GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.5

Based on 1.449 opinions finded in 4 websites

site_photo4

Nº 923 in 7028 in City of London, Westminster

Nº 8 of 29 African in City of London, Westminster

CUSTOMERS TALK ABOUT DISHES WITH..snacksaladchillionionslambricetomatospicyfriedchickenpastalentilsmeatchickpeasonionheartcooked

comment_iconOpinions

I was really missing Masr and was in Covent Garden, this eatery came up as a halal option and Egyptian cuisine- just what the doctor prescribed! I tried the baladi- so meat/chicken free and it really is just a taste of Egypt! Well flavoured and the onion sauce is incredibly authentic! They have regular and large- the latter coming up to £10. I would recommend it if you are looking for a quick walk down memory lane!

site_logo

Noon . 2025-03-17

MORE AT Google

DELICIOUS. You saved our lives. Literally. Thank you from the bottom of our hearts. Love.💕💕💕💕

site_logo

Ninon Pignol . 2025-03-13

MORE AT Google

Cheap, fast and really delicious. I wish I was closer so I could get this more often

site_logo

Lizzy C . 2025-03-10

MORE AT Google

One of the healthies option in Covent Garden. Meet with Ramila she is a superstar helped me and my wife to choose options🤩 thanks Ramila see you soon!

site_logo

Mertcan Okmen . 2025-03-08

MORE AT Google

The staff (or maybe owner) are very patient, warm, kind and welcoming

site_logo

Zainab A . 2025-03-06

MORE AT Google

Lovely staff, great choice of food and very tasty, fresh ingredients used! Love the added crispy onions to my dish! 😍 (I had the Chicken shawarma Egyptian Koshari bowl)

site_logo

life0ffthegrid . 2025-02-24

MORE AT Google

New favorite! Food and service are great ❤️ highly recommended

site_logo

Caroline Bonito . 2025-02-20

MORE AT Google

I love koshari and trying the different bowl variations here. Super tasty food and friendly service 🙏

site_logo

Amira Arasteh . 2025-02-19

MORE AT Google

i stumbled across this, and i’d never had egyptian cuisine so i was curious to try. there was no customers in at the time but they deserve more customers!! the 2 people in there were lovely, and the guy showed me around the menu and was super nice. the food was super yummy and i absolutely loved it. there was a great combination textures and flavours, the falafel was great too 😊. highly highly recommend

site_logo

marcie . 2025-02-19

MORE AT Google

The staff were all super lovely and accommodating and the food was very good.

site_logo

MJM Music . 2025-02-14

MORE AT Google

The Koshari was lovely. I would recommend having it with meat, particularly the beef, as opposed to the classic. Although if you go for the classic, go for some spice for a more authentic experience! The fresh fruit drinks are also wonderful. The place affords some seating area, but definitely not for a long stop. And the staff are really friendly and welcoming. A little bit pricey but worth it for something different.

site_logo

Shahanaz Begum . 2025-02-10

MORE AT Google

The koshari wasn't what I was expecting. I'm used to Egyptian koshari but thought maybe this is a different nations style. Here it is a mix of rice, quinoa chopped lettuce and some pomegranate seeds. I got the chicken shwarama version. The chicken was tasty. The hummus was good but the chilli sauce did nothing for me. Priced at £11 I felt the portion was a bit small. It's a very small place with friendly staff so just eat and go. Glad I tried but don't feel desire to come back.

site_logo

Daniel VandenBurg . 2025-02-09

MORE AT Google

Flavoursome food that hits the spot in a rainy day

site_logo

Muhamed Aqeel Ghouse . 2025-01-26

MORE AT Google

I absolutely loved the food here!! The chicken bowl is full of flavour and the spicy sauce is outstanding!! The hospitality from the staff in the store is also just absolutely incredible as well!! This is such a great dinner or lunch option alike

site_logo

R L . 2025-01-25

MORE AT Google

The food is exquisite, and the service is very patient and friendly, order bigger beef bowl next time

site_logo

yitian ou . 2025-01-21

MORE AT Google

Super tasty classic Koshari with Chermoula chicken on top, will be returning when I feel nostalgic for Egyptian food :) kind staff with great recommendations too

site_logo

Natasha Clark . 2025-01-20

MORE AT Google

Dish was not like how I had them in Egypt, very watery.

site_logo

Fiona Jiang . 2025-01-18

MORE AT Google

Soooo disappointing. Had a.vegan bowl today (aubergine and falafel type thing). Cost £11.95 and not especially large. 3/4 filled with (I’m sorry to say) a slop of overcooked pasta, rice and lentils, not pleasant. The toppings were better but even they were pretty bland for Egyptian food, no heat, no spice, no garlic, just a bit pickled. I specifically asked if they falafel were homemade, I was told yes, but they clearly weren’t, just dry, powdery discs of nothingness - can’t stand that, why do people make falafel seem so hard to make?!!! I never write bad reviews, feel too guilty, but the guy serving was so unfriendly and it was such a waste of money. This is London fgs, not the sticks!!

site_logo

Amy Webster . 2025-01-16

MORE AT Google

koshari is an Egyptian popular street food. It consists of pasta, rice, vermicelli and brown lentils then topped with chickpeas, garlic tomato sauce, garlic vinegar, and crispy fried onions. Hot sauce is optional. Koshari St. is an Egyptian inspired vegetarian café and takeaway serving in addition to Koshari few other Egyptian street food items like falafel, shawarma and Mulukhiyah. The menu is created by chef Anissa Helou.

site_logo

Habib Al Mulla . 2024-12-26

MORE AT Google

You can eat more delicious koshari than the one sold in Cairo, Egypt.

site_logo

Seokjin Ham . 2024-12-18

MORE AT Google

Does not represent the Egyptian dish of koshari one bit. Over priced and not fresh or hot at all. I would spend my money else where.

site_logo

HbLlT . 2024-12-10

MORE AT Google

Food was ok but there was no cutlery or napkins included :(

site_logo

Alex . 2024-12-08

MORE AT Just Eat

If you love bold flavors you will love this place! Fast food streetstyled Egyptian food. The vegan plant power bowl was delicious - packed with the plant-based tectures very flavorful and filling!

site_logo

Rono Stinnett . 2024-12-04

MORE AT Google

Went there to grab a quick dinner before a play the other day. I had the Plant Power Koshari and I absolutely loved it. Staff was lovely too! Would 100% recommend

site_logo

Olivia Carla Schläpfer . 2024-12-04

MORE AT Google

Tasty food and good service, but pricy for quite a small portion

site_logo

Martin Leggett . 2024-11-29

MORE AT Google

Very good shawarma with falafel!

site_logo

Miriam Zavanella . 2024-11-27

MORE AT Google

Great vegan gluten free options

site_logo

Alexandre E. . 2024-11-10

MORE AT Google

Visited many times on trips to London

site_logo

Victoria Townsend . 2024-11-09

MORE AT Google

The place is beautiful and clean All food is halal There is a lot of diversity in it We took the classic and it was nice and light

site_logo

wejdan M . 2024-11-08

MORE AT Google

First time customer and loved the beef, really tasty and great value! I’m coming back soon to try the rest of the menu 😄

site_logo

Cathal Corcoran . 2024-11-05

MORE AT Google

Fantastic food! Definitely going back

site_logo

Nicholas Goldsworthy . 2024-11-03

MORE AT Google

Wow amazing authentic Koshari - friendly staff and lovely Hummos , reccomend.

site_logo

Aaron Horn . 2024-10-18

MORE AT Google

Had the Chermoula chicken wrap. Was so tasty! Chicken flavoured beautifully! Would recommend!

site_logo

Jared Cape . 2024-10-15

MORE AT Google

I only tried the classic and that was SO GOOD! It tasted fresh, deliciously spiced, hearty and healthy. The staff were very friendly as well. Why aren’t there more places in this city with such great value?!

site_logo

Ria V. . 2024-10-09

MORE AT Google

Unfortunately we didn't have a good experience! The Kuscahari was very disappointing.

site_logo

Blend . 2024-10-06

MORE AT Google

The perfect place for my koshary fix, which is much needed in London as there are hardly any places that do it. They now have lots of choice and even have molokhair! I normally get it to go but they do have a few stalls to eat in. Shame they are still selling Coke Cola though as they are on the boycott list.

site_logo

Shelley شيلي . 2024-10-06

MORE AT Google

The best vegan food mind you it was my first time having Egyptian food. Falafel is well seasoned and don’t get me started with the aubergine

site_logo

Ajiana . 2024-10-02

MORE AT Google

Best food with reasonable prices.

site_logo

Arnav Singh . 2024-09-27

MORE AT Google

The food served here is amazing. The large bowl is very filling and a good price too. Just not many seating places.

site_logo

Ashley Finney . 2024-09-27

MORE AT Google

This is the best food you’ve never tasted! The Koshari Street team, Mo and Alicia, were top class! Welcoming space, hip and energetic branding with a reliable take on traditional Egyptian Street Food. Located in a very bustling part of the Leicester Square. Easy, Fast and Delicious! The bowls and wraps are a fast, flavorful and filling way to enjoy any meal on the go! But don’t be in a rush because the menu offers a perfect combination of tradition and nuance to try new things each visit. The familiar Egyptian flavors in the rice/vermicelli base combine wonderfully with any of the traditional protein bases. Multiple Chicken, Lamb, Beef and perfectly seasoned veggie options are available to complement. All glued together with delicious crispy onions on top! Explore something new and share a fabulous culinary exploration with Koshari Street. Don’t miss out!

site_logo

Drew Dufresne . 2024-09-26

MORE AT Google

I was just walking down the street thinking about dinner and went into this place, but when I looked for it to leave a review, I found out that it was an Egyptian restaurant :) I'm not a picky eater, so I just glanced at the menu and ordered something, and it was delicious. It felt like risotto with a good mix of tomatoes, beans, and meat. Personally, I think the price is expensive, but it was good for a quick meal.

site_logo

보름달 . 2024-09-21

MORE AT Google

We enjoyed the experience food is yummy, place is cleaned, staff are so friendly and amazing moreover they advice and explain very patience and politely The menu is Egyptian customised food Try their turkish coffee was amazing

site_logo

Ahmed Abdelatif . 2024-09-20

MORE AT Google

We bought a fit chicken bowl and it was still delicious the next morning! The worker seemed really tired/over it but aren’t we all? Overall I had a very nice experience. Would come again :)

site_logo

Audrey . 2024-09-18

MORE AT Google

Had the Chicken Shawerma Koshari which was absolutely delicious! Would recommend getting the pickled chillies and crispy onions on top. The staff were also really friendly and service was very fast. Would highly recommend Koshari Street to everyone!

site_logo

Cathy Wang . 2024-09-17

MORE AT Google

nice interior, friendly staff, delicious food

site_logo

Fusilli Galotti . 2024-09-16

MORE AT Google

Great food, good portions and friendly staff!

site_logo

Jack Foulds . 2024-09-12

MORE AT Google

Great food, great value. Great for quick but filling office lunch.

site_logo

Andres Palomino . 2024-09-12

MORE AT Google

Koshari Street is a gem in London! The food is so rich in flavours. I've tried many different bowls – all of them are delicious. Some reviews mention it being pricey, but I disagree. The portions are generous, especially with the amount of protein and veggies they offer, compared to other places. It's a great value for the quality and freshness! Highly recommend!

site_logo

Nakisa Nezamabadi . 2024-09-06

MORE AT Google

Good taste, portion very small for the price

site_logo

Tom Martin . 2024-09-04

MORE AT Google

Very tasty food, very seasoned, you are full but still feel light, energetic and not stuffed. Different variations with different types of meat and a large vegetarian selection. Extremely nice staff, a great address, definitely recommended

site_logo

Dorothea Janssen . 2024-09-02

MORE AT Google

Koshari Street in London offers a delightful taste of Egyptian street food, specializing in the beloved national dish, koshari. Located in Covent Garden, this charming eatery serves a hearty bowl of rice, lentils, pasta, and chickpeas, topped with a spicy tomato sauce and crispy fried onions. The dish is both filling and surprisingly light. The atmosphere is casual and welcoming, making it a perfect spot for a quick lunch or a leisurely meal. The prices are reasonable. The unique blend of spices crafted adds a special touch that sets Koshari Street apart from other eateries. Whether you're a fan of Egyptian cuisine or trying it for the first time, Koshari Street is a must-visit for its authentic flavors and vibrant atmosphere.

site_logo

Maryam AlNuaimi . 2024-09-01

MORE AT Google

Koshari was nice but not authentic, portion was a bit small but not bad

site_logo

Ghazi Alnassar . 2024-08-30

MORE AT Google

The atmosphere is pleasant the food is tasty and the staff is always helpful a wonderful spot

site_logo

Donald Smith . 2024-08-20

MORE AT Google

Very good healthy egyptian food.

site_logo

Rafal . 2024-08-19

MORE AT Google

I paid for the small bowl because thats whats priced on the menu, and its half of what you see in pictures on the menu. They didnt fill it to the top. It was not worth the portion. Went with my friend who is Egyptian and she said there was nothing Egyptian about it. So really not worth it for that either

site_logo

Michelle Gonzalez . 2024-08-18

MORE AT Google

Lovely Egyptian food! Great vegan or meat options - feels healthy, fresh and filling!

site_logo

Owen McHugh . 2024-08-13

MORE AT Google

Amazing place where traditional Egyptian dish meets the new London foodie scene in the same bowl. Very tasty and innovative, just a few steps from Trafalgar square or your west end theatre adventures.

site_logo

Dmitry Muchnik . 2024-08-13

MORE AT Google

It's really delicious, simple and cheap. I ate all three days

site_logo

HAYEON Kim . 2024-08-09

MORE AT Google

The food was very good, I tried the classic one spicy and I really enjoy it. The place is so clean and cool. The people is so nice too.

site_logo

Camilo Roa . 2024-08-07

MORE AT Google

I ordered Koshari, the food was delicious with a choice of appropriate toppings, and most importantly, it is halal and you can add chicken

site_logo

Hind Mh . 2024-08-04

MORE AT Google

Loved the fact that its soo light , nutrients packed and so tasty. My go to option for lunch breaks

site_logo

farida el sobky . 2024-08-02

MORE AT Google

What a beautifull place with very kind stuff .. i will repeat it when i come back to London again .. i had a very good experience . Very cool place with the Egyptian taste 😋. We are unlucky we don’t have Koshari st in Cairo.

site_logo

Mostafa El-Saiid . 2024-08-01

MORE AT Google

Great welcome, fast service and very good food

site_logo

Oissila La . 2024-07-28

MORE AT Google

Pre made falafel not even freshly fried ,

site_logo

Broken Compass . 2024-07-27

MORE AT Google

Food was affordable but the beef wrap was to wish for. A bit plain even with the extra sauce.

site_logo

Evita Lauka . 2024-07-22

MORE AT Google

Mi esposa solo quería comer un bocado rápido y nunca ha comido comida egipcia, así que ¿por qué no probarlo? No se esperaba mucho, ya que está en una zona turística y solo las palabras 'Comida de la calle' por lo general significan caro y pequeño por aquí. Estaba tan sorprendido. Gran servicio, plato de pollo encantador y el café egipcio es de primera categoría. Si solo quieres un bocado rápido, hace un gran cambio.

site_logo

Ferenc M . 2024-07-22

MORE AT TripAdvisor

We visited Koshari Street for lunch when we were out in the Covent Garden area after seeing the place on Instagram. The Koshari was delicious and tasted homemade. The service and staff were amazing too - we find it always makes an experience better when the staff are attentive and check on how your food was. The portion sizes were generous. Overall, I would highly recommend Koshari Street, especially if you’ve never tried Egyptian food and want something different and nutritious when out in London.

site_logo

M . 2024-07-21

MORE AT Google

After visiting Koshari Street I fell in love with Egyptian food! 💛 Good atmosphere, super friendly team, the portion is perfect and makes you feel full for long. Big choice of vegetarian meals but we went with Beef Halla Koshari and Chermoula Chicken Koshari. Definitely visiting again, thank you ☺️

site_logo

feelliberty . 2024-07-21

MORE AT Google

I had the basic koshary and it was excellent. Staff is very friendly and topped up my bowl with the spicy tomatoe sauce, tangy with a kick. If not somehow better than koshary I had in the streets of cairo.

site_logo

N. Fatema Fidaly . 2024-07-20

MORE AT Google

I honestly cannot believe how bad the classic koshari was! Being Egyptian and wanting to support the business I was exited to try koshari at! I really expected decent Koshari but this is by far the worst koshari ive ever tasted! No tomato sauce flavour comes through, the rice is soggy, zero salt, no daqa flavour, it’s piping hot and the level of spice the person serving put on the dish was absolutely ridiculous. I spoke to the person at the till about how it tasted after not being able to have more the a handful of bites and he didn’t offer any compensation for the lacking service and food quality. The dish was relatively small for £8.50 (street food). Honestly you guys really need to up your game! What a massive shame…

site_logo

Sara Saeed (Ssaeed) . 2024-07-20

MORE AT Google

This was my 2nd time here but will never come back. After having not so good experience first time, I decided to give another go but it was even worse this time round. The food was bland overall, multigrain quinoa base was under cooked, I threw it in the bin as was not edible. Pricey with not much in the box, 3/4 boxed was filled with undercooked multigrain quinoa base with tiny amount of chicken on top. Not worth it at all.

site_logo

Mustehsan Mahmood . 2024-07-18

MORE AT Google

Very tasty, great value wraps and bowls. Meat and vegan options available. Great spot for a quick lunch.

site_logo

S Harrison . 2024-07-17

MORE AT Google

A little pricy for the street food category and portion but it is tasty and in manageable size. The slow cooked beef hela is tender and flavorful. I did’t expect macaroni in the base but it was fun.

site_logo

X . 2024-07-10

MORE AT Google

Very impressed with the service staff was friendly and attentive .will be coming back again . Thank you

site_logo

Koshinana . 2024-07-06

MORE AT Google

Take out was fast with great service with a smile. The seat was a bit tall for me but food was delicious

site_logo

lal lobster Limbu . 2024-07-06

MORE AT Google

It’s hard to find good vegan food but their vegan options are to die for 😍🤤 very good portion for the money. Will defo go again

site_logo

Shabnam Gurung . 2024-07-06

MORE AT Google

Love their fit chicken koshari bowl! Amazing flavor and very filling 😋

site_logo

Safal Gurung . 2024-07-06

MORE AT Google

The food was very good and customers service was excellent

site_logo

Shivam Yadav . 2024-07-06

MORE AT Google

Great service and very nice staff! Food came in and it was really good! I come in every so often and recommend for you to try this, even just once. I’m a big fan of the protein food!

site_logo

Targen Limbu . 2024-07-06

MORE AT Google

Tasty food and truly helpful, lovely staff!

site_logo

Danusia Stok . 2024-07-05

MORE AT Google

I had one of their vegan bowls, and it was so flavorful! Everything was very nicely seasoned, and I got the spicy option, which had a bit of a kick and also added even more flavour! The crispy onions on top add a great texture to the dish. Food looked and tasted very fresh, and it’s healthy fast food! Will be going back for their other bowls!

site_logo

Anna Krassuski . 2024-07-03

MORE AT Google

Absolutely amazing and generous! ordered it for a group and they were very happy with the quality and the taste. Swift delivery, excellent coordination and very generous portions! well done Seif and team!

site_logo

Abby S . 2024-07-02

MORE AT Google

The food is so delicious, healthy fast food

site_logo

Alice H . 2024-06-29

MORE AT Google

This is from Saudi Eats in London, with 60k+ followers across social platforms. Instagram & Tiktok: saudieats.ksa We were blown away by these Egyptian koshari bowls. 🍲😮🔥 Our absolute favorite was the aubergine Koshari bowl - a delightful mix of aubergine, and crispy onions with a zesty tomato sauce and falafel. Loved all the different components in the bowl. We also tried the halla beef and chicken. Full of banging flavors! ⚡️ Highly recommended best Egyptian street food in an amazing location! Highly recommend this place to everyone looking for a light & healthy meal. 🍽️

site_logo

Saudi & London Eats & Travel . 2024-06-25

MORE AT Google

Delicious food, nutritious and very unique.

site_logo

Eanna Hardwicke . 2024-06-22

MORE AT Google

Oh my gosh, the food is so fresh and delicious! I had the classic Koshari bowl and I am still dreaming about it days later. Please come bring this restaurant to Philadelphia in the U.S.! The lovely woman who served me was so kind to give me so many onions and explain what everything was. The other food looked fresh and delicious also. I watched the loving care that the woman and man gave towards the food they were preparing. The stalls were filled with happy guests. It wasn’t super comfortable seating for my mom and me but the food made it worth it.

site_logo

Beth Clamm . 2024-06-17

MORE AT Google

A great place for healthy food with vegan and vegetarian options. Do try their mint teas, they are very refreshing. The service is quick and the staff are friendly.

site_logo

Sundara Tejaswi Digumarti . 2024-06-14

MORE AT Google

The bowls had main Egyptian flavours including Molokheya, Koshary, the Meat Cubes etc but it felt more contemporary than local dishes. Would be great to include traditional dishes to allow first timers to have that experience. Description on google should reflect the concept as it gave the impression of offering traditional dishes. Overall great taste and amazing hospitality.

site_logo

Ziad Sharaf . 2024-06-13

MORE AT Google

Popped in here looking for something quick and healthy to eat but was disappointed after a few bites. I ordered the koshari but frankly, it was bland, with the only saving grace being the delicious crispy onions on top. My friend ordered a falafel wrap, which I tried and it was okay, but nothing special nor close to some of the better falafel wraps I've tried in London.

site_logo

Jenni . 2024-06-06

MORE AT Google

Amazing experience. Very nice staff, Koshari bowl was very tasty. The combination of rice, lentils, noodles, fresh herbs, tender chicken thighs and joghurt sauce was the perfect match together with the green lemonade which has zero sugar. The only thing I would add to the portfolio is Pepsi MAX. I will definitely come back.

site_logo

Can Koray Saner . 2024-05-30

MORE AT Google

My first experience with egyptian food. I am happy I overcame my convenience and tried something new!! I thought many times of going in but never did because i don’t know what it is and was too lazy to try something. Once you step in and come to order they make it super easy and give you great recommendations! The result was so enjoyable. This experience was a pleasure and definitely not my last one!

site_logo

Daniel Matuschzik . 2024-05-24

MORE AT Google

Love this place. My fave egyptian snack

site_logo

Sandy Goel . 2024-05-21

MORE AT Google

Very welcoming and courteous staff, tidy shop with delicious food. Highly recommended.

site_logo

Suzy Hassan-Khalaf . 2024-05-17

MORE AT Google

Delicious and healthy!! After being reached out to via LinkedIn, I accepted the offer of a couple free bowls for me and my colleagues to try. Seif took the time out of his day to hand deliver me the food to our office in Canary Wharf and I’m very grateful he did. After trying the complimentary bowls me and my colleagues were blown away! Very tasty and was the perfect size for a lunch at the office. Needless to say we will be back for more! Thank you Seif

site_logo

Ed Stedman . 2024-05-14

MORE AT Google

Good value for money. Eat well and quickly. Inventive and original cuisine.

site_logo

Honguy . 2024-05-10

MORE AT Google

Amazing food, service and the staff were amazing. I highly recommend going with their recommendations

site_logo

Kerry Francis . 2024-05-05

MORE AT Google

I love to come here! Its a great place to grab some nice filling food. Quick service and the staff are always friendly. I had never experienced Egyptian food before coming here, I love all the different components in the bowl. Highly recommend this place

site_logo

Alice . 2024-05-03

MORE AT Google

What a super place, me and my wife had lunch here she had the aubergine falafels and I had the Koshari Classic with extra crispy onions and spice, utterly superb. And with 2 limonata it was an excellent lunch.

site_logo

Adrian Dent . 2024-04-27

MORE AT Google

I tried delicious plain koshary

site_logo

RA . 2024-04-18

MORE AT Google

I am very happy that there are many vegan options. Portions are generous, gently flavoured, with a delicate hint of herbs/spices.

site_logo

Emilia Jankowska . 2024-04-15

MORE AT Google

Similary restaurants in London

restaurant_img
4.5

10 Opinions

location-icon111 Grosvenor Road
African
outdoor_seating_116467takeaway_116467delivery_116467

Un muy buen bar, la parte de arriba es un hostel en la localidad de Pimlico y muy cerca de la pintoresca Belgravia.

restaurant_img
4.4

2423 Opinions

location-icon43 Buckingham Palace Road
African
outdoor_seating_71267takeaway_71267delivery_71267

We stopped by for cocktails one afternoon. The atmosphere didn't bother us too much, other than that they have nice cocktails.

restaurant_img
4.2

694 Opinions

location-icon32 Ivor Place
African
outdoor_seating_76526takeaway_76526delivery_76526

The first time there, 5 minutes from the Marylebone station and it was so convenient. After a long day of fasting , it was a delight to be able to go and sit there to enjoy authentic Egyptian food. The desert was the best! The lentil soup was amazing too. Falafel made of fava beans was a surprise since we’d eastern chickpeas falafel until now. Great service by the lovely family, they gave us a table even though we hadn’t booked. But best to book beforehand as it can get full!

restaurant_img
4.0

1533 Opinions

location-icon8 High Timber Street
African
outdoor_seating_71838takeaway_71838delivery_71838

Absolutely fabulous food and a great location. Small and quiet spot right along the river that makes you feel special. The focaccia bread is the best I've ever had, I wish I had ordered just that for dinner. Excellent service and an excellent experience overall.

restaurant_img
4.0

30 Opinions

location-iconO2 Centre
African
outdoor_seating_114579takeaway_114579delivery_114579

I used often when in town , always had a great meal . Only worry was my middle , but still get mouth watering thoughts. thinking about oxtail with jallof. Fast food perfect . Not a sit down . More of an on the go type