GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.3

Based on 1.174 opinions finded in 2 websites

site_photo4

Nº 1301 in 4016 in Birmingham

Nº 36 of 98 Italian in Birmingham

CUSTOMERS TALK ABOUT DISHES WITH..coffeecookedsaladoldfritterssteakoctopustomatopastamustmeatcakefriedpastrycheesechickenparmesanpizzagarliccarbonaratiramisu

comment_iconOpinions

I have been dining at Laghis for a long time. This was probably my last time though. We were told the restaurant was closing down soon. This is a sad news for me. I have had so many nice memories of good dinner with dear friends in Laghi's.

site_logo

Kaveh Manavi . 2024-08-17

MORE AT Google

After we heard this place would be closing down we made a point of going one last time, as a few years ago when we were more local to its location we loved going here for coffee and pastries. Sadly this last visit was a very different experience and made it difficult to feel their closure as much of a loss. When requesting to book a table I found the manner of the server very odd - "Mmmm ...... alright, why not, go on then." As if it was enormously generous that she was squeezing us in. Er, I thought you were closing down soon but...alright then, maybe it was very booked up today. Actually the restaurant remained mostly empty for the duration of our very early Friday evening booking. We were quite shocked at the dramatic increase in prices - the place was never cheap, but always very good quality. So we were disappointed further by very small portions of not particularly impressive pasta. As we were still hungry, we foolishly opted to share a £10 tiramisu for dessert. Never in my life have I seen a tiramisu cost this much ... and it was nothing special whatsoever. And again, tiny. We ate again after we got home! All in all you can find far better Italian cuisine in Birmingham for much more reasonable prices - Caffe Gustami, Pane & Vino, Arena, Amore, Tropea, and Trentina all come to mind. Not to mention significantly better service. We found ourselves regretting our 'farewell' visit as it would have been much better to preserve the memory of what the place was just a few years earlier.

site_logo

Megan . 2024-08-16

MORE AT Google

Decent food and attentive staff but felt quite pricey for what it was. Understand the venue is due to close next month due to the increased cost of everything.

site_logo

Jack Roper (Jackamo) . 2024-07-29

MORE AT Google

Ambiente maravilloso. Ocupado por un martes por la noche en julio! El menú era simple. La comida era deliciosa. Entradas de flores de calabacín y Feta era delicioso al igual que las gambas a la parrilla. Plato principal de pasta con chile y salchicha italiana era divino! Tiramisu y el helado de LaPop era maravilloso. Excelente servicio de Charlotte y Molly. Ocupado restaurante pero parecían relajados y atentos cuando era necesario. Definitivamente iré de nuevo.

site_logo

Ash C . 2024-07-26

MORE AT TripAdvisor

De principio a fin, pudimos ver lo mucho que la gente aquí cree y ama lo que hace. El personal era impecable y la comida era absolutamente sublime! Cada curso era perfecto en todos los sentidos y nos tenía haciendo ruidos deliciosos con cada bocado. Podría decirse que mejor comida que la que tuvimos en Simpsons, que no está muy lejos de Laghis! Stu deeley conoce su comida y estamos muy contentos de haber descubierto este lugar! Una experiencia de cena obligada con la mejor de las personas!

site_logo

Lizz R . 2024-07-06

MORE AT TripAdvisor

Absolutely sublime from start to finish! Can’t recommend this place enough!!

site_logo

Lizz Robinson . 2024-07-06

MORE AT Google

It was ok. Hair in starter was really off putting (staff took price of this off the bill), mains were ok but portions were small. Desert was nice but the presentation of the chocolate cremo was slightly off putting, and the tiramisu came with out a plate on its own, which seemed slightly odd. Wine was overpriced at £50 quid a bottle. Atmosphere was ok- tables close togeather. Would we go again? No, there are much better itallian restaurants in brum.

site_logo

Monshui Soft . 2024-06-29

MORE AT Google

Unbelievable cocktails, fantastic service and even better food 10/10

site_logo

Jack Steggles . 2024-06-28

MORE AT Google

The food here is very nearly perfect however what lets it down is the almost arrogant attitude of the staff - they seemed more concerned about their friends at the bar than the diners in the restaurant and gave off the impression that a basic request such as black pepper was quite inconvenient. we celebrated my mother in law's 60th and it did not go unnoticed that there was no mention of this, not even a happy birthday, a small gesture would not have gone amiss. The food was excellent although the carbonara slightly claggy.

site_logo

Laura Davis . 2024-06-27

MORE AT Google

Delicious authentic Italian dishes 😋

site_logo

Salameh Abu Rmeileh (Sal) . 2024-06-25

MORE AT Google

Mi esposo y yo habíamos estado esperando con ansias el de Laghi se nos recomendó, pero lamentablemente no fue la experiencia que queríamos. No podíamos culpar al personal que era tan amable, pero tristemente la comida defraudó nuestra experiencia. Pedimos un filete y lo comimos más de una hora después ya que el primero estaba sobre cocinado. El personal era increíble y nos dio algunos lados libres y apreciamos los accidentes suceden. Pensamos que habiendo recibido la comida las porciones son demasiado pequeñas para el precio que están pidiendo. Pagamos 60 libras por un filete para dos mi marido podría haberlo comido por su cuenta! ¡Y para colmo había goma de mascar debajo de nuestra mesa que nos desanimó a los dos! Lamentablemente no vamos a volver o recomendar este restaurante, tan decepcionado!

site_logo

June N . 2024-06-24

MORE AT TripAdvisor

Extremely disappointing food, not authentic Italian fare - fritters dripping in oil, pasta tasting of lardon fat, would absolutely not recommend.

site_logo

Jyothish . 2024-06-21

MORE AT Google

Relaxed atmosphere with elevated Italian food. Gorgeous neighbourhood feel and great menu. Need to go back to try the BBQ meats which looked fantastic.

site_logo

Emma Richardson . 2024-06-20

MORE AT Google

An exciting and delicious meal!

site_logo

Jemimah Ride . 2024-06-19

MORE AT Google

Vaya... Regalo del Día del Padre con mi esposa e hija (12 - ella cree que es una de sus 10 mejores comidas de todos los tiempos ... estoy de acuerdo ) ; sugiero que reserve una mesa antes de que consigan una estrella , que según mi cálculo debería ser muy pronto . La parte delantera del personal de la casa es encantador y atento , muy bien informado y hizo algunas sugerencias de maridaje perfecto. Compartimos un montón de platos, entrantes y platos principales, el misto de frita era delicado y delicioso, las pastas divinas. Compartimos el bistec con reducción de médula ósea y algunas patatas fritas parmesanas, y . . . ooh , las vieiras eran increíbles. esto es cocinar a un nivel muy alto de hecho Los pudines igualmente ligeros y deliciosos, especialmente el "tirma - stu" Todo el equipo fue excelente Ve si puedes... es un ganador

site_logo

Hunaidr . 2024-06-18

MORE AT TripAdvisor

Overall: 6.5/10 Disappointed. Unfortunately does not live up to the hype or competition. Servers were polite and friendly but was impossible to get a refill. Also not sure about the lighting in the dining area (perhaps too dark because of the scaffolding)?? The wooden chairs also became very uncomfortable to sit on after 1hr. Starters were good and flavourful. We tried 4 different small plates and our favourite was the courgette - creative and tasty. Mains were very average - lacking flavour and identity, small servings and overpriced. The carbonara in particular was disappointing it only contained a couple shreds (quite literally) of meat meaning it was missing that balance with the sauce. Dessert was a disaster. I have never been so dejected after a dish. We went for the tiram-stu, named after the chef. If I had a dessert in my name I would make sure it is the best thing on the menu but it was BY FAR the worst. Way too much cocoa powder so you chocked on your first mouthful, unevenly spread lady fingers and cream meaning some sponfulls all you got was lady fingers and the next only cream. £10 for the monstrosity! It summed up the experience - lacked finesse, overpriced, and painfully average. Overall - there is potential but the menu needs to be fine tuned and perhaps there needs to be better quality control because it would be a shame to lose another independent. Sadly I cannot recommend Laghis to friends as I hoped (which is painful to say).

site_logo

jag s . 2024-06-16

MORE AT Google

Llevamos a amigos a pasar una noche en Laghis como habíamos estado dos veces antes, pero no bajo el concepto Stu Deeley. Pedimos una selección de platos pequeños y los sabores eran maravillosos, pero lo que nos pareció decepcionante fue el precio del vino. Estamos encantados de pagar por una buena botella de vino, pero el más barato era £ 39. Creo que, siendo realistas en el clima actual, una gama de vinos menos costosos además sería más realista.

site_logo

Rbillo . 2024-06-16

MORE AT TripAdvisor

Used to LOVE coming to Laghi's but it's not the same as it used to be. Have to google half of what the menu items are, staff look unhappy and through it's various evolutions its sadly lost the unique charm that made it special and gave it the edge.

site_logo

R M . 2024-06-14

MORE AT Google

This used to be my favourite Italian to dine in birmingham. However, unfortunately the new rebrand has meant there's a slight dip in the quality of food. It's still pretty good but it's no longer as exceptional as it once was. The menu has shrunk a lot and there isn't many variety to choose from and overall I didn't feel it was as good as before

site_logo

Sarish Mohar . 2024-06-09

MORE AT Google

Really enjoyed our evening at Laghis. One of the nicest Italian meals I have had in a long time. Service was fantastic and can't wait to go back again. A hidden gem.

site_logo

Dana Fitzsimons . 2024-05-26

MORE AT Google

This restaurant is terrible. The food is awful, the menu is limited and confusing, and I do not recommend it.

site_logo

Bashar AZ . 2024-05-23

MORE AT Google

Slow service. Very limited menu. Ridiculously small portions, for example, two tiny fritters for £8.00. The pasta dish was very small with just a handful of pasta. Poor value compounded with an addition of a 12.5% service charge. Not going back!!!

site_logo

I Fisher . 2024-05-07

MORE AT Google

Oh wow, what an amazing evening! To begin with, the atmosphere was lovely, welcoming. We ate like gods - I love the experimental approach to Italian food, whilst retaining all the wonderful, rich traditional flavours. The carbonara was perfect, it's difficult to get it right and often in English restaurants we are disappointed but honestly this was the best carbonara we have ever eaten! The scallops were so delicate and the smoky flavor so refined, another incredible dish. The small plates were well portioned and we left satisfied, the wine was delicious! Overall it was a wonderful evening, my father was very happy for his birthday. Thanks and congratulations to the chef!

site_logo

Margaux Bride . 2024-04-28

MORE AT Google

Me and my fellow colleagues visited the Laghi's for a dinner on a weeknight. Made reservation, were greeted at the entrance. At first place looked upmarket, slightly edgy and we were all excited... Good points: - we had selection of dishes which were nice - sea food, polenta chips, ziccini paties and salad, also desserts were lovely (basically starters and desserts) - two waitresses helping during the evening were polite and smiley - there is a nice lighting in the restaurant - relaxing, bathroom is well stocked and clean - great selection of wine Bad points: - very very slow service... we had to ask every time to have water carafe refilled, wine glass was dirty (wasn't very appreciated when asked for swap, it was wiped only. small glass of wine for £14 in a dirty glass with lipstick residue on, yuck) waiting time for the dishes was very long... it wasnt much of a problem but because they were a let down, you start concentrating on negativities. - hit and miss food - carbonara nice texture of pasta and sauce but too greasy and salty (!!!!), hanger steak - suuuper chewy and so so - not worth £22. - the acoustic/ambience at the venue is horrible. bare walls, bare windows, wooden furniture lead to the fact that it is so noisy with echo inside that you have to speak very very loud to your dinner guests to hear anything. considering we were there for over 2 hours we all left with headaches. cannot imagine being there with restaurant full. as a date venue it would be so frustrating as u literally have to lean to each others earls to talk :D or actually lovely ;-) I have decided to spare time to write this review, as someone clearly has some idea about cooking, quality of ingredients and want to aim high with the décor, selection of wine etc. But it is not going to go up if some of the points above, and mentioned in the previous reviews will not be taken in consideration. I come to Birmingham every 2-3 months and if I ever stay in the hotel near by I may considering coming over for a dinner again. We spent over £250 for dinner for 4 and italian restaurant should take hospitality to the next level, little chat with the guests, limoncello at the end, a bit of personality in the venue..... So yes, good luck guys!

site_logo

Kim Senft . 2024-04-23

MORE AT Google

delicious food, amazing service, and wine list was incredible. Can’t wait to come back for another date night

site_logo

Angelina Adamo . 2024-04-12

MORE AT Google

I hadn't booked and it was a busy Friday night but the staff welcomed me and nothing was too much trouble. The cauliflower arrabiata was delicious can't wait to come back.

site_logo

Janet Chance . 2024-04-12

MORE AT Google

Had a meal here midweek. The menu recommends ordering 4 dishes per person, we ordered 3 each and it was far too much. The food was ok , nothing special. Enjoyed the focaccia and courgette fritters but the pasta was very average. The annoying thing for me is I looked at the wine menu online before going and a wine that was £38 a bottle was £52 when we got there !!! Bit of a price rise!! The service was also slow and had to ask for everything

site_logo

Andy S . 2024-04-12

MORE AT TripAdvisor

Amazing new small plates menu and great drinks. Always feel really welcome, make sure we visit at least once a week and always have a lovely time and food

site_logo

sophiegreaves29 . 2024-04-11

MORE AT TripAdvisor

Charlotte, Mollie and the team are a credit to hospitality. Great food, delicious drinks and an excellent playlist. An italian restaurant with distinct Birmingham accent. Glorious.

site_logo

Simon Carlo . 2024-04-11

MORE AT Google

We have loved Laghi's for quite a few years now and we really loved the sound of their new venture into more of a casual fine dining approach. However, I don't think it has come together as successfully as we'd hoped. We found ourselves really missing the rustic charm of a family-led Italian restaurant at reasonable prices. We never had a bad dish at the old Laghi's, everything was always well cooked. Sadly, our experience the other night was more mixed. That's not to say it was bad, the servers were polite and friendly, the food was overall tasty, but considering the price you're paying for the small plates and 1/2 pastas, you expect a lot more. Also, it is a lot more generous with the portions than it indicates on the menu—I'm not sure who could manage the 4 recommended plates! We took the advice and struggled to finish. Our favourite dishes were the seafood tempura and smokey scallops, both were divine. The cocktail I had, Granny's Apple, was awesome. The onglet was amazingly cooked but we were too full by the time it was served. Everything is served in tapas style, being brought out when it's ready, with the snacks arriving first. The olives were delightful as was the foccacia but the balsamic vinegar in the olive oil wasn't particularly nice. The dining style meant that we were left with a plate of meat without anything on the side. I understand wanting to create a casual dining atmosphere but we didn't really enjoy it in this setting. Some dishes were served in classic fashion with broad rimmed pasta bowls while others were served like gastro pub dishes with grease paper. It just felt slightly confused. We ordered one pasta dish, the 1/2 carbonara and while it was made authentically with guanciale, the fat wasn't very well rendered and it was extremely salty. Finally, we had a raw seasonal vegetable salad with pesto. This was a great refreshing option but we found the pesto quite bland, albeit well made. We were slightly let down too because we were given a dirty plastic glass for a drink and the table was sticky when we arrived at it. I don't think we'd go again because of the price to experience ratio. We felt like it was too expensive for what it was. But again, it wasn't bad, just pales in comparison to what it used to be.

site_logo

Evie Jaggard . 2024-04-08

MORE AT Google

Wow what a new lease of life! Incredible service, food and experience throughout. The female front of house staff were so hospitable and welcoming- nothing was too much trouble. We already can’t wait for our next visit!!

site_logo

Scarlett Webb . 2024-04-05

MORE AT Google

New staff couldn’t care less, it used to have good service

site_logo

David Yang . 2024-04-03

MORE AT Google

A little disappointing… Laghis of old was so much better! Bring back the hearty Italian fare we so enjoyed when you opened.

site_logo

Ryan . 2024-03-29

MORE AT Google

The guest celebrity chef apparently 'sometimes' comes in on a Wednesday. The small plates were very expensive and only OK ,not good. We had a small table for two and too many huge serving plates with a tiny bit of food on came all at once creating a table juggling act. We asked for a break before more came but they still turned up and we were told 'that is what the kitchen does'. We had to put the rest on the next door table and felt cramped and rushed. I had one glass of mediocre wine which turned out to be £18. The only good things were the staff and stunningly good Negroni cocktails. A very disappointing and expensive evening to be avoided again unfortunately.

site_logo

DGoscar . 2024-03-22

MORE AT TripAdvisor

We went to Laghi’s excited by their offer of a menu by guest chef Stu Deeley. Unfortunately the experience didn’t live up to expectations. A weak / limited menu failed to inspire from the outset. My daughter summed it up nicely “I don’t want any of this”. Only the prices were Masterchef level - £7 for a plate of lettuce with balsamic and some grated cheese - you’re kidding right? I went for fennel salumi hoping this basic sounding dish would be elevated somehow in master-chef style - it turned out to be sliced salami with some Tesco dried fennel seeds sprinkled on top - really? How did Stu add value here - did he operate the salami-slicer personally? Honestly it was that bad. Hardly anything we had was elevated in any way beyond what you might expect at your local pub - only the prices. So congratulation to the Laghi’s team on this great marketing initiative - I’m sure this has been a very profitable experience for you. However, it has only served to distance me as a previously regular customer of what used to be a wonderful, warm family-oriented restaurant with great home-cooked Italian food. What we got tonight was limited choice, weak cooking (not even as good as tour usual menu) with a 50-100% surcharge. So, sorry, its a 2/5 for me. I’m all for innovation, but you need to deliver a premium experience if you want ti charge premium prices - and don’t lose sight of your roots as you have with this little adventure.

site_logo

Colin G . 2024-03-14

MORE AT TripAdvisor

Dinner. For Stuart Deeley new menu launch. Stuart, who was Master ChefThe Professionals Champion 2019, has been appointed executive chef of this delightful Italian restaurant in Edgbaston. Along with head chef Patrick Huckins, they have created a whole new menu. Us being Stu's greatest fan boys,we just had to get booked in to see his latest creations. Everything was so tempting that we could have ordered the whole menu but decided to be sensible. Maybe leave something different to choose for the next time. Started with a snack Bombolone, Red onion marmalade smothered in Rachael Reserva cheese. Three small plates Courgette and ricotta Fritters with Lemon and a dip. Pig's head fritters with a Basil Aioli. Barbecued Queenie Scallops with Espelette Sauce, which were cooked perfect and absolutely delicious. You can't come to an Italian without having a pasta dish. And what a dish it was 'Nduja Campanelli. Pasta that looks like chanterelle mushrooms cooked al dente,the proper Italian way with one of the tastiest sauces we have ever eaten. Plates from the Barbecue Onglet with a Salsa Verde and Whole Plaice with warm tartare sauce,plus a side of Polenta chips, Pecorino. There was no way we were going to miss out on a dessert or two. You know it makes sense. Fried Pannetone Bread and Butter pudding ,milk gelato and what is sure to be a must for every diner,the Tirami-stu.WOW! To end a very impressive meal, we had two perfectly made liquor coffees in the bar area.As we said our goodbyes and thanks to Stu and the team for a very enjoyable evening in Brum.

site_logo

Guys Who Dine . 2024-03-13

MORE AT Google

Dinner. For Stuart Deeley new menu launch. Stuart, who was Master Chef The Professionals Champion 2019, has been appointed executive chef of this delightful Italian restaurant in Edgbaston. Along with head chef Patrick Huckins, they have created a whole new menu. Us being Stu's greatest fan boys,we just had to get booked in to see his latest creations. Everything was so tempting that we could have ordered the whole menu but decided to be sensible. Maybe leave something different to choose for the next time. Started with a snack Bombolone, Red onion marmalade smothered in Rachael Reserva cheese. Three small plates Courgette and ricotta Fritters with Lemon and a dip. Pig's head fritters with a Basil Aioli. Barbecued Queenie Scallops with Espelette Sauce, which were cooked perfect and absolutely delicious. You can't come to an Italian without having a pasta dish. And what a dish it was 'Nduja Campanelli. Pasta that looks like chanterelle mushrooms cooked al dente,the proper Italian way with one of the tastiest sauces we have ever eaten. Plates from the Barbecue Onglet with a Salsa Verde and Whole Plaice with warm tartare sauce,plus a side of Polenta chips, Pecorino. There was no way we were going to miss out on a dessert or two. You know it makes sense. Fried Pannetone Bread and Butter pudding ,milk gelato and what is sure to be a must for every diner,the Tirami-stu.WOW! To end a very impressive meal, we had two perfectly made liquor coffees in the bar area.As we said our goodbyes and thanks to Stu and the team for a very enjoyable evening in Brum.

site_logo

guyswhodine . 2024-03-13

MORE AT TripAdvisor

We have eaten here a number of times & it's always been superb. Today was not good. It didn't feel like the same restaurant on arrival at all. Staff were OK but didn't seem to know the menu. The wine list had shortened but we found one. Starters were fine. Main I ordered prawns with lemon & spaghetti. It looked nice bt I could only taste salt. Very disappointed. Have the family left? Another independent we can't go back to.

site_logo

Lisa Pearson . 2024-03-08

MORE AT Google

I'm sorry to have to write this but very disappointing dinner after having being excited to eat at a local independent Italian restaurant. Food was very poor with pasta having no flavour, Pizza being half burnt and having a weird texture similar to a stale baguette from a supermarket. The service was slow and poor too. The toilets were filthy with evaporated urine stains and skid marks on the toilet seat (definitely not cleaned for a couple days), No soap available either. Honestly, Birmingham has many good independent Italian restaurants- i'd advise you look elsewhere.

site_logo

C Morello . 2024-03-06

MORE AT Google

Been here a few times and it's always been a positive experience. However this time the menu had changed and we were very disappointed. The squid was chewy and the beef shin pasta was tasteless. Not good. We may come back, but only for the desserts.

site_logo

Jonathan Bowlas . 2024-02-18

MORE AT Google

Booked in on a Saturday afternoon. Was a little quiet but service was very friendly. We ordered the bombolone with red onion jam to start, and shared a margarita pizza, wild mushroom pasta and rocket and Parmesan salad for main. The bombolone was pretty decent with a soft goats cheese filling. The pizza was outstanding, really light and crispy base, absolutely delicious. 😋 pasta lacked a bit of seasoning and the wild mushroom flavour didn’t really come through. £5 for the teeny rocket salad with a pinch of Parmesan was a bit ridiculous. A little disappointing following previous visits. Would definitely return for another pizza though!

site_logo

Anne-Marie Pratt . 2024-02-17

MORE AT Google

I visited the restaurant on 9th of December 2023. It was a Christamas do, therefore we had to preorder the food. My three-course meal was quite bad. The starter was out of the freezer, deep fried and done. The main corse was carbonara. It was so salty. Anyone, who ordered carbonara, could not eat it. When I commented on it and said they shoud not sell food like this, the waitress said it is not their fault, the ham was very salty. I think their level of food and cooking was far below the level that would make it worthwile to explain anything. The dessert wasn't fresh, but was eatable, especially because I was so hungry. Although, I wished they just ordered it from Greggs. Another thing that I did not like and found it quite unprofessional is that when we arrived and waited at the bar to do our order the staff directed us to the table and ensured us they will take the drink order soon. They did and they add the service charge to the cost because they carried our drinks for 3 metres from the bar to the table. On the positive side, the red wine and the mulled wine I ordered was excellent.

site_logo

Erika Sisak . 2024-02-07

MORE AT Google

Always a nice place to visit. Staff, food, the place perfect. A little gem

site_logo

Brumsgrub . 2024-02-03

MORE AT Google

I had a table booked for tomorrow evening however tested positive for Covid this morning so emailed to cancel the table. I’ve been advised I’m being charged £10pp so £20 for the pleasure: “Thank you for letting us know, please be advised that there will be a £10pp charge to the card used to secure the booking in line with our 48-hour cancellation policy.” I appreciate they have to have policy in place however surely they would rather me not going to their small restaurant and spread germs? Additionally, should this policy not just be enforced during “busy” periods - I doubt they are fully booked for a Thursday evening in the middle of January. Also, if that’s your policy, maybe send a reminder out to your guests to reflect 48 hours; not 24 hours - clearly trying to catch people out. I haven’t eaten here yet but this experience doesn’t make me want to even try it!

site_logo

Abigail Elsden . 2024-01-24

MORE AT Google

Excellent lunch, fresh homemade food. Good service.

site_logo

Laura Grace . 2024-01-23

MORE AT Google

Best place for having AUTHENTIC ITALIAN FOOD in Birmingham. The quality of food is 10/10. Don't forget to ask them about the chef's special.

site_logo

sairaj sable . 2024-01-21

MORE AT Google

Brilliant unassuming restaurant.

site_logo

Anthony T . 2024-01-17

MORE AT Google

Authentic Italian food on the doorstep of Birmingham. Reasonably priced and great service. Also recommend grabbing a pastry on your way out

site_logo

Miah Quirke . 2023-12-26

MORE AT Google

Mi Piace, Laghi’s Deli! Mio Moglie & my, favourite place, in Birmingham, for coffee & obligatory bombolone. We’re lucky, we live in Sutton: otherwise, we’d visit everyday & be the size of a house! My late mother in law, loved Laghi’s: as she always felt, like she’d been transported, back home, to 🇮🇹 Have eaten here, previously and food is always perfect ❤️ As well, as Coffee & Bombolone: we visited Deli today; to collect Mortadella & Prosciutto, for Christmas 👍

site_logo

Phil Innamorati . 2023-12-23

MORE AT Google

The food was fairly good. We ordered a carbonara but the guancciale was overcooked and the taste was awful. The waitress (a blonde woman) was so rude, the food took ages and when I asked how long it would take, she said “are you in a rush?” After waiting for 45 minutes for the food. Not sure if I would come back. Furthermore, it is quite pricey.

site_logo

KATHERINE JOHANNA MORENO MORENO . 2023-12-19

MORE AT Google

Superb dinner: food, wine, service all excellent. Location seems odd but once inside, you know it was a good choice. Highly recommend.

site_logo

Adam Maclean . 2023-12-18

MORE AT Google

Great food on my side, I had mushroom ragu. My mom's was just alright, very salty carbonara. Pasta for both of ours was a little tough, so probably ask them to cook it a bit longer if that's not your thing. Atmosphere and staff are great!*

site_logo

Luke Chandler . 2023-12-07

MORE AT Google

We enjoyed a delicious lunch in celebration of my mum's birthday. We were a small group with two young children. The food was delicious, especially the buratta and pumpkin small plates and the pizzas. The pasta was fresh and delicious. The portion sizes.were perfect and there was the option to have a small or large portion of the pastas. Service was very friendly. Thanks!

site_logo

Laura B Hewitt . 2023-11-12

MORE AT Google

Maybe we booked on a bad day. Where we sat was cold and uninviting. The food we thought was over rated and over priced for what is was, nothing special at all. Worst was the service, surprisingly arrogant and rude staff. Have eaten out all over the world and we don’t make a fuss usually or expect much, but basic courtesy is a must. Won’t be back!

site_logo

annpJ6455KT . 2023-11-02

MORE AT TripAdvisor

Pistachio doughnut to die for, lovely coffee, friendly staff, took pastries to go, will definitely be back

site_logo

Tracy Tromans . 2023-10-25

MORE AT Google

Very nice place. The food, service and place and very good. Visited this place few time already now. Went there for dinner and was pleased with the whole experience

site_logo

Harvinder Jabbal . 2023-10-23

MORE AT Google

Been this place for a few times now. Always happy with the food and service. Definitely recommend for quality food and drinks

site_logo

047harryj . 2023-10-23

MORE AT TripAdvisor

Lovely restaurant with some of the best pasta we have both ever tasted. The service was brilliant and so friendly. Would thoroughly recommend this place.

site_logo

Hannah Jones . 2023-10-15

MORE AT Google

Da italiani in visita a B'ham, il miglior ristorante italiano in zona: Pasta fresca al dente con sapori autentici, tiramisù verace, ottimo caffe( finalmente...)

site_logo

Paolo Esposito . 2023-10-07

MORE AT Google

No pizza at the weekend ! This is an Italian restaurant ? What ?! "Oh, we don't do pizza at the weekend anymore" I was told. Why, I ask ? "Oh, we haven't got the staff." So, two nice pizzas probably near enough £30, and they don't want the business. Sad. It's a nice place, good food. But, if they can't be arsed to do pizza at the weekend - I mean, the weekend ! - then it's a sure slide down to going out of business. And, on a Saturday night at 8 pm the dining room was less than half full. Surely they could have done with the boost of the pizzas I was willing to buy ? So, off to Morrisons nearby for Crosta and Molloca pizzas at a quarter of the price. Sorry, Laghi's, but you have lost my good will and my custom. Probably lots of other people's as well, judging by the slack trade happening chez vous this evening. Yes, I was pissed off !

site_logo

210ChrisM210 . 2023-09-16

MORE AT TripAdvisor

The doughnuts and croissants are not worth the money, and the drinks are way too expensive compared to any other café/restaurants.

site_logo

Amandeep Kaur . 2023-09-11

MORE AT Google

Delicious food and excellent service

site_logo

Estelle Patil . 2023-09-05

MORE AT Google

Amazing Italian.. fabulous dinner menu...sumptuous I think its how I would describe our main courses. So I went back for coffee and pistachio donuts for breakfast. Excellent find xx

site_logo

Lesley Gregory . 2023-08-26

MORE AT Google

Pizza is tasty, Boscaiola is not. Servant was arrogant. Atmosphere was fantastic, nice place for couples dating.

site_logo

Endymion Lees . 2023-08-19

MORE AT Google

The staff are very friendly, warm and accommodating. The interior was comfortable and the food was brilliant. What more could one ask for. Only complaint would be some dishes are a bit pricy.

site_logo

Lea Pridgeon . 2023-07-20

MORE AT Google

I have been ordering countless time online since they opened, its well priced and their food is very good, order/go their with your eyes closed, the taste is very good and the products are fresh ! Kuddos to the man/woman who added an extra doughtnuts to my order because a plain croissant wasn't available <3

site_logo

Pierre EmmanuelB . 2023-07-19

MORE AT Google

We booked for an early table at 5.30 and opted for a starter and a pasta dish each for the four of us. Great service with helpful explanations of the menu. The fact that the menu is limited is a good sign and we weren’t disappointed. The pasta dishes were among the best we had eaten anywhere. Particularly good value with early table offers. Highly recommend - deserves its reputation.

site_logo

David A . 2023-07-14

MORE AT TripAdvisor

A brilliant place for some top quality food! They looked after us so well on our anniversary with a little celebration drink to start and it just got better from there! The food was so delicious, full of flavour and really hearty! The staff we amazing, so welcoming and friendly! We wil definitely be returning and can highly recommend this independent FABULOUS restaurant!

site_logo

Lucy Glassbrook . 2023-07-09

MORE AT Google

Third visit here, food was expensive £12 for 3 prawns with a tasteless dip, a small slice of precut dry white toast with hummus again tasteless, the wine was nice. Real shame the staff were friendly.

site_logo

Annette J . 2023-07-05

MORE AT TripAdvisor

Authentic Italian restaurant, great for socializing and spending time, taking advantage of the delicious cuisine and of course an excellent drink. I recommend it 👍👍👍

site_logo

Nicola Codinotti . 2023-06-15

MORE AT Google

The food was not okay for the price. Takeaway would have been better. Came here for a quick lunch. Food arrived quickly but was disappointing. I had the Mediterranean pizza with GF base, had no cheese due to being vegan. However, it arrived with what I can describe as a tomato pure tasting base (very bland) topped with what should have been tasty green veg but rather watery. The waitress that seated us was polite and helpful and made a lovely coffee to take away & the waiter who took the order was also polite but i personally won't return for food based on the quality of food/cooking.

site_logo

Kacey Louise . 2023-06-13

MORE AT Google

Food is absolutely spot on and staff were good to us as we brought our newborn with us. Will definitely come again just as a couple.

site_logo

Jack Haughey . 2023-06-06

MORE AT Google

In recent months, there has been a significant decline in the quality of the pizzas here. Previously, the pizzas were known for their freshness, with evenly distributed tomato sauce and cheese. However, the current situation is quite different. Now, half of the pizza lacks sauce and appears dry, while the cheese is haphazardly placed, hardened, and no longer retains its soft, melted state as it did before. If you’re searching for quality Italian pizzas don’t come here it’s not worth the price!

site_logo

Rumi Hesse . 2023-05-25

MORE AT Google

Fantastico! Seriously can't wait to move to Brum! Sale going through on the JQ. A top spot you have here! Great buzz around the place. Full of laughter and satisfaction! Top ingredients, brilliant flavours and great service.

site_logo

Dean Ryan . 2023-05-20

MORE AT Google

Wonderful service and lovely food

site_logo

Jessica Wilby . 2023-05-06

MORE AT Google

Cute and cosy. Pizza was alright, pasta dishes are very nice and cocktails lovelyy

site_logo

Diana . 2023-05-06

MORE AT Google

I have been to Laghi's few times before the pandemic and visited again recently. The restaurant has been good before but it even improved. It's a great cosy place with amazing authentic Italian food, new menu is great. Food and drinks are very good and high quality. Restaurant can get a little bit noisy when full but I will come back again for sure.

site_logo

Karol Janik . 2023-04-15

MORE AT Google

We went for lunch on Good Friday and we enjoyed excellent food with great service. The menu is not huge which is not a bad thing. Starters were delicious as was the black spaghetti with prawns. Would definitely recommend eating here.

site_logo

humbero19 . 2023-04-11

MORE AT TripAdvisor

A relaxed vibe that was warm & welcoming. The food was absolutely delicious, with amazing flavours. A hidden gem of a find. We will be back in the future.

site_logo

Emily Glanville . 2023-03-25

MORE AT Google

Really super Italian restaurant, great atmosphere, good menu and the food is delicious, the service is excellent. The restaurant is small so would recommend booking in advance to avoid disappointment

site_logo

Bernice Brewster . 2023-03-18

MORE AT Google

Top spot! The menu was interesting enough that it's not the same old same old, but not so out there either. It feels comfortable and well considered. The food lived up to the promise. The service was the best balance if friendly, sincere and efficient. The front of house also know what they're talking about. There able yo share their own feelings on wine parings for example, without inflicting their opinions on you. They guy who served me was spot on with what he said, but even though I was happy to be led by him, he brought samples of both the wines I asked about, do I could make my own mind up. It was a Tuesday night when I came and it was fairly busy. Really nice energy and atmosphere, nice decor. This place has heart!! You can feel the emotional investment the chefs and front of house have in it. They've fed me well, warmed my cockles, shown personality but without getting all up in my face about it. I'm now rooting for these guys!

site_logo

Rachel Carter . 2023-03-15

MORE AT Google

Lunch Saturday, 1st visit for Birthday, delicious food and drinks, killer Negroni, amazing prawn starter and luscious carbonara primi size plenty, all food was lovely and would definitely go back, thanks to Bite your Brum for the tip.

site_logo

diane harding . 2023-03-04

MORE AT Google

Out with friends in a party of four on a Saturday night. The food is generally very good but some portions can be a little small (prawn/lobster cocktail). Pizzas are excellent, pasta dishes lovely. The affogato desert I had was really poor though; one small scoop of bad ice cream felt pretty miserable and not its normal decadence. Very busy and buzzy atmosphere, it's a good night out.

site_logo

Alex B . 2023-02-25

MORE AT Google

Really enjoyable evening dining out! Busy on a Wednesday evening! Really good food choices and drinks choice, staff were friendly & helpful when asking advice on the menu, would highly recommend.. go as far to say best Italian in Birmingham

site_logo

M9089GSjuliew . 2023-02-18

MORE AT TripAdvisor

What a gem of a place. We’ll thought out menu, wonderful balance of flavours, excellent service and lovely ambience. If you haven’t tried Laghis then you should! The wine selection is great and it is clear that these guys really care about their food and making customers feel very welcome. Just go… it’s great!

site_logo

JHolyhead . 2023-02-10

MORE AT TripAdvisor

Great food and great service from Mollie.

site_logo

Charlotte Cartwright . 2023-02-09

MORE AT Google

Visited this stylish and boho chic restaurant on my way back from work. The place seemed nice and warm and the staff very welcoming and confident. Decided after a quick read at the menu to go for the special lunch set menu with 3 courses. Food came quickly and the entrée that I ordered was looking incredible and almost out of Michelin star restaurant. When I first tasted the burrata it seemed fizzing up on my tongue and gave the feeling of warmth. I then asked for bread and tried it again. It was spoiled as if it was left out the fridge for too long. I couldn’t even have another bite as my tongue was on fire. I asked to just take it back as it tasted off the first answer a bit too rushed was ‘ it’s fresh we got it delivered this morning’ as if I was lying or something. I then asked for the second course cause I just wanted to forget that awful taste. Then I was served the spaghetti with 3 prawns and left speechless; the portion was absolutely not enough to feed a toddler and even if the taste was pleasant it was not possible to dive fully in it as the portion was absolutely ridiculous. For dessert I got a slice ( being generous calling it slice to be completely honest) of tiramisu. Nothing to die for, quite standard tasting. Then I decided to wash it all down with an espresso to forget the gruesome lunch and I was presented a very cute combination of treats and sweets again with a horrible burned coffee. I’m not sure if the lack of portion, lack of attention and freshness of the products is compensated with the aesthetic insides but as it is called deli I was expecting something a bit more refined food wise. I just don’t think they are as passionate about Italian food as they state in their front door. All that and the price was a bit salty for a set menu, with a completely empty restaurant and for the calibre of the food. Loads of micro-greens and great presentation for a whole load of nothing.

site_logo

Assia Aouimeur Khachia . 2023-02-08

MORE AT Google

Just superb! The team managed to squeeze us in on a busy Saturday night, and I can see why they're so popular. Lovingly prepared food, including an excellent gluten free base on one of our pizzas, plus rather than a separate children's menu it was simply their excellent adult food made smaller. Very, very happy!

site_logo

ickle_Dave . 2023-01-22

MORE AT TripAdvisor

Pizza good size and flavour. Triple cooked chips average. Very small portion and not crispy. However atmosphere and service excellent.

site_logo

Ali T . 2023-01-18

MORE AT Google

What a great experience! Staff were brilliantly helpful, food delicious and the best gluten free pizza I have ever eaten. My gluten eating companion declared that she couldn't tell it was gluten free. (Which meant I had to share it sadly) Will definitely return!!

site_logo

GlutenFreeGreedy . 2023-01-14

MORE AT TripAdvisor

I mean WOW and WOW again. Unscheduled trip to Birmingham - where to go for lunch? Husband had read about this place. The service is welcoming and quietly slick and efficient. From the moment you walk through the door you feel like a valued customer. Spoilt for choice with the menu, but as they do small plates we didn’t have to commit and could try a number of dishes. Everything was excellent - freshly sourced, imaginative and worth talking about. This is sharing a meal with friends at its very best. We will be back with family, friends and again just the two of us. Such a find. It’s a genuinely independent restaurant of quality and expertise with exceptional customer service. Ps: I never normally write reviews but this genuinely deserves one for its originality.

site_logo

Passport15802109816 . 2023-01-12

MORE AT TripAdvisor

We had a super meal of small plates here. Everything was beautifully flavoured and presented. Highlights were the polenta, blue cheese, chicory and pear and the roasted octopus with red peppers. Service really good and the restaurant is very welcoming in design and ambience.

site_logo

Juliet F . 2023-01-12

MORE AT TripAdvisor

I was treated like as though I was not existing. Staff are very arrogant. When I asked for olive oil and vinegar I was told they did not have but later when I asked other person they said they had it. Two small pieces of Ravioli cost 7.5 GBP which makes it the most ridiculously expensive place in Birmingham. I think they are not open to the fact that there is so much available around five ways and they cant be bothered to provide even basic service. Appalling and I wont be going there anymore. Please avoid day light robbery and also being treated like a piece of tissue,

site_logo

Achuth H . 2023-01-09

MORE AT TripAdvisor

Relaxed, casual dining in the heart of Edgbaston - authentic, delicious food. Heartily recommend the pasta and the truffle arancini, but you can have confidence that the chef wouldn’t put anything on the menu he thought wasn’t up to his high (Michelin-honed) standards. Great value from this excellent, talented young chef.

site_logo

Tim W . 2022-12-30

MORE AT TripAdvisor

If you haven’t been to Laghi’s yet you MUST book soon. Luca Laghi has recently hired Leo Kattou (previously Simpsons) as head chef and Charlotte Carter (previously the High Field) as general manager. Explosively tasty food, the very best ingredients, warm service, and keen prices. This is a real Birmingham gem.

site_logo

Joshua Dunning . 2022-12-29

MORE AT Google

Delicious small plates, great service, very reasonably priced!

site_logo

Stephen Chand . 2022-12-22

MORE AT Google

This restaurant left me with a bittersweet aftertaste. Tasty food but unreasonably small portions. Nice atmosphere, but the most uncomfortable chairs ever. They're just a slab of wood (see pic), to a point it was painful to sit after half an hour or so. The food is tasty and has my seal of approval as an Italian, but the portion are too small for the price - not a good value for money. The half main option is a joke, £7-8 for barely a taste (see pic). The full main portion is slightly better, but still not good enough. The staff was ok overall, not the most friendly or attentive though. What a pity, the place has potential but my experience made it feel like a wasted opportunity.

site_logo

Marco Romano . 2022-12-21

MORE AT Google

The most tiny portion of food, which doesn't taste nice at all, The most uncomfortable tiny chairs which are suitable for children perhaps, not recommended at all

site_logo

Meena Y . 2022-12-21

MORE AT Google

6 months ago, I did a 5-star review. Today, I feel it's right to review it and change it to 1 star. For the last couple of months, the service has been horrible; the emtities are not as clean as before, and the staff is the least friendly I have seen in England...no one is happy to help or at least do their job (I am referringto the 2 waitresses and 1 waiter). I am very surprised how the owner downgraded the staff to people who do not have the minimum of ethics and manners. I am sorry this is happening...used to be my favourite restaurant in Birmingham...

site_logo

Florian Nallbani . 2022-12-21

MORE AT Google

What a fantastic restaurant. We have wanted to try this Italian for some time and we were not disappointed. Wonderful staff and the food is simply amazing. The small plates are a delight. The salmon and prawns were truly stunning. I couldn't resist a pizza which was crisp and so delicious. I couldn't finish it all and enyoyed the rest at home for tea. Great wine selection and outstanding coffee. Will definitely be going back.

site_logo

2ace . 2022-12-17

MORE AT TripAdvisor

Similary restaurants in West Midlands

restaurant_img
4.3

124 Opinions

location-icon10 High Street, Birmingham B23 6RH England
Italian
outdoor_seating_260710takeaway_260710delivery_260710

Yes, it would be nice if you updated the timetable displayed on the internet...which mentions that the pizzeria is open until 11:30pm...;) and actually: surprise!!! it is closed from 16:00!

restaurant_img
4.3

4862 Opinions

location-icon11 Brook street
Italian
outdoor_seating_88054takeaway_88054delivery_88054

Absolutely loved the food and service!

restaurant_img
4.3

6931 Opinions

location-icon154 Yardley Road, Birmingham B27 6LR England
Italian
outdoor_seating_240711takeaway_240711delivery_240711

I'm a regular customer of Slice of New York and have been ordering from them for years. Their pizzas are fantastic and they deliver quickly. 😁

restaurant_img
4.2

1741 Opinions

location-icon18-19 Bennetts Hill, Birmingham B2 5QJ England
Italian
outdoor_seating_252683takeaway_252683delivery_252683

Excellent pizzas and very pleasant service.

restaurant_img
4.5

3098 Opinions

location-iconColmore Row Unit 10, The Grand Hotel, Birmingham B3 2BS England
Italian
outdoor_seating_243186takeaway_243186delivery_243186

We visited Gusto for Valentine's Day and had an absolutely amazing meal. As a vegan, I was thrilled to have my first ever vegan steak—it was utterly fantastic and presented so beautifully. Every detail of the meal felt special, and the quality was outstanding. The staff were brilliant too—so friendly, kind, and welcoming, which really made the evening even more memorable. I honestly can't wait to come back again. Thank you, Gusto, for such a wonderful experience.