GastroRanking-logo
whatsappWhatsapp
phoneCall
desktopWebsite
menuMenu
bookingBooking
3.1

Based on 90 opinions finded in 1 websites

site_photo3

Nº 564 in 695 in Oldham

Nº 20 of 29 Chinese in Oldham

CUSTOMERS TALK ABOUT DISHES WITH..currypepperriceprawnfriedchickencookedduck
Score
OpinionsNoteTripAdvisor903.1

comment_iconOpinions

Awful crispy beef very small portion roasted in salt awful dry meal. Won't be returning ever. Over £10 for a small box I couldn't finish it due to all the salt so was still hungry. Don't waste your money.

site_logo

roadrunner . 2025-03-17

MORE AT TripAdvisor

Really enjoyed hot duck (our third visit) busy atmosphere, staff really nice and fab food! Yes it comes out bit by bit as the kitchen chooses but they warn you of that! Will be back soon!

site_logo

Ski2034 . 2025-02-01

MORE AT TripAdvisor

Ordered a takeaway for two people directly from their website for a birthday tea. It said 90 mins (which seemed a bit excessive for a Monday night.) After two hours, I had repeatedly called to be told various excuses including the classic ‘5 mins away’ line and blaming on an Uber Eats driver when I’d ordered directly from them. The girl on the phone was either clueless or being forced to lie by her manager. After finally getting refunded, the food finally came after over 2 and a half hours (and promptly sent back as it was now gone 8.30pm and birthday tea ruined.) The driver had no idea that there had been any issues. It was clear that they had forgotten our order and had rushed to get it ready when I rang to chase it up. If they’d been honest and apologised instead of all the lies, then I wouldn’t be leaving this review. What a shame that this place has gone so downhill like this.

site_logo

Rebecca C . 2025-01-28

MORE AT TripAdvisor

We were lrderd a takeaway and told 80 minutes which in hindsight we should have heard the alarm bells. 100 minutes later we receive the order, there are people kicking off in the shop, 3 customers were given their money back wholsg we waited. We got home and it was somebody's else's order , what a farce.

site_logo

SpottheBall . 2025-01-18

MORE AT TripAdvisor

First of all requested for a booth and didn’t get one so immediately annoyed when the room was pretty much empty. We were sat between 2 other groups on very small tables I get that it’s a small place with not many tables but it is very cramped and there was plenty of tables and booths available when we arrived but we were sat in between 2 tables may aswell have been all one group we were that close! Service was slow girls were stood round chatting when people clearly wanted to order food and drinks. Ordered 2 drinks first off and we realised the service was slow so when one of the girls was nearby ordered 2 more. She removed our 2 drinks off the table which were half full and left us with the used plates until the next round of food came and awkwardly removed them when serving next course. By this point we were drink less as our half full glasses that cost £7.25 each were removed and the new drinks order had not arrived. Completed our full main course of 6 dishes without drinks and had to ask again for our drinks. They came once we had finished eating. Not good enough to have drinks removed and not refilled whilst eating spicy food!!!! Then when the bill came we realised we’d been charged for doubles and not singles so been charged £11.35 each on the drinks that were taken away half full. Shambles really and it’s a shame because the food was actually really good. Very tasty nothing was greasy although the chips were lukewarm. Good food however definitely overpriced and really let down by poor service and overcharging. It was my birthday meal so very disappointed. Won’t return and won’t recommend

site_logo

Atothelo . 2024-12-30

MORE AT TripAdvisor

Take-away - ordered through deliveroo with a follow up conversation explaining what to exclude from the order… mushrooms due to dietary requirements. Order arrived with this still in the dish and when contacted again, there was nothing they could do - it appeared too much trouble. Offered money off next order but this would not allow us to have the meal this evening which was over 30 pound for ribs, beef curry, fried rice and chips. The ribs as a starter were poor. Overall it was an awful experience with poor customer service. The rapid decline of this establishment is not good. I could say more but I will keep it to the point.

site_logo

Peter W . 2024-11-10

MORE AT TripAdvisor

Me & a friend visited Hei Hei's adjacent restaurant Hot Duck above the takeaway offering after reading positive reviews online. The server suggested we ordered 2/3 dishes each. I ordered the Thai Green Curry with steamed rice and some prawn toast. My friend had the salt & pepper Calamari, veg spring rolls and egg fried rice with some salt & pepper chips to share. The restaurant operates on a 'Chinese Tapas' style basis so everything comes as it's ready which we had no problem with. My curry was one of the first things to arrive and, after prompting the server to check on our rice after everything else had arrived, by the time I received the rice my curry was mostly cold. The curry itself was extremely spicy and only had 3 pieces of chicken in which was disappointing. Most of the food appeared to be 'padded out' by onions and peppers and portions were not generous at all considering we paid £72 overall! Despite this, the service we received was absolutely faultless and the staff went out of their way for us throughout our meal. Another thing is that the tables were too small for a tapas style meal and the server pulled a spare table next to us to give us adequate room for our dishes - I understand as its a small place that space needs to be maximised but it doesn't work for this style of meal. Overall the food is extremely overpriced and just the same food served from the takeaway offering just with the prices ramped up and served from bowls rather than takeout boxes! Would like to reiterate that the service from staff was great we just had an issue with both the quality & quantity of the food.

site_logo

RB . 2024-01-04

MORE AT TripAdvisor

Our order arrived within the hour however was a disappointment considering it cost us £60 for 2! The food was luke warm and the salt and pepper squid was dreadful. ( a soggy mess) We also realised we had been sent the wrong sauce, after a quick call, we presumed considering we live 4 mins away in the next village it would be a quick resolution however 40mins later and still nothing arrived. We then called up to say don’t bother bringing it as we had eaten the Chinese. They explained they would send the driver back with a refund for the missing item. We are still waiting… We won’t be a returning customer. Extremely disappointed.

site_logo

Hannah R . 2023-11-11

MORE AT TripAdvisor

They were busy as was Friday night, informed me it would be 30mins wait for takeaway. I ordered salt & pepper chicken wings and duck in ginger & spring onion. When I opened the containers I was astonished that starter and main course were Onions with chicken wings and Onions in duck sauce and all for £21, a total disgrace and a con

site_logo

Robert B . 2023-11-04

MORE AT TripAdvisor

Arrived and was pointed in the direction of table for two, was then asked to move literally sat so close to the couple next to us I felt we were dining together. Absolutely not my thing communal dining and could here every bit of their conversation so sat pretty much in silence myself! Ordered food, my partners duck selected on the piece of paper never arrived. Didn't mention it as neither of us wanted to stay longer than necessary to be honest and we weren't charged for it so that's fine but just very poor attention to detail when one of us ended up having egg fried rice and prawn toast, driest meal ever 😂😂 I had the "hot duck" beef curry which was basically the mayflower stuff Iake at home and very underwhelming, calamari was the chewiest rubbery consistency ever... all the food would be "acceptable" from a Chinese chippy take out / delivery but definitely not for a sit down restaurant experience. Staff gathered we weren't impressed, didn't drink my drink was also poor. Won't return, which is a shame living so close by. Tables are too small for a tapas style eatery, we had to move the lamp and water glasses to the window cill just to have space to have two dishes eat on the table! I get they need as many seats as possible but it just doesn't work for small plates, it becomes uncomfortable. I saw a table of 6 walk in as we were leaving and dread to think how they got on if they ordered the suggested three dishes each!

site_logo

Vicky G . 2023-09-16

MORE AT TripAdvisor

With it being the festive season, I only yesterday made a gingerbread house with my son. Imagine my surprise at handling overpriced, classless, tat again when it came to tea. Part of this is my own fault, I never learn that many a takeaway is out and out crap but my hunger and passage of time tricks me. I know Hei Hei is average at best, but my faith in them getting restaurant priced tucker right blinded me yet again. Never again, chicken and sweetcorn snot laced in a float of salt, followed by starters for two, crispy and light you’d expect these things to be, yeah like an old guy’s toe nails with these attempts. Then a duck whose freshness sailed the shores with its quality many moons again, it actually stank. £38, didn’t even throw in prawn crackers. Genuinely, businesses like this deserve nothing, go the chippy it’s far better value.

site_logo

Darren H . 2022-12-25

MORE AT TripAdvisor

Paid £45 for food that went in the bin! Only decent thing was the prawn crackers, £9 for a dire chicken fried rice. Ribs and chips that had clearly been re heated. The salt and pepper chips... all salt no pepper the ribs I don't think a dog could manage to eat! And I've never eaten chicken that has fat all over it! What have I actually eaten? Definitely wasn't chicken never again

site_logo

Claire C . 2021-03-23

MORE AT TripAdvisor

Very very salty. The sharing box was like a bush tucker trial. Crispy beef was so crispy you couldn’t even tell if it had meat in and snapped in half. Chicken was a very strange consistency. The beef and mix vegetables was lovely.

site_logo

Louisevstewart . 2021-03-20

MORE AT TripAdvisor

We decided to have a Chinese New Year lockdown family feast and this place came recommended by some Saddleworth friends. It was worth the journey to collect. Top food and we will be back.

site_logo

Wander05424828279 . 2021-03-08

MORE AT TripAdvisor

When we visit family in the area we always take out here. During lockdown I decided to stop off on the way back from a job in Leeds. The food is still restaurant quality for half the price and the portions are great for us as a family sharing.

site_logo

BertieHospo . 2021-02-26

MORE AT TripAdvisor

Cannot fault this place for quick and tasty fresh food. Like eating in Hong Kong but sat in Oldham! I went for Chinese NY food and had the Duck Udon and my girlfriend had Singapore Vermicelli, both were spot on.

site_logo

Robinnature . 2021-02-26

MORE AT TripAdvisor

Thought, with everyone else going to the restaurant, we’d try this Chinese take away about 15 miles from where we live. Walked passed loads of times, but never called in. Really pleased we did - food was quick, hot and tasty. Don’t need to say anything else. Top meal. Well worth the drive.

site_logo

shB3527OB . 2020-07-05

MORE AT TripAdvisor

I should've checked the ratings before my visit!😡.. no wonder I had a stomach bug for two days!!.. avoiding this place from now on... it's easy while theres such a big choice Chinese restaurants and takeaways in the area!!😡

site_logo

InHisDen . 2020-01-11

MORE AT TripAdvisor

We ordered sliced chicken, sliced beef, both in curry sauce, stir fried bean sprouts and beansprouts and noodles. Both chicken and beef had a weird texture, soft and slimy, inedible! What a waste of money! Everything else just ok! This place used to be so good, do they now use substandard meat? Wouldn't bother again!

site_logo

Sue00do . 2019-12-29

MORE AT TripAdvisor

We rang at 6pm for delivery at 7.30. . Rang again at 8 to be told food would arrive in 15 minutes. Food came 2 minutes later. Everything was tepid. We felt the driver had been driving around since 7.30.To top it all the food was dreadful. Salt and pepper squid is not a dish served cold. It was floppy and flaccid. The batter was thick. The seasoning non existent. Apart from being cold the spring rolls were adequate but let's be honest not cooked from scratch.Duck was described as being served in a plum sauce. It came with unmentioned pineapple and was far too sweet. We also ordered chicken in ginger and spring onions. The sauce, apart from being cold, was acceptable but the chicken had the consistency of plastic. Never again.

site_logo

jan w . 2019-11-23

MORE AT TripAdvisor

Give no ⭐️ rating. We ordered a takeaway for collection on Sunday 6 Oct. The person who answered the phone told us 15 mins it will be ready. Got there within 7 mins our food was already bagged and ready to go! I thought that was quick I hope the food hasn’t been reheated. Got home, sat down to eat boiled rice soft noodles and tofu in black bean sauce. Disappointed before we tasted the food. No fresh chilli, half a mushroom, two small pieces of green pepper and the onion. The tofu tasted like it had been reheated and the only flavour we could taste was SALT. I immediately phoned Hei Hei’s and spoke with Ben who said he was very sorry he would passes this to the manager on Monday and would give me a call back. I’m still waiting for anyone to phone me back re this disgusting food. We will never order anything from Hei Hei’s again. Obviously they are not bothered what quality of food they serve. Do not give them the business.

site_logo

Rudygrace14 . 2019-10-11

MORE AT TripAdvisor

Went for a takeaway sat evening ordered crispy won ton,skewr chicken satay,mains duck mush oyster sauce/ chiken red thai curry and egg fried rice for £23 good value. . staff are very friendly and helpful, ordered , went for pint in waggon , food ready in half an hour. all was very nice although chicken red thai was a little bland, duck was great. i think a fault with many takeaways is that they are a bit too salty? Anyway we`ll be back.

site_logo

518dkb . 2019-09-25

MORE AT TripAdvisor

I used to go to Blue Ginger in Springhead when I wanted a chinese because it is closer to my house and I've been going for years. BUT prices have gone up and and the portions have gotten smaller. Not to mention the rice is dry. I was recommended Hei Hei's by a friend and I'm happy they did because it is so much better than Blue Ginger. Portions are bigger, it's cheaper, rice isn't dry and the service is quicker. Definitely will be returning!

site_logo

bxllarosx . 2019-07-27

MORE AT TripAdvisor

We ‘treated’ ourselves tonight to a not-so-cheap Chinese takeaway. The food arrived early, however that’s where the positives end! The soft Noodles were dry round the edges and very salty. The rice had a horrible taste and the curry sauce inedible because of salt. Our other sauces were also incredibly salty, with not a nice flavour. The only thing our £41 ‘treat’ ended up doing was filling our green bin and leaving us thirsty with a terrible after taste in our mouths! We’ve had plenty of Chinese meals, from various places. This being the worst we’ve ever had!

site_logo

kathRmc . 2019-06-30

MORE AT TripAdvisor

Ordered vegetable Singapore noodles, ended up with every bit of meat under the sun. Picture below. The Chicken fried rice was incredibly bland, the chicken wasn’t even fried. Close your eyes and you’re eating Uncle Bens.Not the cheapest of Chinese either. Have a think before you order from here.

site_logo

Hayhoe123 . 2019-06-01

MORE AT TripAdvisor

Ordered food to take away while visiting family on the recommendation of other family members who had visited previously. The food was very good. We ordered to collect so cannot comment on their delivery but the food met our expectations and all requests were met with no issues. Would definitely recommend and will certainly visit again when back in the area.

site_logo

Ells_04A . 2019-05-19

MORE AT TripAdvisor

This take away just offers false promises. We have had food before that we have collected which was good so thought we would order a delivery. There menu states they deliver within a 3 mile radius plus £1.50 exceeding 3 miles. We checked on google earth and we are 3.5 miles from them. When we called to order TWICE they refused to take our order saying they don’t deliver to our post code. A realLoss for them as we order take out Chinese all the time. DO NOT WASTE YOUR MONEY ON THIS LOT USE ANOTHER TAKE OUT THAT WANT TO TAKE YOUR MONEY. WILL NEVER UAE AGAIN.

site_logo

jamesaO7362QN . 2019-05-17

MORE AT TripAdvisor

Vegetarian Served meat soup after asking for Veg soup! Then to be accused of ordering wrong.. No offer of refund!! The worst service.

site_logo

xen369 . 2019-03-16

MORE AT TripAdvisor

Ordered for delivery- states time 7.15pm, 16 phone calls later, food arrived at 8.30 - Luke warm and chewy - absolute garbage

site_logo

Dtb1234 . 2019-02-10

MORE AT TripAdvisor

First of all the food is generally very good. It is wrong of me not to state that I’ve had a few very good take out (collection!!!!) meals from them before.

site_logo

Passenger760237 . 2018-12-24

MORE AT TripAdvisor

Took over 2 hours to have food delivered, staff couldn't give any timescale to when it would be received on countless phone calls.

site_logo

Natalie B . 2018-12-17

MORE AT TripAdvisor

Ordered our food online. Was told we would have to wait 1 hour 40 mins which was fine. 2hours 30 mins later and 15 phone calls and our food still hadn’t arrived. The person on the phone told us he didn’t know where our food was?? My fella drove to the restaurant to see if he could collect it and was told it was out with the driver but they weren’t sure where???No alternative was offered. We were just told to ring just eat and get a refund. No real resolution from hei heis itself. It was just tough luck. When it finally arrived it was cold and there were items missing. Rubbish

site_logo

sarahh566 . 2018-12-15

MORE AT TripAdvisor

Had a tasty delivery from Hei Hei last night, vegetables with cashew nuts and noodles and hubby had beef in black bean with steamed rice. Both very fresh and light, the veg and cashew could have done with a little more heat maybe but overall delicious

site_logo

charlottewalker13 . 2018-12-12

MORE AT TripAdvisor

went in to order takeaway to collect, had spring rolls, prawn toast, shredded duck with uddon noodles and chicken with chilli and of course fried rice. asked how long as were going to get pint in waggon very helpful staff said no problem can keep food warm. the food was hot and good quality. Both chicken and duck were great. Have been before and would return, next time will get prawn crackers!!

site_logo

518dkb . 2018-11-16

MORE AT TripAdvisor

I read the mixed reviews of this place on Trip Advisor but given a hankering for a Chinese meal, and it was too late to cook, we gave Hei Hei a go. We found the staff were very polite and helpful, and the Chinese takeaway meal was good, very enjoyable. Portions were generous if you have a hearty appetite. We had no complaints and would go there again.

site_logo

Carol J . 2018-11-15

MORE AT TripAdvisor

Ordered a takeaway of chicken satay and fried rice. Looked and smelt awful.

site_logo

TheMonkofManchester . 2018-10-03

MORE AT TripAdvisor

Have ordered from here numerous times with brilliant food and service every time. Last night I ordered Salt and Pepper Squid and the Singapore Vermicelli and they were both absolutely superb, batter was crisp and the amount of protein in the vermicelli was amazing, super tasty and a solid 10/10. I also ordered it for 7:55 as I could serve before the football kicked off, 2 minutes early, brilliant! Keep it up guys and there is never going to be a change where I order my food from! Thanks again

site_logo

Cunnerzzz . 2018-09-26

MORE AT TripAdvisor

We usually ha e take a way, very good food with nice pleasant staff. You can park easily a Ross the road from it.

site_logo

BECMATTManchester . 2018-07-28

MORE AT TripAdvisor

We chose to collect a takeaway from hei hei as staying in the nearby area of Denshaw and we were told that there was a nearby Chinese by our host.

site_logo

KieranML . 2018-07-18

MORE AT TripAdvisor

The food is always excellent from hei hei's. We are vegetarian and often Chinese food isn't great for us but they never disappoint.

site_logo

omimax38 . 2018-07-09

MORE AT TripAdvisor

Totally agree with other comments regarding staff, they are so rude. Unpleasant, unfriendly, ignorant. WILL NOT GO BACK!!!!

site_logo

janetrS9242MA . 2018-05-14

MORE AT TripAdvisor

We had a take out for 6 people last Saturday.

site_logo

AnyB . 2018-04-25

MORE AT TripAdvisor

Food is ok apart from the dim sum which is all identical to the chinese supermarket frozen stuff, so that's what it probably is. That aside, the service and attitude of the staff is appalling. I was spoken to rudely on my first visit, but decided that he could have been having an off day, so gave them another chance.

site_logo

robeckersley . 2018-02-16

MORE AT TripAdvisor

Haven’t eaten inside but had takeaway many times. Always very nice and promptly delivered. Maybe slightly on the expensive side but the quality is there.

site_logo

Nico100 . 2018-02-11

MORE AT TripAdvisor

What a shame! We've enjoyed many meals from here over the years, but will not be ordering ever again.Ordered two meals online. Indicated delivering about one hour. After an hour and 45 we rang up. Was informed it was being delivered. In total we waited 2 hours. The person we spoke at the restaurant was extremely rude. The food was average.

site_logo

Fursey123 . 2017-12-02

MORE AT TripAdvisor

I have just read a review and its identical to our experience, usually the staff are very pleased to see you but not on this occasion, the staff were rude had no people skill and the service was outrageous barring in mind there is an extra 10% charge to sit inside for what ever reason I have no idea because there was not service to speak of.

site_logo

infoC6317SW . 2017-08-28

MORE AT TripAdvisor

I ordered a takeaway from Hei Hei and the food here is absolutely top notch. It is a little bit on the expensive side but you get what you pay for. It tasted really fresh and authentic and is easily the best Chinese food I've had in a long time, so if you don't mind paying a little more don't think twice about ordering from here. Delivery was quick too and food really hot. Oh, and I'm also pescatarian (so I only eat fish and veggies) and had the vegetable chow mien, it was absolutely delicious.

site_logo

Bekka S . 2017-07-22

MORE AT TripAdvisor

I've been to hei heis for food on quite a few occasions the staff are very unfriendly and miserable last time we went in to eat I preferred to sit in as the food is hot and freshly cooked .but they said the staff were on there break and as it was 5.30 in the evening I thought that was odd as they don't open until 5 so we had to settle for a take away so we ordered the meal for the guy to then tell us we would have to come back in 1 hour to pick it up it's a joke we went there New Year's Eve 10 of us walked in and said could we sit in the back the staff said no we were gutted then the owner came in and heard us say but there's no one in the back he asked us what we wanted we again said we want a meal could we sit in the back he said of course you can . must say the staff weren't happy .if you can't sit in the back and eat why have it there . close it off .I have to say the food is brill and I wouldn't mind but it's freezing in the back room but you put up with it because the food is so good the staff need to stop acting like they are doing you a favour .maybe they don't want to wash the pots I don't know but it really makes you not want to go in there and give them your business

site_logo

Jodymagpie . 2017-07-13

MORE AT TripAdvisor

I would not recommend them anymore, the service was good but the food was inedible and this is the second time. they used to be really good. very disappointing.

site_logo

uppermilltherapies . 2017-06-17

MORE AT TripAdvisor

Visited midweek evening and sat inside. Decor a tad dark and dingy and too cold to take our coats off!!! However the food was lovely, cooked fresh and served steaming hot. Would definitely recommend but maybe next time I would get a takeaway and enjoy it in the comfort of my own home,

site_logo

joannehB6144GS . 2017-05-17

MORE AT TripAdvisor

Food is always nice and the choice is good. Can be slow and make mistakes when very busy, but normally a good service.

site_logo

Jakr297 . 2017-04-06

MORE AT TripAdvisor

The salt and pepper chicken wings served here are lovely, if you like a treat now and again, I'd recommend these. As a take out they are fairly quick with the cooking. The only negative was, one time I went, they forgot to start cooking them. However as this was a mistake, it wasn't the end of the world. I'm yet to try other things from this menu.

site_logo

WilliamS3238 . 2017-03-05

MORE AT TripAdvisor

The food is average considering its quite expensive for a take away, if your having dim sum you'd better have a sweet tooth as its usually covered in syrup which basically spoils it. I've also found it can be quite greasy. That said i've also had some nice main meals so its a difficult one to gauge really

site_logo

Mike B . 2016-11-15

MORE AT TripAdvisor

We decided to eat here after shopping in Uppermill,we arrived about 16.45 and they were still preparing food,but we sat in the restaurant section and were served in a few minutes.The food was freshly prepared ,the vegetables crunchy and tasty and the sauces were spicy,which we had chosen,the king prawn dish had a generous portion of prawns and the spicy Tofu was good.

site_logo

mc m . 2016-09-29

MORE AT TripAdvisor

Never had food in but takeaway excellent. Great choice and reasonably priced for the quality you get. Very extensive menu. Freshly prepared.

site_logo

hemimach . 2016-09-11

MORE AT TripAdvisor

Food superb. Wonderful take away. They offer very inexpensive delivery locally. Although we collected the meal.

site_logo

Matthew M . 2016-08-31

MORE AT TripAdvisor

Great service received, quality food freshly cooked and friendly service. We shared a takeaway meal which was brought to our table outside and made to look like a meal for two. We were impressed and will recommend to others and will visit again. Thanks ***** M

site_logo

130michelless . 2016-08-23

MORE AT TripAdvisor

We regularly order take away from here, they deliver, which is a bonus. The food is usually fantastic, but occasionally it can really let you down. Last week we had a rice dish missing from the order, this week the veg curry was lovely and fresh, but undercooked to the extent that the veggies were very hard. While we've used the take away regularly I am at the point where it's too inconsistent and I don't know if I will anymore.

site_logo

Honeyroar . 2016-08-13

MORE AT TripAdvisor

Pedimos para llevar, todo estaba delicioso, tardaron un poco porque había más pedidos pero el personal fue nice. Repetiría sin duda.

site_logo

NoaRouco . 2016-08-04

MORE AT TripAdvisor

Both food and service were perfect. Best Thai red curry was exceptional and I also highly recommend the Schezuen chicken.

site_logo

nilshai . 2016-07-15

MORE AT TripAdvisor

Excellant food and friendly staff. Choose to eat in or take away both as good. Same menu if take away so you still have as many choices. You can phone for delivery, eat in or take away - which doesnt take long and easy parking right across the road. Good chef selection if your not sure what to have.

site_logo

j0annashaw . 2016-07-10

MORE AT TripAdvisor

Ordered a take away from Hei Hei last night after being recommended by a friend. It came within a short time and the food was really nice, fresh and reasonably priced.

site_logo

KJC2795 . 2016-07-04

MORE AT TripAdvisor

I visited with some friends to eat in after having numerous take away a from here, the open kitchen is a real winner you can watch your food being cooked right In front of you so you know it's fresh to your order.

site_logo

samuel g . 2016-07-02

MORE AT TripAdvisor

My go to take away!! Food is always brill, staff always happy and remember you! Would Defo recommend this place for food!

site_logo

C5943XYlisak . 2016-06-26

MORE AT TripAdvisor

The crispy duck is delicious.. Efficient, welcoming service and reasonably priced. Best Chinese in Saddleworth!!!!

site_logo

Karianne H . 2016-06-26

MORE AT TripAdvisor

I regularly eat at Hei Hei , I'm slightly addicted to their spicy chicken vermicelli!! It's AMAZING. Beautiful flavours! If I could eat there everyday I would!

site_logo

Bradley C . 2016-06-23

MORE AT TripAdvisor

Since moving to Uppermill a few years ago we have always been impressed by the quality and freshness of Hei Hei takeaway. It is more restaurant style dishes but at takeaway prices. Also, on a family visit they coped well with a massive order, when I cannot be bothered to cook for everyone.

site_logo

Hotpoteater . 2016-06-23

MORE AT TripAdvisor

We have ordered takeaways many times from here and have always been very satisfied with the service and the food. The standard is very good, not a run of the mill Chinese chippy, the food is neither greasy or loaded with MSG and good size portions too, served in plastic containers. Very Good!

site_logo

Sue00do . 2016-06-22

MORE AT TripAdvisor

Only round the corner from where I live which makes it too easy to call in. Beef and cashew nut and Thai green curry are my go to favourites. Being able to see it being cooked fresh is always a bonus too.

site_logo

RCLstangroom . 2016-06-21

MORE AT TripAdvisor

A family favorite of ours, very generous portions, an extensive menu at superb value. The restaurant is clean & has a chilled atmosphere, suitable for groups of friends & families & great service. The owner is very polite & is very welcoming!

site_logo

Sam S . 2016-06-21

MORE AT TripAdvisor

Always find Hei Hei in Uppermill to provide really good food and service. It's always busy but that is a good thing when you are talking about food. It's provides the best Chinese food in the area and has an extensive menu but my favourites are the salt and pepper spare ribs and Singapore noodles. Everything is cooked to order and it's great to see everything cooked right in front of you. They are even now supplying alcohol which is an added bonus, and although small you can also eat in, a great option for a change of scenery. Keep up the good work!

site_logo

AndyHaz . 2016-06-20

MORE AT TripAdvisor

We had the Hei Hei banquet for 3 people. It was delivered on time and was perfect. It was clean Chinese food. Quality ingredients, no MSG and not greasy. Some allegedly first class Chinese restaurants in Manchester frequented by footballers etc could learn a lot from this quality establishment.

site_logo

Rob B . 2016-06-20

MORE AT TripAdvisor

Visited this weekend with a few friends. Have to say nothing was too much trouble, even altered a few dishes to accommodate the fussy ones amongst us. Friendly staff and a good selection of dishes. will definitely be going back !!!

site_logo

dwhitchurch2016 . 2016-06-19

MORE AT TripAdvisor

A few of us visited Hei Hei this week. What a great menu, excellent value and superb venue. Staff friendly and a chilled atmosphere. Will be back soon. Thanks!

site_logo

awalvin . 2016-06-15

MORE AT TripAdvisor

Plentiful. Excellent. Piping hot. The right money, quick service.: everything a good takeaway should be. My case rests ...

site_logo

SilverSurferOldham . 2016-06-12

MORE AT TripAdvisor

If you order the same couple of noodle dishes every time then it's not to bad. Most of the menu just seems to be food by numbers with little substance and a lot of onions

site_logo

O544LNjohnw . 2016-05-24

MORE AT TripAdvisor

Used this take away several times, it does what it says on the tin....it's a take away! That said it does offer a small tabled area at the back of the kitchen if you want to eat in.....it's bring your own beer though.

site_logo

Jimbojet733 . 2016-02-15

MORE AT TripAdvisor

This is the best Chinese food in the area by far. I have eaten in and taken out. You can buy an alcoholic beverage next door and sit in with it -Added bonus.

site_logo

Ali-J-Brennan . 2016-01-27

MORE AT TripAdvisor

After reading a couple of bad review on TP, I was reluctant to try but last night I had a takeaway from this place and went in to collect on a Saturday evening the place was busy, however it was very sufficient operation with the open kitchen right in the middle of the place, food was cooked right in front of my eyes. Lovely salt and pepper ribs and the king prawns satay was good too.

site_logo

Mkershaw88 . 2015-12-13

MORE AT TripAdvisor

We have takeaway from here at least twice a month always excellent, but tonight very disappointing back to using plastic chicken please use proper chicken

site_logo

fiona t . 2015-12-06

MORE AT TripAdvisor

I have sadly never dined in so can only comment on service and food.

site_logo

daniellej932 . 2015-11-05

MORE AT TripAdvisor

This establishment has existed for some time but has apparently recently undergone a change in management/ownership. It offers both sit in dining and take away. This review concerns take away.

site_logo

BCSaddleworth . 2015-10-20

MORE AT TripAdvisor

Similary restaurants in North West

restaurant_img
3.1

82 Opinions

location-icon116 Union Street
Chinese
outdoor_seating_151873takeaway_151873delivery_151873

any time we order from dragon palace the service is amazing with friendly staff & drivers incredibly delicious food always get empty plates and always early deliveries

restaurant_img
3.3

251 Opinions

location-icon218 Ashton Road East
Chinese
outdoor_seating_332274takeaway_332274delivery_332274

Had to review low for the crispy beef. Was very disappointed, it was more like a pork scratching texture. Couldn't taste any beef in it. Salt & pepper chips are very good. Everything else seemed decent apart from the crispy beef. Won't be rushing back sorry.

restaurant_img
3.5

286 Opinions

location-icon30 Dunkerley Avenue, Failsworth M35 0EB England
Chinese
outdoor_seating_244906takeaway_244906delivery_244906

I haven't eaten here for a long time! I had a meal recently! It's improved a lot! The taste is very good!

restaurant_img
3.5

2674 Opinions

location-icon2a Greenbridge Lane
Chinese
outdoor_seating_166391takeaway_166391delivery_166391

Great food, fresh and piping hot.

restaurant_img
3.6

126 Opinions

location-icon69 Market Street
Chinese
outdoor_seating_198134takeaway_198134delivery_198134

Absolutely FANTASTIC First time ordering here and it was amazing Every dish was delicious and tasty , Great portions Can’t wait to try it again