Based on 1.779 opinions finded in 4 websites
Based on 1.779 opinions finded in 4 websites
Opinions
Very good food and service. Recommended
HMD Khan . 2024-08-16
MORE AT Google
Fully loaded 🍟 and American burgers recommended love it ❤️
Paul Faller . 2024-08-15
MORE AT Google
The food is tasty, I love the chicken wings
Mbo Mbeti . 2024-08-15
MORE AT Google
Food was amazing and fresh.. great food for the price..
Raman Muthu . 2024-08-14
MORE AT Google
The manager was class, big credit to the man. 🔥🔥🔥
Alexander Dale-Makin . 2024-08-13
MORE AT Google
I ordered Mega pizza deal and it was good value for money. Food was hot and the staff was friendly.
Muhammad Haris . 2024-08-11
MORE AT Google
Awesome place to eat the deserts, grill chicken tikka kebab and milkShakes 😋😋😋 Best place in Manchester ❤️❤️❤️🍗😍🐔 protein + Carbs = 💪🏻
Ahmed Ibrahim Bhatti . 2024-08-09
MORE AT Google
Burger l had was very good beef and Peri Peri would recommend
Matthew Williams . 2024-08-09
MORE AT Google
Great food as always, Lewis is a legend.
Olive Tree Cats . 2024-08-09
MORE AT Google
Late delivery, cold, very salty, I am not happy at all.
Bartek . 2024-08-09
MORE AT Just Eat
Very tasty food & polite friendly staff, will definitely be back!
Corey Bennett . 2024-08-09
MORE AT Google
Great bunch of lads and great food price was good as well and very polite
Paul Anderson . 2024-08-08
MORE AT Google
better than all the other places havent had this place in a year, its really good.
Jessica . 2024-08-07
MORE AT Just Eat
Great food and made fast, manager was very friendly. I’d recommend the BBQ Grill Chicken.
Mohamed Ben Ali . 2024-08-07
MORE AT Google
Tasty food, friendly staff and great service
Mark Buckley . 2024-08-04
MORE AT Google
Excellent food, excellent delivery
Anthony . 2024-08-04
MORE AT Just Eat
Amazing service from Oman! Thank you! Will definitely order again!
Lydia . 2024-08-04
MORE AT Just Eat
Good food, reasonable price and polite staff.
Alex Uzaizi . 2024-08-03
MORE AT Google
My gals favourite pizza🍕 place and my favourite chicken place
Tima . 2024-08-03
MORE AT Just Eat
Loaded fries with peri peri chicken was really good and the place was very clean
Zara M . 2024-08-03
MORE AT Google
Love the food from here its amazing the service is great and the atmosphere here is great can have a laugh and a joke with the guys here very welcoming
ItzJakeeBTW . 2024-08-03
MORE AT Google
I love the taste of their Peri Peri chicken .The food quantity is huge!!! Amazing service. Really good behaviour of the team members. I would love to come back here. Highly recommend this restaurant ❤️🌸
GAZI MEEM . 2024-08-03
MORE AT Google
Best takeaway in the area! Every time I come I leave completely satisfied. Other takeaways could learn a thing or two about friendly service from the lads in here. 10/10.
Liam . 2024-08-02
MORE AT Google
Good fried chicken reasonable prices
Shivam Seth . 2024-08-02
MORE AT Google
Driver got lost even though I dropped a pin when ordering
Ian . 2024-08-02
MORE AT Just Eat
Food was hot and fresh, driver delivered fast and gave excellent customer service!
Mario . 2024-07-31
MORE AT Just Eat
Great food, fast and lovely delivery.
Rosie . 2024-07-31
MORE AT Just Eat
Good restaurant, hygienic food.
Akshat Sharma . 2024-07-31
MORE AT Google
Great staff very professional and great food
Juan George . 2024-07-31
MORE AT Google
Very friendly professional staff
Liya 02 . 2024-07-31
MORE AT Google
the restaurant owner is soooooo nice that he gave me an extra ice cream which definitely made my day🥹🥹🥹🥹🥹. ordered a kinder ferrero rocher shake plus a biscoff cheesecake which are exactly the kind of sweetness that i’m craving for in this hot summer day. lovely and love it so much!!!❤️
Nanette Tong . 2024-07-31
MORE AT Google
Brilliant food that I come back to have often. Great staff who are friendly and welcoming and a greatly priced menu that's acceptable.
Ross “Santcas” Freakes . 2024-07-30
MORE AT Google
disgusting food. everything was just disgusting
dream . 2024-07-28
MORE AT Just Eat
Amazing people, amazing food and great service!
JJV media (JJVISUALS) . 2024-07-28
MORE AT Google
Preordered food for collection was done for when we got there quality service cheers
Sam Coulborn . 2024-07-27
MORE AT Google
Quick and friendly service and portion size is great
Anthony Cockbain . 2024-07-25
MORE AT Google
Noman was really nice and sweet and made sure to bring my food quickly :)
Nishaat . 2024-07-25
MORE AT Just Eat
Good food, friendly delivery driver
Saul . 2024-07-25
MORE AT Just Eat
Great food and service, staff are also really friendly. Would defo come again
Vas N . 2024-07-24
MORE AT Google
The driver Noman is patient and kind, waiting me even He cant contact me
Man . 2024-07-24
MORE AT Just Eat
Food was good and fresh just like the cheery delivery driver promised. Think his name was namoo or nemo? 🤣 Will be ordering again
Dean . 2024-07-24
MORE AT Just Eat
Cool place . Very nice and friendly staff
Matheus Luna . 2024-07-24
MORE AT Google
Very good quality food . Good customer service. Love to go again.
Usman ajmal . 2024-07-24
MORE AT Google
Omg just called in for a well done chicken kebab as I'm staying at the travelodge and the best tasting kebab to date..I say no more 😋
Paul Brown . 2024-07-23
MORE AT Google
Was visiting the area after a nearby event and hadn’t had any food this evening. Stumbled across this take away. Service and food quality was excellent! Really enjoyed my burger, chips and fried chicken. Next time I come to Salford, I shall definitely return. Thanks guys!
J B . 2024-07-22
MORE AT Google
driver was asking personal questions and he was talking crazy
Amal . 2024-07-22
MORE AT Just Eat
I loved the food in foodstation mainly here MILK CAKE and the manager also cool
Prasanna thota . 2024-07-22
MORE AT Google
Food is always made fresh, would highly recommend this takeaway! One of the best in manchester
Jamil Ahmed . 2024-07-21
MORE AT Google
Chicken tikka is very good here and good service by manager Ahmed
Pranith Sama . 2024-07-20
MORE AT Google
asked for 2 different milkshakes both had nuts in one frero one malteaster yet both was the frero ended up putting mrs in a and e don't think I'll be using it again
Leon . 2024-07-19
MORE AT Just Eat
very nice food, amazing and kind staff
brogan . 2024-07-18
MORE AT Google
MASHALLAH NICE FOOD NICE SERVICE NICE ATMOSPHERE 🥰
Rafay Butt . 2024-07-18
MORE AT Google
Delicious pizza 🍕 ever in Salford, great staff ,highly recommended 10/10 💥👌
Haseeb Ahmad . 2024-07-17
MORE AT Google
Food station is the best takeaway in town.I love their food.always fresh and well cooked. I visit foodstation mostly and everytime tried new meal and all are so tasty. Food station have above level taste. I highly recommend food station. Staff is so friendly and helpful. Must give a try to food station, after that u will keep going on and on👍👍👍
Arisha Haseeb . 2024-07-17
MORE AT Google
The food is so delicious and the quality and quantity is outstanding, staff is friendly and professional, highly recommend salford legends 10/10 ❤️❤️❤️
Numan Irfan . 2024-07-17
MORE AT Google
Very nice and welcoming experience, food is great.
Fabakary Drammeh . 2024-07-14
MORE AT Google
The guy that served us was really friendly, nice environment 10/10 food
Natalina Renae . 2024-07-14
MORE AT Google
Very friendly staff, very good service, and lovely food.
Cherno X X . 2024-07-14
MORE AT Google
I would give 0 stars if that was an option. The server was despicable and rude to me and my girlfriend (not sure if this was a homophobic motivated incident ) the man with the dark hair,beard told my girlfriend she needed to ‘go to the gym’ I’m not sure why men with beer bellies the size of bowling balls always have so much to say. He was rude to EVERY other customer in the building, everyone felt awkward. Our order was marked as being ready, we made our way to the shop only for him to basically tell us we are taking the piss because it’s not ready yet, the app said it was that’s why we are literally here??? Will never eat here again and recommend you don’t either. That guy needs a new job, he shouldn’t be dealing with customers.
Alex owen . 2024-07-14
MORE AT Google
Somehow every single staff member are equally amazing! So friendly and accommodating! Hands down best takeaway in Salford, heck, best in all of Manchester! Get here whenever you get the chance! 10 out of 10!
Sabah Akhtar . 2024-07-13
MORE AT Google
Banging food as always. Friendly staff, always welcoming atmosphere. Never had any issues with the food.
Jamie Owen (Business) . 2024-07-13
MORE AT Google
This place sells banging onions rings n milkshakes love it so so much they are really good n amazing customer service 10/10 recommend
Passport55979212759 . 2024-07-13
MORE AT TripAdvisor
Very late , food was cold and dry
Kenya . 2024-07-13
MORE AT Just Eat
It was very nice experience the staff is also very friendly
Malav Mehta . 2024-07-10
MORE AT Google
Friendly lads, solid food and very reasonable prices.
Chris . 2024-07-10
MORE AT Google
Really good service and amazing food as well
Emesomi . 2024-07-08
MORE AT Google
Tried work burger meal ,I went crazy ,the American burger was so delicious,juicy and even though my mouth was watering while eating eat good food,good prices and quality +quantity are massive ,I’ll personally recommend this to everyone,love you guys
Amir Zaheer . 2024-07-08
MORE AT Google
delicious food 10/10 service ❤️❤️❤️
Desiree Balogun . 2024-07-08
MORE AT Google
Great staff, welcoming atmosphere
Ahmed MohamedAli . 2024-07-07
MORE AT Google
Lovely food, friendly staff. Highly recommend 😋🤤
Anthony Moody . 2024-07-06
MORE AT Google
Great place. Wide selection of food. Staff are always friendly and the food is tasty! It’s a decent price too.
Andrew Crossland . 2024-07-06
MORE AT Google
Most amazing and delicious food in the town so as the staff
Syed Siraj . 2024-07-04
MORE AT Google
I love the food here and the ppl are very friendly
Mathias . 2024-07-04
MORE AT Google
Very friendly staff and quick service:) would recomend
Angel Dixon . 2024-07-03
MORE AT Google
The food was great. Superb service. A must try. Very friendly manager
Carl Niba . 2024-07-02
MORE AT Google
Delicious food at affordable price. Must try.
Mohamed Sithik H . 2024-07-02
MORE AT Google
Great food and friendly staff. Amazing overall experience!
T . 2024-07-02
MORE AT Google
Great place with so many options! Staff were lovely and very efficient. Especially recommend if you’re at the Travelodge nearby!
Amal Khalidi . 2024-06-30
MORE AT Google
loved it good food good service. Logan is mint
Kai Power . 2024-06-29
MORE AT Google
Superb place with friendly and accommodating staff.
jedmistro . 2024-06-29
MORE AT Google
Best pizza I've had in ages will be ordering again
Lauren . 2024-06-29
MORE AT Just Eat
Friendly as soon as I walked in. Lewis is a lovely bloke, couldn't of asked for nicer service.
Lucid_Scorch clipz . 2024-06-29
MORE AT Google
Hey! 🌟 If you're looking for a good food outlet, I recommend checking out "food station& shakes" in Manchester Salford. It's a great spot to grab a bite to eat!
SOURAV SHARMA . 2024-06-29
MORE AT Google
Horrible taste horrible made . You can't call this food. My first and last time I don't advice you. Avoid .
NABIL . 2024-06-27
MORE AT Just Eat
Mixed kebab was great. Wish more than one sauce was included with it though. I added my own sauces at home to really get it to my liking. Also wish the chicken was cut into bite sized pieces rather than big chunks - that would be easier to eat. My partner enjoyed his burger and fries - no complaints. Friendly staff when we called to change our order. Will order again :)
Arafah . 2024-06-26
MORE AT Just Eat
I was directed to this place by Google when I searched healthy food outlets… this is your run of the mill cheap burger and fries takeaway… as far removed healthy food as you can get… Food ain’t much better either…
Don Felipe . 2024-06-24
MORE AT Google
Awsome food ,educated staff , manager Ahmed is fantastic man, he’s a good convincer and i love peri grill chicken and lamb kebab, and try out biscoff milk cake as wel ❤️♥️😍😍😍
M Usama Shakoor . 2024-06-24
MORE AT Google
Great staff clean premises and quick service
Rocib Rahman . 2024-06-23
MORE AT Google
Good food, always fresh and quick
Marianna Mervjak . 2024-06-23
MORE AT Google
Amazing food very kind and well mannered
Melissa Alves . 2024-06-23
MORE AT Google
The food was very well prepared, quick and efficient service, and food was fresh.
Abu-Darda Khan . 2024-06-22
MORE AT Google
Food station is the place where food goes to commit suicide. Myself and my boyfriend ordered a delivery for 2 chicken burger meals and a fried chicken meal but it tasted awful not like chicken at all and was blatantly reconstructed meat 🤮 we had a few mouthfulls and left it. Baring in mind we hadn't eaten any other food that day and were starving. We woke up this morning with bad tummy’s. We will never eat there again.
Miss Dearden . 2024-06-22
MORE AT Google
Great food to eat in/take out. Great Staff 😉
Carl McDonald . 2024-06-20
MORE AT Google
Love the food here and the service is always amazing
Kyle Godden . 2024-06-20
MORE AT Google
Always a pleasure coming here, very friendly staff and good value as we get the Too good to go bags! Definitely recommend
mackayla rice . 2024-06-19
MORE AT Google
Such nice food and such kind staff! Would recommend to anyone.
Basant Messruther . 2024-06-17
MORE AT Google
Fantastic meal deal - really reasonable but great quality chicken burger
Amelia Kendal-Williams . 2024-06-16
MORE AT Google
Excellent service, fast and reliable. My go to takeway everytime. The food is hot and tasty and the staff are friendly and helpful.
connor goulding . 2024-06-15
MORE AT Google
Very fast and very early delivery, thank you for my drink and cake and custards
Alice . 2024-06-14
MORE AT Just Eat
Everything was good except the smelly and not fresh Seekh kabab. please deliver fresh food. thanks
Tayyaba . 2024-06-11
MORE AT Just Eat
These schedules may not be completely accurate on special days. Please always confirm with the restaurant
Similary restaurants in North West
1856 Opinions
Food was not bad came from Sheffield and was recommended Burgerizm by somebody, would i visit back probably not. Placed an order and rang the store for extra cheese on the burgers but apparently they
creamchickenfriedwafflecakemeatpizza1942 Opinions
Came here for a bottomless brunch to celebrate a birthday. The servers were lovely, Rachel was great. However the food was really terrible quality, it was cold and hard to eat, we were so hungry after
creamchickenfriedwafflecakemeatpizza