GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.3

Based on 2.107 opinions finded in 2 websites

site_photo4

Nº 168 in 599 in Solihull

Nº 5 of 14 American in Solihull

CUSTOMERS TALK ABOUT DISHES WITH..payolivesribmeatsteaksribeyesaladsteakfilletgarlicprawnsbasschurroscookedchickensirloinladybeautiful

comment_iconOpinions

Amazing Experience – So Grateful We Came! I normally don’t enjoy going out much since developing my disability — it’s been a daily struggle with anxiety, depression, and physical pain. But my partner encouraged me to go out for my birthday, and I’m so glad we did. This place truly exceeded all expectations. The staff were incredibly kind and welcoming, offering some of the best service I’ve ever experienced. We didn’t have to wait long for our food, and when it arrived, everything was perfectly cooked — it looked and tasted amazing. We had the best time, and it meant so much to feel comfortable and cared for. I’d absolutely recommend this place to anyone. Thank you for making my birthday so special!

site_logo

Tanya Newman . 2025-05-13

MORE AT Google

Mario and Curtis amazing hospitality thank you for all your help!

site_logo

Manil Chauhan . 2025-05-12

MORE AT Google

Wonderful experience for a birthday celebration. Lovely atmosphere and great service from Curtis and Zhante!

site_logo

Zainab B . 2025-05-10

MORE AT Google

Had my sisters 60th birthday 🎂 meal there and it was all excellent, couldn't fault them. Thanks a lot. Well worth travelling from Oxford for that occasion! 👍🏾

site_logo

Maxine Hanson . 2025-05-05

MORE AT Google

Everything was so yummy throughout the three courses. The highlight of the night was definitely the porcini croquettes; they were lovely. My pasta main course was really flavourful and had a very generous portion, but the beef was a little tough. The service from everyone was excellent, and it was a fantastic atmosphere. Highly recommend!

site_logo

cate bernal . 2025-05-02

MORE AT Google

Love this place. The staff and the atmosphere are amazing. Been for the bottomless brunch several times now, plenty of options and never left with an empty glass.

site_logo

Stephanie Marshall-Murray . 2025-04-28

MORE AT Google

Overall 10/10, Meals on point,cleanliness, staff so friendly with good customer service,

site_logo

Faith Nzilani . 2025-04-25

MORE AT Google

Great food and brilliant service from Hag and Cartis. My recommendation

site_logo

Yuliia Katrenko . 2025-04-18

MORE AT Google

Harj is the best server, she was lively and attentive all night!

site_logo

Shauna Quinn . 2025-04-18

MORE AT Google

Curtis the server was fantastic great service highly recommend

site_logo

ian harper . 2025-04-14

MORE AT Google

Harj was amazing with her service and recommendations, pleased to be served by her

site_logo

Sandy Kaur . 2025-04-11

MORE AT Google

It’s totally different from the last time with visited the restaurant, the food are not as good as before, the dolce de letche, are like a caramel soup & also splits. 5pcs of padron for the price. The prawns bruschetta are very dry. But the bread & empanadas are actually good & flavoursome.. the service are a little bit slow, specially when your the only one the restaurant.

site_logo

Paul . 2025-04-10

MORE AT Google

Superb food and such friendly service.

site_logo

Nick Bishenden . 2025-04-09

MORE AT Google

Fiesta del Asado in Shirley is increíble! The food was amazing—full of authentic flavors that took me back to my country. ¡Qué delicioso! The meat was perfectly cooked, and the portions were so generous that I’ll definitely come on an empty stomach next time. The prices are great for the quality and quantity you get. My Nigerian husband 100% aprueba the food, which says a lot! The atmosphere was fantastic, making the whole experience even better. A big thank you to our wonderful server, Amedia—she was so attentive, always checking in on us without us needing to ask. ¡Servicio excelente! I will definitely be coming back and recommending this place to everyone.

site_logo

Catia Moreira . 2025-04-08

MORE AT Google

Fantastic food and atmosphere. Steak very tasty. Harj was an excellent t waitress. Friendly and helpful without being intrusive.... Recommended! 👌👍

site_logo

Ian Jennings . 2025-04-04

MORE AT Google

Went there Sunday night ,for a family dinner, we couldn't eat they refuse to offer a table saying that kitchen its closed ,was 10 before 9 and kitchen going to close at 9..

site_logo

Agadir Max . 2025-04-02

MORE AT Google

We visited this restaurant for Mother’s Day and really enjoyed the warm atmosphere and friendly service. The staff were very helpful and understanding, especially when we asked to change our table to better accommodate our two young children. While the service was excellent, the food was a bit underwhelming. Our steak was cooked well done, despite requesting medium rare, and overall the quality did not quite match the price point. It is worth trying once for the experience, but the high prices are not fully justified by the food quality.

site_logo

Arian Aryanfard . 2025-04-01

MORE AT Google

Fantastic service from Harj! Nothing was ever too much and we always had whatever we needed :)

site_logo

Jess Scott . 2025-03-29

MORE AT Google

Great evening and great food. Great service from Harj

site_logo

Richard Evans . 2025-03-29

MORE AT Google

Fiesta Del Asado - Great Spot and Great food honestly. The service was great - quite busy on Saturday night. The only thing is lack of vegetarian options for main - I had pasta. That was quite tasty. Partner had pork belly which was tender and full of flavours! I would highly recommend the Chocolate fondant! That was moist and delicious! One of the best! I wouldn’t recommend the sticky toffee pudding - it is sweet and dense. But if you are into your sweet treats - then go for it! PARKING - is an issue. Took us 10 minutes to find a space and ended up parking in the car park just five minutes away from the restaurant.

site_logo

Tanmeet Kaur . 2025-03-25

MORE AT Google

Massive thanks to Haj who was friendly and very tentative during our dining.

site_logo

Charlotte Haskey . 2025-03-22

MORE AT Google

Zhante was amazing! Had such a lovely bottomless brunch, great food and drinks! Thank you so much xx

site_logo

Georgia Williams . 2025-03-15

MORE AT Google

Lewis is the best barman I've ever had, his cocktails are amazing and runs a great bottomless!

site_logo

XxcharlieXx14 Young . 2025-03-15

MORE AT Google

Way more expensive than I remember, but isn't everything now! Can't beat the food though, so delicious!! Have a look at their early bird deals online when you book. Will definitely take advantage of that and come back again!

site_logo

Sara A . 2025-03-11

MORE AT Google

Appalling bar service - Met some friends for drinks and was ignored by staff behind bar - when we did get some acknowledgement the guy said ‘you won’t get served standing there - you need to move round’ !! I get that it was busy and some of the bar area is probably reserved for the servers getting diners drinks but it was not the sort of attitude we expected. Needless to say we went elsewhere in Shirley for our drinks and won’t bother here again.

site_logo

Doug Hall . 2025-03-09

MORE AT Google

Great experience as usual.good service and atmosphere.friendly staff.curtis a great ambassador for fiesta.made our visit enjoyable.

site_logo

M and G Macca . 2025-03-09

MORE AT TripAdvisor

Food was beautiful and the service was amazing. The staff were really friendly and welcoming. We had the early bird menu and was excellent value for money. The portion sizes were good, we couldn't eat it all!

site_logo

Selina E . 2025-03-08

MORE AT TripAdvisor

Harj service was fantastic as she was confident, attentive and a excellent host. Food was fabulous. I would recommend this place.

site_logo

Sawita K . 2025-03-08

MORE AT TripAdvisor

Great meals, decent drinks service- but at a cost.

site_logo

Keith Richards . 2025-03-08

MORE AT Google

Great Service, Belly pork excellent, great side dishes, ie mac and cheese in particular

site_logo

Fash 1970 . 2025-03-06

MORE AT Google

Came here on valentine’s day and the food was spectacular! My only complaint is that the wait between the starter and main course dish was an hour, besides that everything else was great. We were served by Lauren who was so efficient within her job role, I am a picky eater and have a lot of allergies and she was so accommodating and helpful in regards to that.

site_logo

potion cosmetics . 2025-03-06

MORE AT Google

Had a lovely time here for my grandads 94th birthday. We were served by Harj and her service was lovely. She made sure everything went smoothly with his cake and we really enjoyed our food. Will be back again!

site_logo

Paris. . 2025-03-06

MORE AT Google

Served by Harj who was so lovely and attentive! Had a delicious serving steak for 2 and a bottle of wine, cooked to perfection! Will definitely be returning.

site_logo

Charlotte . 2025-03-06

MORE AT TripAdvisor

Great food, great service and great atmosphere! Live music was a really nice touch. Food was delicious, will definitely be going back.

site_logo

J B . 2025-03-03

MORE AT TripAdvisor

First time visiting and had a great afternoon. Sunday lunch was excellent and great portions! Service from Raj was top notch and she was very attentive for a busy table of 6. Nothing was too much trouble. My only negative .. the peach passion cocktail taste like overly diluted squash. Everything else was 10/10

site_logo

Helen M . 2025-03-03

MORE AT Google

Great service from our servers Harj and Hannah Had great live music

site_logo

Saran Dhami . 2025-03-02

MORE AT Google

Service for drinks were slow!! However, the service for food was fast. The food was 10/10 worth every penny. Best steak I’ve had in years. Will be back!

site_logo

Abbey Cooper . 2025-03-02

MORE AT Google

Our first experience and it was lovely! Our waitress, Molly, was so lovely as well

site_logo

Genevieve Evans . 2025-02-28

MORE AT Google

Food and drinks were amazing and service was very friendly. Shout out to Zak the bar man - he was brill!

site_logo

Liam Beard . 2025-02-28

MORE AT Google

Haij was fantastic, great waitress, really friendly and went above and beyond during our meal this evening.

site_logo

Colin Shaw . 2025-02-27

MORE AT Google

Excellent service from Haij!!! Super friendly and lovely xx

site_logo

Chelsea Anne Nocon . 2025-02-27

MORE AT Google

Harj was lovely and the food was absolutely splendid. Great place and great service .

site_logo

Anika Priya Rahman . 2025-02-27

MORE AT Google

The food is amazing with an atmosphere to match. Hard served us and ensured we had such a lovely time

site_logo

Thierry France . 2025-02-21

MORE AT Google

Myself and my wife visited the Restaurant for our Anniversary. The Restaurant was decorated to a high standard, service was spot on, the staff very professional. Food was excellent, Garlic Mushrooms sauce with our main meal was very moorish. Great meal. Will definitely return again 👍

site_logo

John Delaney . 2025-02-20

MORE AT Google

Went for a Valentine’s date night and couldn’t fault a thing, food was delicious, staff were attentive but not pestering. Atmosphere was delightful. Definitely worth a return visit.

site_logo

Fi G . 2025-02-17

MORE AT Google

We love Fiesta at Edgbaston, so thought we would try Shirley. I don't know what they're thinking but it's all very First Dates. Plastic plants hanging from the ceiling, massive bar, loud live musician (who to his credit was great), high ceilings, bright lights and arm to arm tables. Very different to the intimate and more rustic candlelit experience you get at Edgbaston where the food does the talking. It was very overwhelming, so we left. The manager and server were really understanding though and very friendly and helpful when we said we wanted to leave. I think this restaurant, I'm sure, is very lovely to a lot of people, but if you like a low and slow more private and classy setting, Shirley is not the location.

site_logo

Alex Lowbridge . 2025-02-15

MORE AT Google

Great service from Harj & the food was amazing! Recommend.

site_logo

Dan Beed . 2025-02-13

MORE AT Google

Food was over cooked had the daddy t bone 80 quid which then lead to us eating separately as I’ve had to send back ,not ideal when it’s date night over all the night when down hill shake as this place use to be great

site_logo

damian waller . 2025-02-07

MORE AT Google

We had a fantastic meal with superb service 😀

site_logo

littlemaggie79 . 2025-02-03

MORE AT Google

Fantastic amazing food great customer service by Zhante in particular really good service

site_logo

Gurdev Delair . 2025-02-02

MORE AT Google

A joy to have this place on our door step .

site_logo

S Singh . 2025-01-31

MORE AT Google

Staff very friendly, attentive. Food was excellent, although mostly of an “Italian” flavour. Atmosphere was really nice, great for a nice cosy meal

site_logo

Ben . 2025-01-30

MORE AT Google

Harg was our server and was amazing throughout. Really looked after us well. Food was great. Well worth the money. Would recommend to anyone wanting a fantastic night out.

site_logo

Mia S . 2025-01-17

MORE AT Google

We had a truly disappointing experience at Fiesta del Asado Solihull on what was meant to be a special anniversary celebration. Despite the restaurant's reputation, the food and service fell far below expectations. My steak was overcooked and dry, and the waitress said she would get it replaced, it arrived with reheated microwaved inedible sides after a 25-minute wait. My partner finished her meal alone, while I waited for mine. To make matters worse, we were overcharged for three steaks, with no one on-site able to rectify the error and give me a refund. Follow-up communication has been equally poor. Despite assurances of a refund and resolution, we were offered only a £50 voucher 4 weeks later which would require us to spend more money to correct an already appalling experience. This level of service is shocking and I would not recommend this place to anyone.

site_logo

Steve Dixon . 2025-01-14

MORE AT Google

Mario and the team gave a warm and friendly welcome. This is our 5th visit and the food was excellent as always. Louis makes an excellent Old Fashioned! Great, warm and cosy atmosphere, will definitely return and always recommend.

site_logo

Dan Leyland . 2025-01-12

MORE AT Google

Lunch with Spanish, Argentinian, German and English co-workers. Everything is spectacular and Mario's attention is 10. On the next visit we will repeat without a doubt.

site_logo

Fernando Obeso Herrero . 2025-01-12

MORE AT Google

Excellent service, Mario was very approachable, very delicious barbecue, we are Spanish and Argentinian and we will surely return! Excellent service, Mario was very approachable, very delicious barbecue, we are Spanish and Argentinian and we will surely return!

site_logo

Natalia Bosch Marco . 2025-01-12

MORE AT Google

We went to this restaurant as a family of 10 on a Friday evening to celebrate my son’s birthday. Both my son and I are coeliac and additionally he eats a ketogenic diet for medical reasons. Once upon a time this was a great restaurant with good food choices for dietary requirements but alas no longer. Everything and I mean pretty much everything has flour in it, including creamed leeks and garlic mushrooms!!! All foods are pre-prepared. We opted for steak and asked for our potato terrine to be swapped for broccoli which was the only veg they could do to accommodate us, they then charged us an additional £14 for the privilege on top of the ridiculous price of the steaks. I asked for my steak on the rare side of medium, it came out pretty much raw. We were charged for a drink we didn’t have and £60 as a service charge. The serving staff to be fair were great but the place was empty, so I’m sure they were glad to have something to do. I would not recommend anyone with any dietary concerns to ever visit this restaurant as they are too inflexible to be of any use. A really expensive disappointment and one which we will never repeat.

site_logo

Helen Dufficy . 2025-01-11

MORE AT Google

Enjoyed a very nice meal, alongside a lively atmosphere. Steaks are delicious and customer service was excellent especially from Harj who was very welcoming and helpful. Would highly recommend for a nice meal out.

site_logo

Jeevan Bansal . 2025-01-11

MORE AT Google

To be honest I found this place disappointing. I ordered bread for the table, and then had to cut it up myself so it could be shared. My shandy tasted like it was made from soda water - even after I complained. The lamb shank was good but the sauce was bad. Over £7 for a broccoli side is a rip off. I don’t think this place knows what to be, but it is expensive and I’ve eaten better and had much better experiences in places for half the cost. I can’t recommend and probably won’t go again.

site_logo

Steve Jakab . 2025-01-11

MORE AT Google

Amazing as always! We visit from Scotland every year with friends from Birmingham and Wales - it's that good! Harj was great as always, food and service was impeccable as expected - will be back again soon!

site_logo

Lisa Burnham . 2025-01-11

MORE AT Google

Harj was an excellent host as always …looks after us as if we her personal guests .. happy new year all at fiesta Shirley !!!!

site_logo

Neil Taverner . 2025-01-04

MORE AT Google

Amazing steak and special shoutout to our server Kyle, excellent service all night and felt well looked after.

site_logo

Christian Nicholls . 2025-01-02

MORE AT Google

Came on New years night and had a great night, service from Jamie was excellent he made us feel very welcome! HWAGM

site_logo

Gianni Di Mambro . 2025-01-01

MORE AT Google

Food was exceptional. Expensive, yes. But, if steak is served right then worth it. And mine was. Fillet rare. Usually all places tend to overcook but mine was perfect. And other dishes were really tasty. The reserve malbec was absolutely delicious. Again, expensive, yes. But, worth paying an extra £20 for such a great evening of food. Mario, our server was beyond incredible. He was attentive, and available and also really chatty and friendly. He helped make our evening as wonderful as it was, and we'll definitely be back!

site_logo

Amanda Juniper . 2025-01-01

MORE AT Google

Always have a fantastic meal here amazing starters and amazing main meals. Staff are always happy and friendly. Thanks Fiesta Del Asado

site_logo

Russell Debar . 2024-12-28

MORE AT Google

Mario and Zhante were lovely, our food was incredible. Couldn't have picked a better place to celebrate our engagement!

site_logo

Dylan Hawthorne-Slater . 2024-12-27

MORE AT Google

Had an amazing meal to celebrate our engagement!

site_logo

Grace Attwood . 2024-12-27

MORE AT Google

Cocktails were lovely! Service was great. X

site_logo

Carrie Clarke . 2024-12-21

MORE AT Google

We were here for our works Xmas meal and drinks. All really enjoyed the evening and we would highly recommend Fiesta - great job, first class with lovely atmosphere; one said it was the best steak she has ever had. Manager Mario very welcoming couldn't do enough for us .Harj is very attentive, great service. Worth coming back.

site_logo

Sue Cadalzo . 2024-12-09

MORE AT Google

Dropped in whilst staying in Birmingham. The food was great, steaks were amazing. Atmosphere was great and our server Haj was brilliant, very attentive and friendly. Would absolutely recommend.

site_logo

Jemma Reid . 2024-12-08

MORE AT Google

Good experience. Lovely evening. Solid food

site_logo

jilhad123 . 2024-12-07

MORE AT Google

Excellent Argentinian restaurant, Harj looked after us very well, overseen by Mario. 10/10 would visit again, food was perfect

site_logo

E K . 2024-12-07

MORE AT Google

I have been here a few times now and have to say it is probably one of the best sirloin steaks i have ever had, therefore, i don't mind when the bill is a bit costly because the quality of food is so good. Good range of cocktails also and the service is excellent as is the manager who is friendly and chatty. I would say that if you want the full Argentinian experience and ambiance, i wouldn't go at busy times on weekends as is really busy and full of large families and children, definitely weeknights is much more enjoyable and doesn't feel like you're on the Shirley high street at all.

site_logo

Carlmathew Holton . 2024-12-06

MORE AT Google

Came to dine here with a couple friends and was served by Mario. He was so accommodating, helpful and alway came around with a smile. Food was good as always

site_logo

Hoii Huuynh . 2024-12-03

MORE AT Google

The cocktails here are just perfect, generous and tasty . Food too was delicious, backed by Mario service , attentive and always there when we needed it . 10/10

site_logo

Leandra Seixas . 2024-12-03

MORE AT Google

Lovely meal. Fantastic service.

site_logo

Lucky Number 7s . 2024-11-27

MORE AT Google

I had my baby shower here as it’s one of my favourite restaurants. I have to say the service was outstanding. Nothing was too much bother and the staff are always friendly. Mario the manager made my baby shower joyful and made sure we had everything we needed for a great experience. I always look forward to visiting as the atmosphere is calm whether you’re popping in for a few drinks or food. I’ll be back soon

site_logo

Manjula Turner . 2024-11-17

MORE AT Google

After a long time, I decided to give this restaurant another chance and it definitely wasn't a good idea. I ordered my non-alcoholic cocktail without ice and when it arrived it looked like I had ordered it with extra ice. My steak was like a rubber and there wasn't even a steak knife on the table, I had to ask for it. My daughter's dish was from the children's menu and it didn't even seem like it, it was very spicy. Furthermore, the atmosphere was very noisy. Very loud music and the noise of many people talking at the same time. It was even difficult to order. Faced with this whole situation, I came across a completely unprepared staff who didn't know how to solve this sequence of problems. An unpleasant experience that ended up being very expensive!

site_logo

Barbara Lacet . 2024-11-17

MORE AT Google

We come to the Solihull branch often and Harj has always been our waitress. She is so attentive and always checking whether we need anything. She always has a big smile on her face and such a bubble personality which makes the experience that much better. She is a real credit to the restaurant and keeps us coming back!

site_logo

Gurpreet Reyat . 2024-11-16

MORE AT Google

Great food, Lovely vibe. Fantastic service. Highly recommended - Han was amazing

site_logo

Claire Lees . 2024-11-08

MORE AT Google

Brilliant service from Harj, amazing atmosphere and divine food! Better than Miller and carter!

site_logo

Rajina Chahal . 2024-11-08

MORE AT Google

Been a few times before. Bar staff are really attentive and cocktails are amazing. We had a meal. Service again excellent. Food was amazing too. Lovely ambience and classy place. Thank you..will defintely go again.

site_logo

Sharon “Shazzleb” Ingleston . 2024-11-04

MORE AT Google

Really good food and great service from Haj. Always enjoy eating here :)

site_logo

Shannon Price . 2024-11-01

MORE AT Google

Our server Harj was very attentive and knowledgable, she made our experience so much more enjoyable having such a friendly face serving us! We will certainly be back and hope to see Harj next time too.

site_logo

Abi Carruthers . 2024-11-01

MORE AT Google

Love this place… Harj the waitress was amazing the service outstanding and i would 100% return if not for the food but for the service delivered

site_logo

a nash . 2024-11-01

MORE AT Google

Harj was amazing good halal menu too

site_logo

Abir Khan . 2024-11-01

MORE AT Google

Food is delicious, fantastic wine- we had croquettes, ribeye steak with various sides & churros for dessert. Staff very welcoming - excellent service.

site_logo

Anita Singh . 2024-10-31

MORE AT Google

My son took me for my birthday meal was absolutely fantastic staff and food exceptional 👏 Thank you so much

site_logo

Michele Mooney . 2024-10-29

MORE AT Google

Lovely Sunday lunch and great service from Curtis

site_logo

Dalton Sarah . 2024-10-27

MORE AT Google

Curtis was attentive and friendly The apple empanada was to die for

site_logo

Debbie Donohoe . 2024-10-27

MORE AT Google

The food is OK, the staff is kind, food came in time but for dessert we had to wait 1h. It was becoming ridiculous. The prices are little bit higher than expected.

site_logo

DoDo . 2024-10-27

MORE AT Google

Service by Harj was great. Lovely atmosphere with great music! Would visit again

site_logo

Victoria Sage . 2024-10-25

MORE AT Google

“I’ve been to Fiesta Del Asado many times, and last night we went for a nice steak and wine. The staff and the manager were friendly, and the steak was perfectly cooked. Compliments to the chef! The atmosphere was nice and relaxing. It was perfect.”

site_logo

Mike Azin . 2024-10-20

MORE AT Google

Had a real nice time ,the food was good and great service from staff . The atmosphere always brilliant inside even when it’s not so busy. Throughly enjoyed the cocktails ! Will be back to do it again soon

site_logo

Michael Wilson . 2024-10-20

MORE AT Google

Food and drinks were great! Service from Jamie and Kyle was excellent. Would highly recommend visiting 👌

site_logo

Lee Wilson . 2024-10-16

MORE AT Google

Came for anniversary, food was amazing, service from Jamie even better. The manager, Kyle, made us feel so welcome, will definitely be back. Thank you team!

site_logo

Ella Wilson . 2024-10-16

MORE AT Google

It was our first time at the restaurant and the steak was so nice and juicy and filled with flavour. Mario’s service was exceptional. He even volunteered to take pictures of us and was always available regardless of us needing anything. Would highly recommend.

site_logo

Hajera Laskar . 2024-10-15

MORE AT Google

Went as a group of 16 on a golf weekend. They had a really good app which allowed everyone to pre order individually before the night. Service was great, lovely place, amazing steaks. Only issue was that all the sauces ordered hadn’t been charged on the app so the bill came to £40 more than I had told the group - restaurant very kindly cancelled the charge so group cost was the same. Great choice for a Saturday night group meal.

site_logo

James Hamilton . 2024-10-14

MORE AT Google

Great restaurant, decorated very authentic. Service was excellent, professional informative and very pleasant. Signing up for their card is very beneficial as you are able to get discounts and save up points to get money off your next visit. Fully recommend.

site_logo

Scot Frederiks . 2024-10-11

MORE AT Google

Similary restaurants in West Midlands

restaurant_img
4.5

4758 Opinions

location-iconPendigo Way, Birmingham B40 1PU England
American
outdoor_seating_258933takeaway_258933delivery_258933

Fantastic service by Isabelle, we came to celebrate my husband’s birthday and she made it a lovely experience. The food was delicious so compliment’s to the chefs. Thank you for a lovely afternoon 😊

restaurant_img
3.8

1930 Opinions

location-iconTerminal 1
American
outdoor_seating_104796takeaway_104796delivery_104796

Comimos aquí antes de nuestro vuelo. El personal era amable, pero nos dieron intoxicación alimentaria de aquí! Arruinado completamente nuestras vacaciones, mi esposa y yo estuvimos enfermos durante 5 días y no pudimos comer nada durante nuestro viaje, ya que era tan grave! La comida se veía increíble, pero la yema de huevo estaba mal cocida y también comenzó a solidificarse como si hubiera estado allí durante un tiempo. Iremos a ver a los médicos tan pronto como aterricemos, ya que todavía estamos muy mal. Uno de mis hijos también ha estado bastante enfermo. ¡Por favor, no comas desde aquí justo antes de tu vuelo si no quieres arruinar tus vacaciones!

restaurant_img
3.2

2619 Opinions

location-icon15/17 High Street
American
outdoor_seating_309080takeaway_309080delivery_309080

Amazing service and food quality. Nikhil, the manager there was very kind and helpful to get my order smoothly.