GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.3

Based on 2.057 opinions finded in 2 websites

site_photo4

Nº 173 in 599 in Solihull

Nº 5 of 14 American in Solihull

CUSTOMERS TALK ABOUT DISHES WITH..olivesribsteaksirloinsteaksribeyesaladmeatpayfilletladychickenprawnsbeautifulcookedgarlicbasschurros

comment_iconOpinions

Lewis is the best barman I've ever had, his cocktails are amazing and runs a great bottomless!

site_logo

XxcharlieXx14 Young . 2025-03-15

MORE AT Google

Zhante was amazing! Had such a lovely bottomless brunch, great food and drinks! Thank you so much xx

site_logo

Georgia Williams . 2025-03-15

MORE AT Google

Way more expensive than I remember, but isn't everything now! Can't beat the food though, so delicious!! Have a look at their early bird deals online when you book. Will definitely take advantage of that and come back again!

site_logo

Sara A . 2025-03-11

MORE AT Google

Appalling bar service - Met some friends for drinks and was ignored by staff behind bar - when we did get some acknowledgement the guy said ‘you won’t get served standing there - you need to move round’ !! I get that it was busy and some of the bar area is probably reserved for the servers getting diners drinks but it was not the sort of attitude we expected. Needless to say we went elsewhere in Shirley for our drinks and won’t bother here again.

site_logo

Doug Hall . 2025-03-09

MORE AT Google

Great experience as usual.good service and atmosphere.friendly staff.curtis a great ambassador for fiesta.made our visit enjoyable.

site_logo

M and G Macca . 2025-03-09

MORE AT TripAdvisor

Harj service was fantastic as she was confident, attentive and a excellent host. Food was fabulous. I would recommend this place.

site_logo

Sawita K . 2025-03-08

MORE AT TripAdvisor

Great meals, decent drinks service- but at a cost.

site_logo

Keith Richards . 2025-03-08

MORE AT Google

Food was beautiful and the service was amazing. The staff were really friendly and welcoming. We had the early bird menu and was excellent value for money. The portion sizes were good, we couldn't eat it all!

site_logo

Selina E . 2025-03-08

MORE AT TripAdvisor

Came here on valentine’s day and the food was spectacular! My only complaint is that the wait between the starter and main course dish was an hour, besides that everything else was great. We were served by Lauren who was so efficient within her job role, I am a picky eater and have a lot of allergies and she was so accommodating and helpful in regards to that.

site_logo

potion cosmetics . 2025-03-06

MORE AT Google

Served by Harj who was so lovely and attentive! Had a delicious serving steak for 2 and a bottle of wine, cooked to perfection! Will definitely be returning.

site_logo

Charlotte . 2025-03-06

MORE AT TripAdvisor

Great Service, Belly pork excellent, great side dishes, ie mac and cheese in particular

site_logo

Fash 1970 . 2025-03-06

MORE AT Google

Had a lovely time here for my grandads 94th birthday. We were served by Harj and her service was lovely. She made sure everything went smoothly with his cake and we really enjoyed our food. Will be back again!

site_logo

Paris. . 2025-03-06

MORE AT Google

First time visiting and had a great afternoon. Sunday lunch was excellent and great portions! Service from Raj was top notch and she was very attentive for a busy table of 6. Nothing was too much trouble. My only negative .. the peach passion cocktail taste like overly diluted squash. Everything else was 10/10

site_logo

Helen M . 2025-03-03

MORE AT Google

Great food, great service and great atmosphere! Live music was a really nice touch. Food was delicious, will definitely be going back.

site_logo

J B . 2025-03-03

MORE AT TripAdvisor

Great service from our servers Harj and Hannah Had great live music

site_logo

Saran Dhami . 2025-03-02

MORE AT Google

Service for drinks were slow!! However, the service for food was fast. The food was 10/10 worth every penny. Best steak I’ve had in years. Will be back!

site_logo

Abbey Cooper . 2025-03-02

MORE AT Google

Our first experience and it was lovely! Our waitress, Molly, was so lovely as well

site_logo

Genevieve Evans . 2025-02-28

MORE AT Google

Food and drinks were amazing and service was very friendly. Shout out to Zak the bar man - he was brill!

site_logo

Liam Beard . 2025-02-28

MORE AT Google

Excellent service from Haij!!! Super friendly and lovely xx

site_logo

Chelsea Anne Nocon . 2025-02-27

MORE AT Google

Harj was lovely and the food was absolutely splendid. Great place and great service .

site_logo

Anika Priya Rahman . 2025-02-27

MORE AT Google

Haij was fantastic, great waitress, really friendly and went above and beyond during our meal this evening.

site_logo

Colin Shaw . 2025-02-27

MORE AT Google

The food is amazing with an atmosphere to match. Hard served us and ensured we had such a lovely time

site_logo

Thierry France . 2025-02-21

MORE AT Google

Myself and my wife visited the Restaurant for our Anniversary. The Restaurant was decorated to a high standard, service was spot on, the staff very professional. Food was excellent, Garlic Mushrooms sauce with our main meal was very moorish. Great meal. Will definitely return again 👍

site_logo

John Delaney . 2025-02-20

MORE AT Google

Went for a Valentine’s date night and couldn’t fault a thing, food was delicious, staff were attentive but not pestering. Atmosphere was delightful. Definitely worth a return visit.

site_logo

Fi G . 2025-02-17

MORE AT Google

We love Fiesta at Edgbaston, so thought we would try Shirley. I don't know what they're thinking but it's all very First Dates. Plastic plants hanging from the ceiling, massive bar, loud live musician (who to his credit was great), high ceilings, bright lights and arm to arm tables. Very different to the intimate and more rustic candlelit experience you get at Edgbaston where the food does the talking. It was very overwhelming, so we left. The manager and server were really understanding though and very friendly and helpful when we said we wanted to leave. I think this restaurant, I'm sure, is very lovely to a lot of people, but if you like a low and slow more private and classy setting, Shirley is not the location.

site_logo

Alex Lowbridge . 2025-02-15

MORE AT Google

Great service from Harj & the food was amazing! Recommend.

site_logo

Dan Beed . 2025-02-13

MORE AT Google

Food was over cooked had the daddy t bone 80 quid which then lead to us eating separately as I’ve had to send back ,not ideal when it’s date night over all the night when down hill shake as this place use to be great

site_logo

damian waller . 2025-02-07

MORE AT Google

We had a fantastic meal with superb service 😀

site_logo

littlemaggie79 . 2025-02-03

MORE AT Google

Fantastic amazing food great customer service by Zhante in particular really good service

site_logo

Gurdev Delair . 2025-02-02

MORE AT Google

A joy to have this place on our door step .

site_logo

S Singh . 2025-01-31

MORE AT Google

Staff very friendly, attentive. Food was excellent, although mostly of an “Italian” flavour. Atmosphere was really nice, great for a nice cosy meal

site_logo

Ben . 2025-01-30

MORE AT Google

Harg was our server and was amazing throughout. Really looked after us well. Food was great. Well worth the money. Would recommend to anyone wanting a fantastic night out.

site_logo

Mia S . 2025-01-17

MORE AT Google

We had a truly disappointing experience at Fiesta del Asado Solihull on what was meant to be a special anniversary celebration. Despite the restaurant's reputation, the food and service fell far below expectations. My steak was overcooked and dry, and the waitress said she would get it replaced, it arrived with reheated microwaved inedible sides after a 25-minute wait. My partner finished her meal alone, while I waited for mine. To make matters worse, we were overcharged for three steaks, with no one on-site able to rectify the error and give me a refund. Follow-up communication has been equally poor. Despite assurances of a refund and resolution, we were offered only a £50 voucher 4 weeks later which would require us to spend more money to correct an already appalling experience. This level of service is shocking and I would not recommend this place to anyone.

site_logo

Steve Dixon . 2025-01-14

MORE AT Google

Lunch with Spanish, Argentinian, German and English co-workers. Everything is spectacular and Mario's attention is 10. On the next visit we will repeat without a doubt.

site_logo

Fernando Obeso Herrero . 2025-01-12

MORE AT Google

Mario and the team gave a warm and friendly welcome. This is our 5th visit and the food was excellent as always. Louis makes an excellent Old Fashioned! Great, warm and cosy atmosphere, will definitely return and always recommend.

site_logo

Dan Leyland . 2025-01-12

MORE AT Google

Excellent service, Mario was very approachable, very delicious barbecue, we are Spanish and Argentinian and we will surely return! Excellent service, Mario was very approachable, very delicious barbecue, we are Spanish and Argentinian and we will surely return!

site_logo

Natalia Bosch Marco . 2025-01-12

MORE AT Google

To be honest I found this place disappointing. I ordered bread for the table, and then had to cut it up myself so it could be shared. My shandy tasted like it was made from soda water - even after I complained. The lamb shank was good but the sauce was bad. Over £7 for a broccoli side is a rip off. I don’t think this place knows what to be, but it is expensive and I’ve eaten better and had much better experiences in places for half the cost. I can’t recommend and probably won’t go again.

site_logo

Steve Jakab . 2025-01-11

MORE AT Google

Amazing as always! We visit from Scotland every year with friends from Birmingham and Wales - it's that good! Harj was great as always, food and service was impeccable as expected - will be back again soon!

site_logo

Lisa Burnham . 2025-01-11

MORE AT Google

Enjoyed a very nice meal, alongside a lively atmosphere. Steaks are delicious and customer service was excellent especially from Harj who was very welcoming and helpful. Would highly recommend for a nice meal out.

site_logo

Jeevan Bansal . 2025-01-11

MORE AT Google

We went to this restaurant as a family of 10 on a Friday evening to celebrate my son’s birthday. Both my son and I are coeliac and additionally he eats a ketogenic diet for medical reasons. Once upon a time this was a great restaurant with good food choices for dietary requirements but alas no longer. Everything and I mean pretty much everything has flour in it, including creamed leeks and garlic mushrooms!!! All foods are pre-prepared. We opted for steak and asked for our potato terrine to be swapped for broccoli which was the only veg they could do to accommodate us, they then charged us an additional £14 for the privilege on top of the ridiculous price of the steaks. I asked for my steak on the rare side of medium, it came out pretty much raw. We were charged for a drink we didn’t have and £60 as a service charge. The serving staff to be fair were great but the place was empty, so I’m sure they were glad to have something to do. I would not recommend anyone with any dietary concerns to ever visit this restaurant as they are too inflexible to be of any use. A really expensive disappointment and one which we will never repeat.

site_logo

Helen Dufficy . 2025-01-11

MORE AT Google

Harj was an excellent host as always …looks after us as if we her personal guests .. happy new year all at fiesta Shirley !!!!

site_logo

Neil Taverner . 2025-01-04

MORE AT Google

Amazing steak and special shoutout to our server Kyle, excellent service all night and felt well looked after.

site_logo

Christian Nicholls . 2025-01-02

MORE AT Google

Food was exceptional. Expensive, yes. But, if steak is served right then worth it. And mine was. Fillet rare. Usually all places tend to overcook but mine was perfect. And other dishes were really tasty. The reserve malbec was absolutely delicious. Again, expensive, yes. But, worth paying an extra £20 for such a great evening of food. Mario, our server was beyond incredible. He was attentive, and available and also really chatty and friendly. He helped make our evening as wonderful as it was, and we'll definitely be back!

site_logo

Amanda Juniper . 2025-01-01

MORE AT Google

Came on New years night and had a great night, service from Jamie was excellent he made us feel very welcome! HWAGM

site_logo

Gianni Di Mambro . 2025-01-01

MORE AT Google

Always have a fantastic meal here amazing starters and amazing main meals. Staff are always happy and friendly. Thanks Fiesta Del Asado

site_logo

Russell Debar . 2024-12-28

MORE AT Google

Mario and Zhante were lovely, our food was incredible. Couldn't have picked a better place to celebrate our engagement!

site_logo

Dylan Hawthorne-Slater . 2024-12-27

MORE AT Google

Had an amazing meal to celebrate our engagement!

site_logo

Grace Attwood . 2024-12-27

MORE AT Google

Cocktails were lovely! Service was great. X

site_logo

Carrie Clarke . 2024-12-21

MORE AT Google

We were here for our works Xmas meal and drinks. All really enjoyed the evening and we would highly recommend Fiesta - great job, first class with lovely atmosphere; one said it was the best steak she has ever had. Manager Mario very welcoming couldn't do enough for us .Harj is very attentive, great service. Worth coming back.

site_logo

Sue Cadalzo . 2024-12-09

MORE AT Google

Dropped in whilst staying in Birmingham. The food was great, steaks were amazing. Atmosphere was great and our server Haj was brilliant, very attentive and friendly. Would absolutely recommend.

site_logo

Jemma Reid . 2024-12-08

MORE AT Google

Good experience. Lovely evening. Solid food

site_logo

jilhad123 . 2024-12-07

MORE AT Google

Excellent Argentinian restaurant, Harj looked after us very well, overseen by Mario. 10/10 would visit again, food was perfect

site_logo

E K . 2024-12-07

MORE AT Google

I have been here a few times now and have to say it is probably one of the best sirloin steaks i have ever had, therefore, i don't mind when the bill is a bit costly because the quality of food is so good. Good range of cocktails also and the service is excellent as is the manager who is friendly and chatty. I would say that if you want the full Argentinian experience and ambiance, i wouldn't go at busy times on weekends as is really busy and full of large families and children, definitely weeknights is much more enjoyable and doesn't feel like you're on the Shirley high street at all.

site_logo

Carlmathew Holton . 2024-12-06

MORE AT Google

The cocktails here are just perfect, generous and tasty . Food too was delicious, backed by Mario service , attentive and always there when we needed it . 10/10

site_logo

Leandra Seixas . 2024-12-03

MORE AT Google

Came to dine here with a couple friends and was served by Mario. He was so accommodating, helpful and alway came around with a smile. Food was good as always

site_logo

Hoii Huuynh . 2024-12-03

MORE AT Google

Lovely meal. Fantastic service.

site_logo

Lucky Number 7s . 2024-11-27

MORE AT Google

After a long time, I decided to give this restaurant another chance and it definitely wasn't a good idea. I ordered my non-alcoholic cocktail without ice and when it arrived it looked like I had ordered it with extra ice. My steak was like a rubber and there wasn't even a steak knife on the table, I had to ask for it. My daughter's dish was from the children's menu and it didn't even seem like it, it was very spicy. Furthermore, the atmosphere was very noisy. Very loud music and the noise of many people talking at the same time. It was even difficult to order. Faced with this whole situation, I came across a completely unprepared staff who didn't know how to solve this sequence of problems. An unpleasant experience that ended up being very expensive!

site_logo

Barbara Lacet . 2024-11-17

MORE AT Google

I had my baby shower here as it’s one of my favourite restaurants. I have to say the service was outstanding. Nothing was too much bother and the staff are always friendly. Mario the manager made my baby shower joyful and made sure we had everything we needed for a great experience. I always look forward to visiting as the atmosphere is calm whether you’re popping in for a few drinks or food. I’ll be back soon

site_logo

Manjula Turner . 2024-11-17

MORE AT Google

We come to the Solihull branch often and Harj has always been our waitress. She is so attentive and always checking whether we need anything. She always has a big smile on her face and such a bubble personality which makes the experience that much better. She is a real credit to the restaurant and keeps us coming back!

site_logo

Gurpreet Reyat . 2024-11-16

MORE AT Google

Brilliant service from Harj, amazing atmosphere and divine food! Better than Miller and carter!

site_logo

Rajina Chahal . 2024-11-08

MORE AT Google

Great food, Lovely vibe. Fantastic service. Highly recommended - Han was amazing

site_logo

Claire Lees . 2024-11-08

MORE AT Google

Been a few times before. Bar staff are really attentive and cocktails are amazing. We had a meal. Service again excellent. Food was amazing too. Lovely ambience and classy place. Thank you..will defintely go again.

site_logo

Sharon “Shazzleb” Ingleston . 2024-11-04

MORE AT Google

Harj was amazing good halal menu too

site_logo

Abir Khan . 2024-11-01

MORE AT Google

Really good food and great service from Haj. Always enjoy eating here :)

site_logo

Shannon Price . 2024-11-01

MORE AT Google

Our server Harj was very attentive and knowledgable, she made our experience so much more enjoyable having such a friendly face serving us! We will certainly be back and hope to see Harj next time too.

site_logo

Abi Carruthers . 2024-11-01

MORE AT Google

Love this place… Harj the waitress was amazing the service outstanding and i would 100% return if not for the food but for the service delivered

site_logo

a nash . 2024-11-01

MORE AT Google

Food is delicious, fantastic wine- we had croquettes, ribeye steak with various sides & churros for dessert. Staff very welcoming - excellent service.

site_logo

Anita Singh . 2024-10-31

MORE AT Google

My son took me for my birthday meal was absolutely fantastic staff and food exceptional 👏 Thank you so much

site_logo

Michele Mooney . 2024-10-29

MORE AT Google

Lovely Sunday lunch and great service from Curtis

site_logo

Dalton Sarah . 2024-10-27

MORE AT Google

Curtis was attentive and friendly The apple empanada was to die for

site_logo

Debbie Donohoe . 2024-10-27

MORE AT Google

The food is OK, the staff is kind, food came in time but for dessert we had to wait 1h. It was becoming ridiculous. The prices are little bit higher than expected.

site_logo

DoDo . 2024-10-27

MORE AT Google

Service by Harj was great. Lovely atmosphere with great music! Would visit again

site_logo

Victoria Sage . 2024-10-25

MORE AT Google

“I’ve been to Fiesta Del Asado many times, and last night we went for a nice steak and wine. The staff and the manager were friendly, and the steak was perfectly cooked. Compliments to the chef! The atmosphere was nice and relaxing. It was perfect.”

site_logo

Mike Azin . 2024-10-20

MORE AT Google

Had a real nice time ,the food was good and great service from staff . The atmosphere always brilliant inside even when it’s not so busy. Throughly enjoyed the cocktails ! Will be back to do it again soon

site_logo

Michael Wilson . 2024-10-20

MORE AT Google

Came for anniversary, food was amazing, service from Jamie even better. The manager, Kyle, made us feel so welcome, will definitely be back. Thank you team!

site_logo

Ella Wilson . 2024-10-16

MORE AT Google

Food and drinks were great! Service from Jamie and Kyle was excellent. Would highly recommend visiting 👌

site_logo

Lee Wilson . 2024-10-16

MORE AT Google

It was our first time at the restaurant and the steak was so nice and juicy and filled with flavour. Mario’s service was exceptional. He even volunteered to take pictures of us and was always available regardless of us needing anything. Would highly recommend.

site_logo

Hajera Laskar . 2024-10-15

MORE AT Google

Went as a group of 16 on a golf weekend. They had a really good app which allowed everyone to pre order individually before the night. Service was great, lovely place, amazing steaks. Only issue was that all the sauces ordered hadn’t been charged on the app so the bill came to £40 more than I had told the group - restaurant very kindly cancelled the charge so group cost was the same. Great choice for a Saturday night group meal.

site_logo

James Hamilton . 2024-10-14

MORE AT Google

Great restaurant, decorated very authentic. Service was excellent, professional informative and very pleasant. Signing up for their card is very beneficial as you are able to get discounts and save up points to get money off your next visit. Fully recommend.

site_logo

Scot Frederiks . 2024-10-11

MORE AT Google

Our group of 5 ate here last weekend. The service was great from all of the staff, attention to detail, patience and kindness were demonstrated. We waited a reasonable amount of time for food, it was good because we didn't feel rushed. The place was busy and had a good atmosphere. Food arrived, it was tasty and sufficient. My son said it was the best tomahawk steak he'd had to date. Bit of a shock when the bill arrived, there is a service charge, to be fair, we hadn't skimped on what we had. We very much enjoyed our experience.

site_logo

Sha Witt . 2024-10-10

MORE AT Google

Curtis our waiter was amazing. The service was impeccable and his recommendations were exactly what we wanted. Food was excellent and surpassed expectations. Will be going again.

site_logo

Iona Rose . 2024-10-09

MORE AT Google

Perfect service from Curtis to complement incredible food. Great vibe, will definitely be going again

site_logo

Brant Gumbley . 2024-10-09

MORE AT Google

Unreal food last night! Tomahawk was amazing as was the chicken! Will definitely be returning! ❤️

site_logo

Lauren Owen . 2024-10-06

MORE AT Google

Great atmosphere and Jamie our waiter was great.

site_logo

Sam Lange . 2024-10-05

MORE AT Google

Overall good experience. Pleasant staff and serving. Thumbs up!

site_logo

Hafsa Kaleem . 2024-10-05

MORE AT Google

Amazing experience and five star service. We were looked after from start to finish and the food was amazing. I highly recommend and will be going again

site_logo

Vickie Moss . 2024-10-04

MORE AT Google

We were here for my girlfriend’s birthday with her family and had a lovely meal. Harj took amazing care of us! Thank you!

site_logo

jessie miah . 2024-10-04

MORE AT Google

Poor. If People like this place, then they have no taste, probably live on take aways.

site_logo

Keith Dee . 2024-10-02

MORE AT Google

Really polite and kind waiter, Jamie and made it a great dining experience!!

site_logo

Hala Suliman . 2024-09-27

MORE AT Google

Jamie was a lovely gentleman!!! He was super caring and sweet. He took photos of us when asked and had great banter with us on my special day…. My birthday !! HAVE A GOOD WEEK JAMIE. we will deffo be back

site_logo

Davina Samra . 2024-09-26

MORE AT Google

Have dined in Fiesta many times & the food & service is always amazing. Popped in yesterday afternoon for a couple or more cocktails! Kyle served us, what a star he is. It was our wedding anniversary & he kindly gave us a complimentary glass of fizz along with our margaritas. Suffice to say we stayed longer than intended & had a lovely afternoon. The old fashioned was the best I've ever tasted. Kyle, you are a credit to the company, we look forward to returning again soon!

site_logo

emma lawlor . 2024-09-25

MORE AT Google

This place has definitely set a high standard for food/steak. Every aspect of the menu tasted exceptional. Credit to the chef. The staff were amazing and looked after us well from the moment we arrived. Will definitely be returning.

site_logo

Maimoona Peart . 2024-09-22

MORE AT Google

Me and my wife had an amazing amazing dinner at fiesta, Harg served us and was fantastic.

site_logo

Lewis Quinn . 2024-09-21

MORE AT Google

We came on Saturday for bottomless brunch. Mario was amazing, he was so attentive and gave great customer service. The food was delicious and the drinks were lovely. Overall I recommend this experience. The cocktails were proper alcohol and my mom got 2 bottles of Prosecco during our bottomless brunch. So deffo worth the money!!!

site_logo

Sophie Clarke . 2024-09-21

MORE AT Google

Lovely place for a date or family night out. Harj was attentive and took amazing care of us, will be coming back soon☺️

site_logo

Ata B . 2024-09-20

MORE AT Google

Very good service from our server Harj, catered to all our needs and food was impeccable as always

site_logo

Callum Mcdaid . 2024-09-14

MORE AT Google

Harj made an outstanding effort when it comes to customer service, she went above and beyond, we can not recommend her enough ! Thank you so much Harj!

site_logo

Amy Bowers . 2024-09-14

MORE AT Google

Good portions, nice ambience, pleasant service and good food. Enjoyed the whole experience.

site_logo

Madhushekar Mittemari . 2024-09-14

MORE AT Google

Harj made an outstanding effort when it comes to customer service, she went above and beyond, we can not recommend her enough ! Thank you so much Harj!

site_logo

Amy Bowers . 2024-09-14

MORE AT Google

Very good service from our server Harj, catered to all our needs and food was impeccable as always

site_logo

Callum Mcdaid . 2024-09-14

MORE AT Google

Similary restaurants in West Midlands

restaurant_img
4.5

4486 Opinions

location-iconPendigo Way, Birmingham B40 1PU England
American
outdoor_seating_258933takeaway_258933delivery_258933

We had an excellent meal food was fab and Donna was amazing and looked after us, definitely will be back as service was brilliant

restaurant_img
3.8

1496 Opinions

location-iconTerminal 1
American
outdoor_seating_104796takeaway_104796delivery_104796

Perfect spot for the airport, the person who took us to our table was friendly and inviting, the food was lovely and came out promptly and our server Leah was absolutely lovely, she was kind, patient (even though it was busy) perfect definition of service with a smile, extremely professional throughout, if every restaurant had a Leah they wouldn’t need to worry about customer service as she would ensure every customer is attended to and happy.

restaurant_img
3.1

2091 Opinions

location-icon15/17 High Street
American
outdoor_seating_309080takeaway_309080delivery_309080

I love a good Burger King! Sadly, I will not use this one at all. I've never had a good experience ordering from here, the food is always cold even when eating in store etc. But the last time I visited some guy behind the counter was ridiculously patronising despite standing there doing nothing but laughing with his friends. I tried ordering at the till as the self service kiosks weren't working, they seemed to be frozen. The moment I asked to order he pulled a proper funny face at me - literally matching the Emilia Clarke meme - and said "naw, you see those big things behind you? I'm afraid you'll have to use those like everyone else". I told him that if he'd been paying the slightest bit of attention to his job, he'd have noticed ne trying to use them, and that all the screens were a blank white so I couldn't. I then left.