chilli chips…. Hardly cooked, pale, onions (again) peppers just thrown in…. Again a tasteless dish. Pork hk style was good. So disappointed as this lot cost me just under £30. Ming us getting worse. Ban the o ions and start seasoning your food. Looking for recommendations for other Chinese takeaways please.

site_logo

carol . 2023-11-03

MORE AT Just Eat

After requesting delivery for when my wife returned from work, the meal arrived 23 minutes early, so when we sat down to dinner the whole meal was ruined because it got cold, this restaurant cannot deliver and when I called the restaurant I got a rude woman on the end of the phone, not a hint of customer service at all!!!

site_logo

Jaice . 2023-11-02

MORE AT Just Eat

I have been waiting over an hour and have now been marked as delivered but I have no food the delivery service has been pathetic this evening. I had an ordered cancelled after waiting 40 minutes from McDonald’s this order after over an hour of waiting has told me it’s been delivered and it hasn’t and my other order has been over 45 minutes and the driver has been at the restaurant for 20 minutes or so and still no food from any of the orders

site_logo

James . 2023-10-27

MORE AT Just Eat

disappointed as the sweet & sour was missing from my order

site_logo

Sylvia . 2023-10-22

MORE AT Just Eat

Order was late, I kept having to call up and the lack of communication annoyed me why I am waiting so long when you’re so close. Spoiled my mums birthday dinner

site_logo

Yvonne . 2023-10-09

MORE AT Just Eat

Absolutely delicious! Thanks so much for a delicious takeaway, and for you reading the note on my order and adding ingredients. This is the best Chinese I’ve had in edgware. Fast delivery and amazing food. So happy, thanks again

site_logo

Alice . 2023-09-23

MORE AT Just Eat

Airways delivers great quality!

site_logo

Tomi . 2023-09-17

MORE AT Just Eat

Tried the 2nd time with feedback to the shop and added update Typical Chinese takeaway menu 1st try ordered sea spicy aubergine and salt & chilly squid I was told Sea spicy aubergine is 魚香茄子 and get me excited. When I got it, it becomes sweet and sour aubergine, I am so sock to see a Chinese cook would just hand this out without question. I just disgarded it after trying 1 piece Salt & chilly squid mostly done right except the salt is nonexistent. I mean salt is in the name of the dish Update on 2nd try as everyone deserves at least a 2nd chance This time I tried salt & chilly squid + stir fried beef Ho Fun Gave feed back on the salt & chilly squid. I was told they received comment salt&chilly squid was too salty so reduced the amount of salt... Anyway, this time they make it 95% right. This dish should be dry and has no liquid, the one they sell has small amount of liquid/ sauce in it I was told the Stir fried beef Ho fun is the equal dish to 乾炒牛河. One of the hall mark dish from Canton/ Hong Kong This one dish confirms the chief is not from the area The original one need to be stir fried with high temperature and the Ho Fun (thick noodle make of rice) needs to fuse with sweetened soy sauce perfectly and no residue liquid or oil on the bottom of plate. The high temperature gave the dish signature "chared" aroma to it that one can eat it plain without adding meat or other vegetables. This one I got has a few variations No chared taste, has residue liquid

site_logo

Brian Chan . 2023-09-17

MORE AT Google

Best local takeaway in my opinion

site_logo

David Lindsay . 2023-08-25

MORE AT Google

HOW DOES THIS PLACE GET TWO REVIEWS!!!?YUCK MUST BE THEIR MATES RATING THEM. DONT EVEN BOTHER EATING FROM THIS PLACE. THEIR FOOD SUCKS! THE LADY IN THERE IS RUDE. SHE HAS A FACE LIKE A SOUR LEMON NEVER EVER AGAIN. I THREW MY ORDER IN THE BIN NASTY THEIR FOOD WAS MINGING 🤮

site_logo

Dushy Dushy (Dush) . 2023-08-22

MORE AT Google

Absolutely delicious 🤤 many thanks

site_logo

Will . 2023-07-28

MORE AT Just Eat

The best food, like always hot and tested. I really recommend 👌 😋😋😋

site_logo

Mihaela . 2023-07-15

MORE AT Just Eat

Ming does it again! Good food delivered quickly!

site_logo

Gareth . 2023-07-14

MORE AT Just Eat

Our first time getting it from here, will definitely be our new go-to chinese!

site_logo

Emily . 2023-07-12

MORE AT Just Eat

Have been using Mings for a few years, good is always hot, fresh and tastes good. Value for money is also very good and decent size portions. The lady’s on the phone are always polite. Thank you again!

site_logo

Jessie T . 2023-07-08

MORE AT Google

Really tasty and hot love this Chinese restaurant 10/10

site_logo

Elena . 2023-07-08

MORE AT Just Eat

Food was tasty, spring rolls are huge disappointment, paid £3 for 3 mini spring rolls that were disgusting. Rest of food lovely though

site_logo

Leigh . 2023-07-01

MORE AT Just Eat

Warm and extremely tasty food! My favorite Chinese in North London!!

site_logo

Natalie . 2023-06-23

MORE AT Just Eat

Driver spent time complaining and did not want to deliver to my apartment.

site_logo

Anthony . 2023-06-18

MORE AT Just Eat

Delicious and very good quantity

site_logo

Kaycee . 2023-06-07

MORE AT Just Eat

Wow the food was perfectly cooked very impressive and the ribs were 10/10

site_logo

Kerrylee . 2023-06-04

MORE AT Just Eat

Food arrived as always hot and tasty full of flavour. I have ordered from Ming restaurant time and time again and will do so. I recommend them to anyone .

site_logo

Jane . 2023-06-03

MORE AT Just Eat

Order was delivered on time, and as always the quality of the food is 👌

site_logo

Madawa . 2023-05-26

MORE AT Just Eat

Didn’t ring my bell, left it down stairs and when I called she told me to check my kitchen… in my own house I was standing in the kitchen when I called her

site_logo

Clay . 2023-05-15

MORE AT Just Eat

Delicious, hot and hits the spot!

site_logo

Sandra . 2023-05-07

MORE AT Just Eat

Would have been better if they had put the pork in my chow mein

site_logo

sue . 2023-05-03

MORE AT Just Eat

The noodle dishes and dumplings are amazing, especially the Special Chow Mein. Very friendly and swift service as well 👍

site_logo

nat simkiewicz . 2023-04-26

MORE AT Google

When I think of ordering Chinese food, I only order from this restaurant. Food is so delicious

site_logo

Marcela . 2023-04-24

MORE AT Just Eat

They do try to get the food to you as soon as is humanely possible & they always do for us - we definitely DO recommend Ming to our friends & a lot of our friends refuse to order from any other Chinese restaurant because the Ming is so good - & we have to agree with them too xx

site_logo

Kara . 2023-04-21

MORE AT Just Eat

Great food, great service as usual. A+

site_logo

Roy . 2023-04-12

MORE AT Just Eat

Poor service, had to call 4 times to check where my order was. I think they had forgot about it but kept lying saying it was on the way. When food finally arrived it was like warm and not tasty at all. I’ve ordered here many times in the past and food was always lovely but it’s done downhill (also checked out there food hygiene rating) so I’ll be finding a new place to order from

site_logo

Ash Gregoire . 2023-03-26

MORE AT Google

Delivered much earlier than expected

site_logo

Angela . 2023-03-25

MORE AT Just Eat

Popped into Ming after work,I hadn't been there for 20 years. I ordered set meal A2 which had egg fried rice, sweet n sour chicken & 3 crispy king prawns for £12 and chicken chowmein £4 60 bcos I paid cash they took 10% off so total was £15. I was just getting into candy crush on my phone but very surprised that it was ready and in only 8 minutes ! Got home and everything tasted lovely. So I will be back !

site_logo

tizwozere . 2023-03-09

MORE AT TripAdvisor

Drive said he didn't get told to call me once outside

site_logo

David . 2023-03-08

MORE AT Just Eat

Always great tasty food. We love it

site_logo

Douglas . 2023-03-08

MORE AT Just Eat

Very disappointed, am still waiting for my order.

site_logo

Eloho . 2023-03-06

MORE AT Just Eat

Food was very tasty & delivery very quick!

site_logo

Leanne . 2023-02-25

MORE AT Just Eat

Can't go wrong with ming really good food

site_logo

007 guns . 2023-02-21

MORE AT Google

Brilliantfood as always. Tasty and morish and great value for money. Best chinese takeaway in town 😋

site_logo

Jane . 2023-02-18

MORE AT Just Eat

I placed an order 1hour 45 minutes ago and still no food. Restaurant were curt and rude to me when I called to enquire on 2 occasions about my food. If you are too busy to fulfill orders then stop taking orders. Disappointed as I’ve always ordered from here but will now be changing restaurants after this

site_logo

Ash . 2023-02-18

MORE AT Just Eat

Food was outstanding fresh , full of flavour very polite delivery person we would be ordering again definitely

site_logo

Irena . 2023-02-09

MORE AT Just Eat

Very nice people I called them and they removed the pork of my order . I will order again. Singapore noodles outstanding

site_logo

Abbas . 2023-02-06

MORE AT Just Eat

Lovely food always ,Good portions and good quality...I Don't know why people live bad feedback because the food is amazing...I will order again 😀 😋

site_logo

Mihaela Lorent . 2023-02-05

MORE AT Google

Great food as always! Speedy delivery.

site_logo

jenna . 2023-01-13

MORE AT Just Eat

Delicious as always. Thank you.

site_logo

Nicola . 2023-01-08

MORE AT Just Eat

Food didn't taste as fresh this time round

site_logo

Natalie . 2023-01-06

MORE AT Just Eat

Food doesn’t taste and look like it’s from Ming Chinese. Quite disappointed!

site_logo

CHANDANE . 2023-01-06

MORE AT Just Eat

The food was nice the only thing is the sweet and sour chicken could of been better , there was a few pieces that had no chicken in, and they also forgot my mini veg spring rolls but sent some free triangle things.

site_logo

Gemma . 2022-12-24

MORE AT Just Eat

The food was lovely, however, they messed up one noodles which I asked with prawns but got chicken. Prawns being £4 more expensive. The delivery was 10 minutes late however the driver was really sweet, so I will close an eye on that one. 🤍

site_logo

Nora . 2022-12-12

MORE AT Just Eat

Trying food for the first time and was very impressed with the prompt delivery, courteous driver, and quality of food. Food was nice and hot and schezuan prawns and Singapore noodles were nice and spicy as it says. Often found in other places very bland. Will definitely order again as all the dishes were delicious.

site_logo

Hina . 2022-11-11

MORE AT Just Eat

Absolutely lovely, delicious food, great portions, and friendly staff, been ordering from here for years and never disappointed

site_logo

Lesley . 2022-11-11

MORE AT Just Eat

Ming is the best for Chinese. Especially the House Special

site_logo

Jo . 2022-11-10

MORE AT Just Eat

Excellent, great quality, fresh and hot, delivered super quick. Highly recommended.

site_logo

Gary . 2022-11-10

MORE AT Just Eat

Although a delivery estimate was given. 20 mins after order was placed it showed order with driver on way. But it was another 30 mins wait for arrival even though I live a 7 minute drive from this my local Chinese . Ont know what happened as they are usually very good on delivery.

site_logo

Ryan . 2022-11-08

MORE AT Just Eat

Similary restaurants in London

restaurant_img
3.8

237 Opinions

location-icon27 Queens Parade, Friern Barnet Rd
Chinese
outdoor_seating_116206takeaway_116206delivery_116206

Food is good delivery time is not the fastest but food still hot when arrive

restaurant_img
3.8

549 Opinions

location-icon236 Station Road
Chinese
outdoor_seating_238498takeaway_238498delivery_238498

One of the best vegetarian restaurants in London! The food here is amazing, as was the service. I will definitely be coming back here for sure. They also catered for our dietary needs as I don't eat onions or garlic.

restaurant_img
3.8

382 Opinions

location-icon134 Golders Green Road
Chinese
outdoor_seating_73401takeaway_73401delivery_73401

We arrived for dinner, relatively late and spontaneously. We ordered 2 main dishes - Szechuan soup and beef curry. The soup was sticky and bland, the beef was really uninviting, a bit chewy as well, but the sauce was delicious. We had to order the side dish (white rice...) separately, because a pound for a portion of white rice is small. The 2 portions were really small. to note that until we asked, water and glasses were not served to the table, which in other restaurants was served immediately upon sitting down For dessert we took caramelized pineapple in querantero - a dish that sounded special. It was delicious and beautiful, but one slice of pineapple for 10 pounds is quite excessive. Total price was about £75, that the quantity and quality really did not justify it. There are enough kosher restaurants on the street that provided a much better experience and value for money.

restaurant_img
3.9

2262 Opinions

location-icon189 Woodhouse Rd
Chinese
outdoor_seating_116016takeaway_116016delivery_116016

Good portions of very tasty food, if a little on the expensive side.

restaurant_img
4.0

28 Opinions

location-icon28 North End Rd
Chinese
outdoor_seating_109757takeaway_109757delivery_109757

Si usted, como yo, les gusta la comida caliente picante szechuan, podrá disfrutar de una comida en amigos locales. El banco rojo reats American Diner evocan un y el ambiente es casi tipo cantina, con familias locales para disfrutar de la comida. El personal es amable y eficiente, guía a través de el menú grande con respecto a los niveles de las Especias y el tamaño de las porciones (que satisfacen a un grupo de 4 mejor que un grupo de 2). Teníamos dos entrantes, tres platos principales, fideos y un plato de verdura, que era un montón de comida para 4 - es una pena que sólo había 2 de nosotros!