GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
3.9

Based on 414 opinions finded in 2 websites

site_photo4

Nº 303 in 398 in Monmouthshire

Nº 5 of 9 Chinese in Monmouthshire

CUSTOMERS TALK ABOUT DISHES WITH..duckprawnnoodlescookedboiledbeanmeatchillipayeggfriedchickencurryribsbeautifulrice

comment_iconOpinions

Fabulous food, very helpful staff. And a great fish tank. 😍 I love this place. Diolch.

site_logo

Tim Yorath . 2024-11-29

MORE AT Google

Fabulous takeaway meals. Good food at reasonable cost.

site_logo

Marilyn Smith . 2024-10-28

MORE AT Google

Great spot for authentic Chinese cuisine, lovely for small to medium groups of friends. lovely staff and delicious food, quick and clean service.

site_logo

Luke K . 2024-09-29

MORE AT TripAdvisor

Great food and friendly service

site_logo

leonard rumbold . 2024-08-23

MORE AT Google

Great food and friendly service

site_logo

leonard rumbold . 2024-08-23

MORE AT Google

Had a takeaway meal from Kongs. First time and last, that I will purchase from here. Boiled rice was a solid lump and overcooked. Special house chowmein had overcooked noodles and presented and as canned heinz spaghetti , with lumps of carrot and meat that could not be identified, except from the sliced chicken and beef on top of container. Duck pancakes...an overcooked duck leg..meat on bone that you had to shred yourself. Sea spray beef was edible, but did not deliver the flavours that were advertised. Overall very disappointing meal.

site_logo

KAREN STEADMAN . 2024-08-16

MORE AT Google

Had a takeaway meal from Kongs. First time and last, that I will purchase from here. Boiled rice was a solid lump and overcooked. Special house chowmein had overcooked noodles and presented and as canned heinz spaghetti , with lumps of carrot and meat that could not be identified, except from the sliced chicken and beef on top of container. Duck pancakes...an overcooked duck leg..meat on bone that you had to shred yourself. Sea spray beef was edible, but did not deliver the flavours that were advertised. Overall very disappointing meal.

site_logo

KAREN STEADMAN . 2024-08-16

MORE AT Google

Love this place and the food. Was served by a wonderfully cheerful young lady called Dea (think that’s how you spell it) and we had the evening banquet. Lovely food, lovely atmosphere, only tiny issue I have is you can only order one side with the evening banquet at a time but my partner only orders once from this menu so requested chips and rice and was met with a mixed response told couldn’t have both but the boy explained we could order one on the next time but he wasn’t ordering again as one meal is plenty. Also said was only allowed one side as we had ordered started so the evening banquet menu is actually just a set menu. So , that’s the only issue but I love it here

site_logo

D James . 2024-06-07

MORE AT Google

Food was amazing. We sat downstairs due to mobility issues but unfortunately no one else was sat downstairs so it felt a little flat. Card machine was playing up but the team handled it very well and explained to everyone. Staff seemed to lack a little confidence but were friendly.

site_logo

Kat Dodd . 2024-05-13

MORE AT Google

Really disappointed went in to get some things from the menu to be told they are not available so ordered something else it was quite a bit more expensive than where I usually go golden city brynmawr or town gate the king prawn foo yung is half the size of what I usually have and 2.50 more the lemon chicken had 8 bits of chicken and was in a small rice portion pot there was more pineapple than meat so over all expensive for small portions used to be the best around when they first opened in market Street very long way away from there now disappointing

site_logo

Mike Fuse . 2024-04-20

MORE AT Google

Food was fantastic hot, tasty and plenty to feed us. We Really enjoyed the evening

site_logo

Dark Thoughts . 2024-03-16

MORE AT Google

What a waste of £55.00. Food was watery, tasteless and insipid. Prawn toasts were the tiniest I have ever seen and certainly not worth £5.00! Moo Shu pork did not even have a hint of yellow bean sauce. Crispy chicken noodles were awful, menu didn't say the Crispy chicken noodles came with lots of vegetables and a few pieces of chicken separately which was overwhelmed by ginger. Most of the things I wanted to order was unavailable at the time or not available at all and hadn't been for quite some time but this has not been updated on their online menu. I asked the staff if any chilli oil was available which is usually used in Chinese restaurants and they said yes so I asked if I could have some, they then charged me £3.00 for a pot of sweet chilli sauce when I got the food home, not what I had asked for. Will certainly never use again, extremely disappointing.

site_logo

S Willhart . 2024-03-09

MORE AT Google

Sadly our takeaway was absolutely terrible. Rice was stodgy, Chicken looked dodgy,everything was tasteless.A waste of £60+. Most positive thing was prawn crackers.

site_logo

Jackie Vaux . 2024-02-25

MORE AT Google

I have been having takeaways from here for the best part of 10 years, and the customer experience and quality has fluctuated greatly over that time. So we decided to eat in the restaurant for the first time ever recently thinking this would be a more consistent experience, but the whole thing was so awful that we will never spend another penny in this place again. The management here literally have no idea how to run a business! There are so many other options for Chinese takeaway, do yourself a favour and go elsewhere. We'll be sticking with Crickhowell from now on 5* hygiene rating there!

site_logo

FoodieExplorer . 2024-02-12

MORE AT TripAdvisor

Really disappointed… one of the worst Chinese I’ve ever had. The quality of the food was so poor and nothing at all tasted fresh. It felt like such a waste of money as no one enjoyed- a real shame.

site_logo

Chris McEneaney . 2023-10-20

MORE AT Google

We had the most amazing Chinese meal at this restaurant the staff are extremely courteous and very friendly and polite.

site_logo

Tim Noyes . 2023-10-15

MORE AT Google

Bit worrying as you enter that it has a three star hygiene rating. Restaurant area was clean enough. Toilets needed attention. Staff friendly. Food nice enough but not amazing. Didn't have that really fresh taste. Won't be rushing back even though we were regulars pre-kids.

site_logo

Rebecca Rees . 2023-10-08

MORE AT Google

Good value for money. Nice and fresh and lots of it. There was a wait as they were busy as. Lovely staff and prices good.

site_logo

cansh1969 . 2023-08-22

MORE AT Google

We used to go here all the time because it was so great. The last time we were very disappointed but figured it was a one-off. It wasn't, we ordered takeaway - the smoked chicken appetisers which normally we love and fight over, so we ordered two lots, was so tough and as we didn't want to pay dentists fees, they had to go in the bin. The spare ribs were overcooked and tough, the duck with ginger and sping onions was unmemorable, as was everything else we ordered. Such a waste of money and so disappointing. Not going back again.

site_logo

plasgraig . 2023-08-20

MORE AT TripAdvisor

We ordered a takaway - £90 worth and so many things wrong with it. The sesame chicken starter was so overcooked it was like strips of rubber; we ordered two portions of 6 dumplings and only got 8 in total; the spare ribs were tough and mostly gristle; the manderin chicken was rubbery and the sauce tasteless; the chilli beef was hard as rocks. This restaurant used to be so good but the quality has been dropping. We won't be going back

site_logo

Julie C . 2023-08-20

MORE AT TripAdvisor

Really cool place. We got take away, but I’d love to dine here some time. Hard to find, but worth it!

site_logo

Matt Pugh . 2023-07-30

MORE AT Google

Visited 22.7.23 part of 10 with 5 on each table food amazing tasty, hot and plentiful staff were very welcoming and helpful will definitely be returning.

site_logo

Julie K . 2023-07-23

MORE AT TripAdvisor

Always excellent service and food outstanding at reasonable price

site_logo

Colin Jones . 2023-07-22

MORE AT Google

Beautiful takeaway. You can tell this is a restaurant rather than just a takeaway kitchen.

site_logo

Matt Booth . 2023-07-01

MORE AT Google

We had a sit down all you can eat meal! Food was quality plenty of it cooked well. Service great. Plenty of takeaway trade Food was excellent staters to die for lovely crispy duck and pancakes Main meal beef in black bean and king prawn and cashew Service excellent

site_logo

pookieWales . 2023-07-01

MORE AT TripAdvisor

Ordered from maki menu. Good portion size on the large side. Perfectly cooked with amazing flavours. No wonder they won the welsh Asian food awards. Will be returning

site_logo

coco21NZ . 2023-06-04

MORE AT TripAdvisor

Amazing food, service very reasonable prices. First visit here but return visit in order!! Parking available near by with extensive menus

site_logo

Scott Wilson . 2023-05-18

MORE AT Google

Amazing place to eat food freshly cooked we had the banquet plenty to choose from every meal was delicious. Staff very friendly and helpful will definitely be back

site_logo

sandra m . 2023-05-06

MORE AT TripAdvisor

Steaming hot fresh tender chicken balls in batter.Lovely sweet n sour sauce piping hot.Egg fried rice very tasty.100% reccommend.Fantastic service and well worth looking at the beautiful huge fish tank.Nothing was too much trouble to make you feel welcome and comfortable.

site_logo

Linda Powell . 2023-04-16

MORE AT Google

Booked here for Dinner as we were staying in Abergavenny for the weekend we decided to have the evening banquet as it looked good value for £27.95 per head , Starters were tasty however I don’t think prawn crackers should be one of the 5 choices you get to choose they should be complimentary , Duck was nice as a second course where this menu fell down was the main choices , curry sauce was cold , Schezwan prawn dish as a main had 4 prawns in it , egg fried rice was the smallest portion I have ever seen literally the bowl was the size of a small teacup and the beef in black bean was tasteless you can order more main dishes included as part of the evening banquet-as long as you finish your first dish we waited 20 minutes to order a chow mein this proved impossible we couldn’t summon a waiter and our table was avoided so we gave up I think they are trying to reduce costs so the evening banquet is not as value for money as it seems as portions are very small and amount of protein in the dishes I.e meat etc is reduced and although main courses are advertised as limitless as long as you finish each dish they are not forthcoming after you’ve received your first main and make it impossible to make another choice we are not food wasters or over eaters so the poor service was unnecessary

site_logo

iluvhollibobs . 2023-04-10

MORE AT TripAdvisor

Excellent evening Food was beautiful service was fantastic. Reasonably priced. Nice atmosphere I would highly recommend this lovely restaurant.

site_logo

894bethd . 2023-04-01

MORE AT TripAdvisor

Quick, tasty, good value and the fish tank was awesome !

site_logo

Lucy Cowan . 2023-03-30

MORE AT Google

This place used to be amazing Went tonight to celebrate Chinese New Year ,obviously just myself and husband. We went for the buffet at £27pp (which had many times before and has been stunning),sadly tonight it was awful The first starters ,we had limited choice as they didn’t have them all available(we were not told this when we were seated) We ordered limited choice starters and when doing so were informed that we should have had prawn crackers when drinks were brought out ,which we didn’t and waited about 20 minutes for it to arrive . The restaurant was very empty .We then ordered the Duck ,for second course ,came out ,pancakes and Duck ,cold,went to the bar as no one came to us to see ,yet again if everything was ok (didn’t on first course I may add) another 25 minutes of waiting Replaced pancakes 5-10 minutes later ,at which time ordered main course .They didn’t replace the duck and tbh second lot of pancakes were tepid . Main course came ,rice was cold and stodgy ,as obviously nuked and not checked all way through. Mains served on cold plates and was awful No one came to check if food was ok ,my husband who never complains about food said it was awful and we both left it and husband went to toilet and then came back and said let’s go I said what about the bill ,he said he d paid it ,literally had our meal for about 3 minutes prior to this I went up again to bar to complain about poor food 2 staff didn’t know what to do ,called someone down who did ask had anyone checked,staff said no I explained I wasn’t happy about the food and service as it was cold and all he offered a was a 10% reduction ,I disagreed,but he said he wasn’t the Manager ,whose name I requested as staff said he was manager “Mike “ is the supposedly Manager and won’t be back until Thursday and is meant to phone me I don’t believe this as written on piece of paper that is used to take orders on But I will be phoning on Thursday,as why should a Restaurant offer poor food,poor service when charging a lot money with the way cost of living is these days And to pay (bill £80) is a lot of money ,especially to those on minimum wage,it actually works out to over a days wages .I did say the bill for alcohol,that I understood (cheaper to buy bottle of wine than by the glass and husband had 2 330ml bottles of larger) Totally disappointed

site_logo

693fionaj . 2023-01-22

MORE AT TripAdvisor

Best Chinese in Wales, food alway great, friendly staff and great value for money.

site_logo

Jon . 2023-01-07

MORE AT Google

Had a takeaway earlier chips was not cooked they were slightly hard and really dry this place has gone down hill alot Sweet and Sour Balls is way smaller along with the prawn toasts

site_logo

Josh Dumayne . 2022-12-24

MORE AT Google

Staff are friendly, food is great and the kids love the huge fish tank.

site_logo

404 Not Found . 2022-11-23

MORE AT Google

Probably the best beef chow mein I've ever had.

site_logo

Jack Mason . 2022-11-10

MORE AT Google

Lovely food and a great range of vegan options (just ask for their separate vegan menu).

site_logo

Mark Pont . 2022-11-08

MORE AT Google

Staff were polite. Starters were OK but all main courses besides the duck were bland. Plenty of food but certainly quantity over quality.

site_logo

laurenwI2431GB . 2022-10-11

MORE AT TripAdvisor

Food very good, service good but premises in need of TLC.

site_logo

Russ B . 2022-10-02

MORE AT Google

This is the worst restaurant I have ever set foot in, absolutely disgusting food. Prawn crackers left out on tables for who knows how long, knives and forks but no chopsticks..unless you fancy a wooden pair. They had a list of about 10-15 dishes they didn't have from their already limited menu. The crispy beef should be renamed 'soft beef', and the noodles were slimey. I have been to some shocking restaurants but this wins hands down. They obviously have the banquet on a Sunday to use up all the leftover food from the week before they close for several days!! Avoid this place at all costs.

site_logo

Carrie Louise Elliott . 2022-08-29

MORE AT Google

We have visited a few times recently. We have had the Sunday buffet and food from the main menu. The food has always been very good. Portions from the main menu are huge. I can understand why you can't take buffet food away because that is liable to be abused. We love the shared starter and also the house special fried rice. It's usually very busy there I am surprised at the negative reviews .

site_logo

Jane K . 2022-08-18

MORE AT TripAdvisor

Had lots of take away from Kongs Aber in the past - Until 6 months ago - top drawer Last three times we have phoned to order...............closed ! end of !

site_logo

Peter Gray . 2022-08-11

MORE AT Google

Staff were great. Food good although not a big lover of Chinese. Rather expensive

site_logo

Alison Ashman . 2022-08-08

MORE AT Google

Table for 2, great and friendly staff. huge potions so definitely worth your money and if you don’t finish it you can take home the rest!

site_logo

joe mama . 2022-08-02

MORE AT Google

We booked a table for 2pm. When we arrived, we were then told the kitchen would be closed in 20 minutes. We decided to go for the set menu and the small starters were not home made and bought in and they were very bland and factory made and the main course, I ordered, sweet and sour chicken. The chicken was deep fried and the chef just poured sweet and sour sauce that was straight out of the bottle, tasted the same as iceland £2 frozen sweet and sour instead of £13.95 that they were charging. The other customers seemed happy and I looked at what they were eating and their food looked a lot better than what we were served. When we were asked "how was the food"? we gave our report and I said, if you did not have the time to serve and cook properly, it would have been better to be honest and stay we would not have time when I rang to book the table. The waitress stopped clearing our table and walked off and started talking to her colleagues and I paid the bill protesting.

site_logo

Matthew Harris . 2022-07-24

MORE AT Google

After not meeting up socially for a long time we were really excited to be meeting at this place for food and drinks. Disappointed on arrival to find the restaurant looking tired, dusty and in need of a decor refresh. We made our way to the bar to get drinks and the chaos at that point set the tone for the evening! We eventually made our way upstairs to our table. The room was very warm and stuffy and a fan and a small air cooler were operating but not near where we were sat. One window was open and another adjacent window was closed. We asked the waitress if the fan could be moved closer to be told she wasn’t allowed to move it, we challenged this so she said she would ask permission, she didn’t return! Another waitress then came, by now we had opened the other window. This obviously upset her and she proceeded to close the window (with attitude) and when we asked again if the fan could be moved this seemed to upset her and she protested and proceeded to cause a fuss, banging and stamping around eventually repositioning the air cooler, the mood continued throughout the remainder of the evening. Food was ok, but so many rules and restrictions applied to the all you could eat banquet that it just made for a difficult and tense experience. Service was slow and laboured. The evening ended with some of our party asking if they could take home the food they couldn’t finish, to be told this wasn’t allowed, and so food that was paid for subsequently ended up in the bin. Overall an extremely disappointing experience, we won’t return and cannot recommend 🙁

site_logo

skyus . 2022-07-23

MORE AT TripAdvisor

nice little Chinese good food it was just to much of it, but its ok what you leave you can take away with you.

site_logo

Gary Marlborough . 2022-07-12

MORE AT Google

Had an absolutely great evening, very friendly and obliging staff and the food was fantastic. If you enjoy Chinese food Kong's is well worth a visit. Definitely worthy of five stars awarded.

site_logo

Paul Jones . 2022-06-30

MORE AT Google

Well impressed with this place ,the food was amazing and they give you so much of it

site_logo

Natalie Mitchell . 2022-06-29

MORE AT Google

was nice what i had but had some left over so i asked for a container to take home they said no cuz i ordered from banquet and not the menu ,i think its bad as they would ony tip it out in bin .

site_logo

901beverleye . 2022-04-17

MORE AT TripAdvisor

The worst take away I have ever had. Our first and last visit. Never again. Had chicken crispy noodles, tasteless watery slop.

site_logo

Andrew Mcfart . 2022-04-07

MORE AT Google

Great food at reasonable prices. The good at Kong's had been constantly good every time I've been. Would recommend highly.

site_logo

Thomas Gibson . 2022-03-15

MORE AT Google

Been to Kong's many times, one of our favourite places but tonight, service was very poor. Waited ages for our food, order was incorrect, not once but twice, not their usual standard. Hope it is just a 'one off' as it's the best Chinese around!

site_logo

Mary Gatrad . 2022-02-20

MORE AT Google

Thought we would have a Thursday night treat with the kids so the kids decided on Chinese and we ordered a takeaway from Kongs! Ordered crispy chicken noodles at £8.50 and what I received was a tray of dry tasteless rock solid noodles? Looked in my the tray for chicken but none could be found until I come across a container with some slimy chicken pieces and what I can only describe covered in gravy? No actual Chinese taste involved here. Being confused as if this was right I rang and after two phone calls I was told to tip the slop on the crispy noodles. My son, who will eat anything put In front of him had a bite of some noodles which dug straight into the roof of his mouth. I can honestly say this was the worst looking and tasting muck I’ve had in my possession The rest of the food was tasteless and over priced…pretty much went in the bin…near on £ 40 down the drain I never write reviews but I feel like dick Turpin has jumped off his horse and robbed me of my £40 God awful place

site_logo

Skippy11221122 . 2022-02-03

MORE AT TripAdvisor

Amazing lovely polite and smilly staff. Ready tasty food. I would only like to be warmer as I was a bit chilled, but definately we would go back. I was impressed with both food and People. Thank you.

site_logo

Kiki Sianou . 2021-12-04

MORE AT Google

Great food on the all you can eat menu

site_logo

Gavin Bourne . 2021-12-03

MORE AT Google

Me and a friend booked here for some food. We had all you can eat menu which was priced at 22.95. Sounds fantastic but there’s a 2 hour limit so once you place your first starter the time apparently starts lol and you have 2...

site_logo

564lewj . 2021-11-01

MORE AT TripAdvisor

Sunday Buffet Lunch was lovely Good service

site_logo

Wendy Davies . 2021-10-29

MORE AT Google

Ordered beef curry egg fried rice cold and king prawn feung very small portion and watery wouldn't go again

site_logo

Paul madigan . 2021-09-30

MORE AT Google

We experienced exceptional service after they managed to squeeze us in without a booking. Food was decent and very filling thanks to the large portions. Toilets were clean and parking nearby.

site_logo

James Hoskins . 2021-09-29

MORE AT Google

This is pretty much your average Chinese takeaway. The food is good, if a little greasy, but that's to be expected from a takeaway. Everything seems reasonably priced, and the staff are friendly and helpful. However, I wouldn't have wanted to dine in, as the...

site_logo

A S . 2021-07-30

MORE AT TripAdvisor

Lovely food, had the banquet and it exceeded my expectations. Great sized portions

site_logo

Janet Mayers . 2021-07-25

MORE AT Google

Pleasant little restaurant. Food generally good but could be hotter. They need to use heated food warmers at the table and use hot serving plates. Duck dishes not recommended as too much fat/skin and little meat. Otherwise ok.

site_logo

MarionB . 2021-07-25

MORE AT Google

Have had a takeaway from here before, but we recently ate inside the restaurant and it was a great experience. Their selection of vegetarian options was not the widest, with some 'vegetarian' options containing oyster sauce, which was a bit concerning. However, the dish that I did have, the sea spicy aubergine, was delicious and perhaps the best vegetarian dish I have had from a Chinese. The atmosphere was good, and the food was well priced. I will definitely be visiting again in the future, and I would recommend for eat in or takeaway.

site_logo

Amber Wilkes . 2021-06-27

MORE AT Google

Excellent food staff very attentive would recommend

site_logo

Wendy Andrews . 2021-06-20

MORE AT Google

The buffet idea I think is amazing. The food was delicious and the atmosphere was nice and cozy. Every single dish I ate was fantastic. Definitely recommend.

site_logo

pavols440 . 2021-06-11

MORE AT TripAdvisor

Fantastic food, fantastic staff, fantastic atmosphere. I would happily return again and again to such a wonderful place.

site_logo

charlestrwalker . 2021-06-07

MORE AT TripAdvisor

Probably the worst Chinese meal ever. Ate outside in garden as inside was dark & grubby. Nice red picnic tables but there was litter on the lawn and the grass needed cutting. Started with bbq ribs in sauce which were fatty and soggy. Prawn toast...

site_logo

Julie E . 2021-05-26

MORE AT TripAdvisor

Fast service always excellent food and fenerous portions. Only criticism sat close to door and it was open and cols so ate with my coat on.

site_logo

Angela Dean . 2021-05-23

MORE AT Google

the food was very tasty and is honestly the best chinese i’ve ever been to. the service is great! they have a buffet with many options and is also 5 stars. i definitely recommend going here

site_logo

Jet55550383652 . 2021-05-05

MORE AT TripAdvisor

We've enjoyed a few takeaways from Kong's in recent months. Orders are taken accurately, food is delicious, prices are reasonable, it's always ready at the time we are given to collect. Thanks, all!

site_logo

Kavita Favelle . 2021-03-19

MORE AT Google

Really good food best chinese in the area

site_logo

Brownie Mtb_08 . 2021-01-30

MORE AT Google

Good food but I would recommend town gate as the prices are more reasonable and the food is better

site_logo

Owen Birch . 2021-01-29

MORE AT Google

Lovly food Best Chinese in Abergavenny

site_logo

Adam Gibson . 2020-11-18

MORE AT Google

Plenty of taste in the food, but we struggled to find much meat in each dish.

site_logo

Natalie Harris-Powell . 2020-10-17

MORE AT Google

We had a sit down all you can eat meal! Food was quality plenty of it cooked well. Service great. We were the only ones in the restaurant! However plenty of people coming in for takeaway orders

site_logo

pookieWales . 2020-10-14

MORE AT TripAdvisor

I've had a few meals from here over the last year based on the good reviews. Unfortunately every meal I have had has been disappointing. Initially I put it down to a few bad nights in the kitchen. Soggy batty on the meats, and nothing...

site_logo

angillo . 2020-09-26

MORE AT TripAdvisor

The food was delicious, really large portions as well. Excellent service and great staff

site_logo

Beth Makin . 2020-09-07

MORE AT Google

Much better than before lockdown. Lovely food and great service.

site_logo

mike boyd . 2020-08-12

MORE AT Google

Food was delicious and plenty of it. We sat in the gazebo but was slightly worried that we might get forgotten about. We had nothing to worry about as staff were very attentive and we were well looked after. Would definitely recommend.

site_logo

Lisa Wright . 2020-08-05

MORE AT Google

Food good staff friendly value for money

site_logo

Carl Johnson . 2020-08-05

MORE AT Google

Had a takeaway from here last weekend whilst staying locally. The meal was OK but nothing spectacular. We had two starters – chicken satay (good sized decent, moist chicken and tasty sauce) and spicy salt and pepper squid (much too much pepper and also a...

site_logo

Sellest . 2020-07-25

MORE AT TripAdvisor

It was shut! It says they are open on their website but they are not. Update your opening hours people! 😠

site_logo

Anna Wilkes . 2020-07-09

MORE AT Google

First time I’ve had food from here. Plentiful tasty and really good value for money.service was fast and efficient bThank u.

site_logo

TracyW1775 . 2020-06-20

MORE AT TripAdvisor

Great place anybody go there try the crispy duck fab

site_logo

Julie Blanchard . 2020-05-28

MORE AT Google

Complete lack of customer service. A young boy who had no idea of being nice or being "anything". If you want a business, please employ people who care !!! . If you are going to employ young people, train them to be polite and have...

site_logo

Samantha P . 2020-02-29

MORE AT TripAdvisor

Good value and good choice of food. Wine was reasonably priced. Will definitely be going back

site_logo

Lynda Hadfield . 2020-02-20

MORE AT Google

This has got to be one of the best Chinese food I have ever seen or eaten. My Wife has the same food so she knows how good it was.

site_logo

Philp Danaher . 2020-02-06

MORE AT Google

I love Kongs and have been a regular customer since 2009. I am really sad to see a few negative posts. However, reading the first 3 comments maybe they are unfair because the food wasn't ready on collection or customers felt they were not spoken...

site_logo

Claudine1111 . 2020-01-23

MORE AT TripAdvisor

Fantastic food ..... restaurant and takeaway

site_logo

Julian Edwards . 2020-01-07

MORE AT Google

My husband had pre ordered the takeaway to be collected at 8:30 but when we got there the order wasn’t ready!! I understand it’s a big order we had but it felt like they were doing the restaurants food first not the takeaway orders. The...

site_logo

P518FUsamh . 2020-01-01

MORE AT TripAdvisor

New years eve. Rang kongs at 7.20pm to ask what the waiting time was for food and explained I was going to book a taxi to collect order. Was told 30 minutes. I ordered a take away and rang a taxi and booked it to...

site_logo

antitank . 2019-12-31

MORE AT TripAdvisor

Lovely evening, fabulous company, great meal. 16 of us had the 'All You Can Eat Banquet Menu,' . Food was cooked and served to perfection. Well done Kongs. Happy New Year to all staff.

site_logo

Paul Clark . 2019-12-31

MORE AT Google

I have dined here many, many times and never had a bad experience until Christmas Eve. Ordered crispy aromatic duck, it had been over cooked to the point it was cremated, and the waitress struggled to shred it off the bone. My friend ordered battered...

site_logo

Deborah_182014 . 2019-12-30

MORE AT TripAdvisor

Best chinese restaurant/takeaway in town .

site_logo

Terry . 2019-12-21

MORE AT Google

A very poor Chinese restaurant to say the least. We drove for over half an hour to get here and were left extremely dissatisfied. It was all very much the same style sauces with the addition of different meats. The noodles were bone dry and tasteless. All in all not good at all.

site_logo

Jedd G . 2019-12-11

MORE AT TripAdvisor

Our first take away from Kong’s and it was excellent. We will be eating in soon and will use take away service again. First class.

site_logo

Beverley Davies . 2019-12-08

MORE AT Google

Food is lovely, good value for money with great hospitality.

site_logo

Game Tag ImLisaFromEarth PeepsTheDragon . 2019-11-16

MORE AT Google

Had the all you can eat buffet, food was pretty tasty with the exception of the veg spring rolls which were soggy cooked from frozen. Staff with the exception of one of the lady waiters need to be served dinner there by the owners so they know how to provide a better experience - all slightly awkard, in combination with the longest list of all you can eat buffet rules you will ever experience.

site_logo

bhrdg . 2019-11-02

MORE AT TripAdvisor

Similary restaurants in South Wales

restaurant_img
3.8

55 Opinions

location-icon62 Monnow Street
Chinese
outdoor_seating_203660takeaway_203660delivery_203660

the food was delicous nothing can beat canton kitchen ive tried all dine in and takeaway around monmouth and this one was the best the service was amazing and I will always come back for more

restaurant_img
4.1

82 Opinions

location-icon180 Newport Road
Chinese
outdoor_seating_177016takeaway_177016delivery_177016

Deliver to Undy/Magor, deliver at time they say they would, delicious food, lovely service on phone and delivery drivers - our favourite Chinese takeaway!

restaurant_img
4.1

238 Opinions

location-iconBank Street
Chinese
outdoor_seating_172674takeaway_172674delivery_172674

Lovely food, staff were really lovely and accommodating for us as a group of women with a newborn baby, will definitely come back

restaurant_img
3.2

147 Opinions

location-iconCross Street
Chinese
outdoor_seating_89152takeaway_89152delivery_89152

Always been the families favourite Chinese in town 😊