GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.5

Based on 706 opinions finded in 2 websites

site_photo4

Nº 101 in 347 in Vale of White Horse

Nº 3 of 4 Asian in Vale of White Horse

CUSTOMERS TALK ABOUT DISHES WITH..spicycookedcurrybeautifulfishmustnoodleschillisoupchickenmeatladyriceprawnprawnsduck

comment_iconOpinions

Food was nice but portions very small for the price. My wife had a single prawn in her Pad Thai !!! One prawn!!!! Wouldn't visit again, very overpriced for what you get given. Make the portions bigger, or drop the prices. This was a normal full priced meal, not some 'all you can eat' deal, which makes it even worse. In response to the owner's reply, we came on Thursday evening & sat downstairs. Be serious - you expect customers to point out to the waiting staff (it was a man, not a lady, and he was very nice) when you skimp on ingredients??

site_logo

Doug Clark . 2024-10-27

MORE AT Google

Green curry, pork dumpling, muscles and spring rolls are high recommended.

site_logo

White Rose . 2024-09-17

MORE AT Google

Came here for the first time last night and will definitely return. The food was excellent value for money and each dish was served with care.

site_logo

Sue Davey . 2024-08-25

MORE AT Google

Chinese adapted to Thai. Average experience

site_logo

PeterPumpkinEater65 . 2024-08-07

MORE AT Google

Excellent food 😋 👌 well worth a visit.

site_logo

Keith Price . 2024-08-06

MORE AT Google

It was really delicious. However, we were left feeling a little short changed by the king prawn penang in our takeaway which was half the size of the chicken green curry and contained only 6 prawns.

site_logo

Benjamin . 2024-07-07

MORE AT Google

Love the sweetness of Thai food compared to Chinese food. A perfect blend of coconut and spices. The usual variety of oriental dishes, served with a good welcome and care.

site_logo

VeryHungryWalker . 2024-06-23

MORE AT TripAdvisor

Absolutely the best Thai restaurant I have ever been to .. brilliant !!

site_logo

Hazel Baker . 2024-06-12

MORE AT Google

Really helpful and attentive staff and lovely food with a good view of the main high street. Would definitely recommend and support a family run local business.

site_logo

Nem . 2024-05-28

MORE AT TripAdvisor

Had a lunchtime meal, fantastic! Great service and friendly staff.

site_logo

Ian Dickinson . 2024-05-25

MORE AT Google

Always amazing food here and usually exceptional service… however on my latest visit I felt almost avoided. This has never been the case on my many previous trips to Chaba Thai and I generally enjoy the atmosphere and service they provide. Every dish here is exceptional.

site_logo

Tascha Hurst . 2024-05-08

MORE AT Google

The only Thai place in town as Hugomango's is pretty much a takeaway these days. Food was a bit bland (chicken satay or red duck curry for example without any kick at all) and the sticky rice was so dry that it must have been prepared hours before and reheated. On he positive side average sized portions (for us at least) and friendly service. OK every few months but nowhere near as good as places like Chiang Mai kitchen or Giggling Squid in Oxford , never mind real Thai food from Oli's (sadly gone) or from Thailand itself (of which I've got very fond memories).

site_logo

Peter W . 2024-04-20

MORE AT TripAdvisor

Food was tasty, we ordered half a duck but it must’ve been a very small duck. Also the noodles were very greasy, honestly I would not go back.

site_logo

John P . 2024-03-20

MORE AT TripAdvisor

Today, my son 16 years old came alone to the restaurant for break fasting (iftar). He ordered some food and 1st came out only tom yum soup. The main course took about 50 minute to served. My son very upset and dissapointed. He heard some other people came after him ordered food and got served first. I feel sorry for my son and kept him monitor by phone. Who ate alone for his break fasting after about 13 hours fasting. Just wonder, he being ignored because he is minor and alone???

site_logo

ris Pri . 2024-03-16

MORE AT Google

Had lunch here today, very good, authentic sauces and flavours. Lovely atmosphere and polite staff. Food arrived without a long wait.

site_logo

TC B . 2024-03-13

MORE AT TripAdvisor

The food was actually quite good. We ordered a variety of starters and mains. The main issue is that the portions are very small compared to other Thai restaurants I’ve been to. I left the restaurant still feeling hungry which is very unusual. The pad Thai had ONLY 2 prawns in there (yes it was so obvious) and literally 4 small strips of chicken. If you have a small stomach and can look past the portion sizes then that’s fine. My partner had the jungle curry. The beef was very small. Unfortunately this made the experience not worth it.

site_logo

Jesse Opoku . 2024-03-10

MORE AT Google

We were a little put off by how the place was decorated but i have to say, was one of the best meals we have had. A little bit stingy on the portion sizes but you didn’t get the bloating ! Highly recommend!

site_logo

Fiona Bray . 2024-02-25

MORE AT Google

Very rude staff. We were welcomed well to begin with. Upon ordering food, when explcity told there was only one vegetarian we got food for 3 people and the waitress looked totally upset as food got wasted. She wouldn’t let us order mains until we finish our starters. This was an awkward moment and my friend asked for the bill and that’s when she offered to take the menu down for mains. There was no sorry for the behaviour and no explanation either. Food was good and so was the ambience but the attitude of the restaurant staff was very poor and off-putting. They could perhaps do well with a change in their staff. ...........................................….…........................................ In response to the restaurant owners reply! Thank you for a prompt response. If only you could have displayed some last evening. Alas! Perhaps, next time! You could always keep wishing… good luck!

site_logo

Bindu Tallapally . 2024-02-13

MORE AT Google

Whilst the food we had on a busy Saturday night was quite tasty, the portion sizes were far too small and when you factor in the price it wasn't great value for money. This was a-la-carte rather than the midweek buffet. The photos in the menu weren't an actual representation of the portions for the dishes we had. The prawn toasts were half the standard size for £8, the dumplings were tiny for £8 (the photo in the menu shows them filling a steamer but the serving itself had tiny dumplings almost hidden behind a sauce pot!), the soup, though tasty, was smaller than expected, as was the massaman curry. The pad kee mao was a bigger portion but this time let down by overcooked beef and no chilli heat. Looking round the dining room I saw a few questionable looks from fellow diners when their smaller than expected dishes arrived so we didn't feel like it was just us! We had been looking forward to eating here for a while as it is always busy. We'll try the buffet at some point and hope for a better experience but for now we are disappointed by our visit to Chaba Thai.

site_logo

Marcus F . 2023-12-12

MORE AT TripAdvisor

Amazing food. Really friendly. A little bit slow but they were busy. Will return!

site_logo

Soya Bean Protein . 2023-11-18

MORE AT Google

Food was amazing. Service was great. Decor lively. Owners cute and adorable. Please take Amex next time 😁

site_logo

Arif Khan . 2023-11-05

MORE AT Google

The food was excellent and served quickly. A varied menu is a valuable including set options. Takeaways are also available from here.

site_logo

Mike McCairns . 2023-10-17

MORE AT Google

Don't go thinking you will have the buffet if you're a solo diner as its minimum two people - was very disappointed! Shame really

site_logo

maidelyn . 2023-10-03

MORE AT TripAdvisor

Friendly service and great food.

site_logo

W Spreadbury . 2023-10-01

MORE AT Google

The food was nice, standard Thai fare. Portions are good, but not overly filling. The staff were a bit hit & miss with most of them very friendly and polite, one however very much didn't want to be there and we got a grunt from them. The price was quite reasonable too.

site_logo

Ricky . 2023-09-01

MORE AT Google

Lovely food, lovely staff, I highly recommend you give it a try

site_logo

Steve Woffinden . 2023-08-31

MORE AT Google

The waitress wasn’t happy on the evening we visited! Face like thunder and being rude to everyone! We arrived and she said have you made a booking, we said no and she pointed to a table and said sit there!! My partner and I just looked at each other! In the downstairs part of the restaurant, it was this lady and a lovely male waiter whom we just hoped he would deal with us! Mostly he did (thankfully). The evening went on and everyone who walked thro the door without a booking got the same treatment … sit there! She went to take the order and no hello or greeting just ‘ready or not’ came out of her mouth! The food was ok but this lady totally spoilt the atmosphere. All the diners were looking at each other raising eye brows! We heard her moaning that she wanted the night off but wasn’t allowed! I suggest to the manager if she wants a night off for the success of your business, let her have it! We were glad to get out of there and won’t be returning. Horrible stressful experience!

site_logo

lesleytyler63 . 2023-08-23

MORE AT TripAdvisor

Went for my daughters birthday,,the host were very friendly,,although it was busy, everything just seemed to flow,,definitely be going back 😋

site_logo

Swandon Lane . 2023-08-22

MORE AT Google

Take away available, booking recommended. Excellent thai food and nothing too much trouble with personal service. Had 3 courses it was so good.

site_logo

Paul MJ Stone . 2023-08-20

MORE AT Google

Great Thai food, reliably good.

site_logo

Rowland Conway . 2023-08-08

MORE AT Google

Excellent food, they have an all you can eat option, but the menu if full of nice food and very filling.

site_logo

Keith Price . 2023-07-30

MORE AT Google

Delicious food 😋. Generous portions. Reasonable prices. Cosy. Fast friendly service.

site_logo

Brenda . 2023-07-28

MORE AT Google

I took my wife here for her birthday because Thai food is her favourite meal. I'd (foolishly) read the Trip advisor reviews ahead of the meal and they were a little uncomplimentary of late.. But I ignored them. Turned out it was utter tosh...the meal, experience, ambiance, service and facilities were spot on. We absolutely loved it. People are so quick to criticise, but we need to be more proactive in the praise. This restaurant is really good....don't be swayed. Thank you Chaba Thai.

site_logo

MJBoyt . 2023-06-15

MORE AT TripAdvisor

Lovely authentic thai food, very tasty

site_logo

Wilfred Lam . 2023-06-10

MORE AT Google

Loved the food. The staff were brilliant. Great price.

site_logo

Mark S . 2023-05-10

MORE AT Google

Always a great experience. Food never disappoints and the service is excellent. Fairly priced too.

site_logo

Shani Parry . 2023-05-06

MORE AT Google

Quality and portion sizes, not what it was food was very bland. 2 half pints £8.50. Unfortunately, I won’t be going again .

site_logo

Maria Jaremchuk . 2023-03-30

MORE AT Google

Food is very good. Starter portions are lovely but very small thus becoming expensive for what they are. Mains are very tasty and value for money.

site_logo

Greg Walsh . 2023-03-17

MORE AT Google

Came away feeling really disappointed after spending £55 for 2 starters 2 mains and 2 drinks. £4.50 for a tea bag in a pot. 4.50 for small bowl of rice (probably 20p’s worth) Pad Thai is my go to in a Thai restaurant this was the worst I had, cheap soggy noodles, hardly any chicken all for 13.30. The other meal was a couple of pieces of duck in sauce for 13.50 with no rice. Went to the Thai restaurant in Oxford the next day much better food for half the price. I never write reviews and I understand the cost of living crisis but £55 is borderline ripoff

site_logo

Richard D . 2023-02-27

MORE AT TripAdvisor

Great place to eat, fab food and great service. Will be going again and again.

site_logo

Julie Jarvis . 2023-02-07

MORE AT Google

Had a take away from Chaba Thai after unable to get a sit in booking due to them being busy. We have eaten here before and very pleased however, on this occasion very disappointed. The mixed starters and soups were good, I wouldn't say they were one of the best we have had, but they were fine. We had Red Beef, Yellow and Green Chicken curries and these were of very little Chicken or Beef content and what there was had a poor, cheap, stale, chewy texture to them and most of this remained uneaten and consigned to the bin. This happens BUT this takeaway meal was just under £80 for three people, which was basically a rip-off and therefore reflected in the review.

site_logo

LordPhilipOfWansley . 2023-02-07

MORE AT TripAdvisor

Horrible argumentative waitress greasy spring rolls no substance to food yuk

site_logo

Home Little Home Victoria Plowman . 2023-01-22

MORE AT Google

First time visiting this place. Food and service very average. However the ambience and state of the place was terrible. Bright lighting. Cramped. The trip to the toilets was interesting. You venture up a dirty old staircase past a bar/kitchen/takeaway ! Clutter everywhere. The toilet was dilapidated. Shut my eyes to blur the experience. There was a mop and broom in the corner which fell over and blocked the door. I had to try and move them to get out without risking touching them. A tricky procedure. This place should not be classed as a restaurant but a takeaway with a few tables available. I am shocked by the reviews already on trip advisor as they portray a different experience.

site_logo

GEOFF l . 2023-01-21

MORE AT TripAdvisor

Fantastic food, brilliant service, and very relaxed venue

site_logo

Nick Thomas . 2023-01-08

MORE AT Google

The pad Thai noodles I ordered were half cooked. The soup was good. Quite place at the corner.

site_logo

Paul Pearson . 2022-12-24

MORE AT Google

We have been coming to this restaurant for as long as I can remember. There are so many good restaurants in the Oxfordshire region, but we regularly return to Chaba Thai because quite simply it is our favourite. Thai food is our favourite and this is the very best one we have found. Added to that, the owners are just lovely people and the staff are always cheery and welcoming. The only fault with this place is that I cannot find one (fault!).

site_logo

Andrew M . 2022-12-23

MORE AT TripAdvisor

Was yummy, really enjoyed the food! Had a pleasant dining experience :)

site_logo

Jo . 2022-12-20

MORE AT Google

We had the set menu. We love everything we tried. One great point is that you can eat as much as you wish to. However, if you do not finish the food you order, they will charge you for the unfinished dish separately. Great way to stop food wasters, greedy people. 🙏👏 The waiters (Wave and another lady) were so welcoming and lovely. This was our first time but we will definitely be coming back frequently after today.

site_logo

Y YCS . 2022-12-13

MORE AT Google

Not the best tom yum I’ve ever eaten, but decent. Staff is very friendly

site_logo

Alexandr K . 2022-12-03

MORE AT Google

We Had a lovely two course meal and the service was excellent.Thank you

site_logo

David Lyons . 2022-11-05

MORE AT Google

Took half an hour to get drink then another half an hour to get food. Seafood was overcooked and chicken not cooked well and my friend found hair in her food. It was a busy night I get it, but worst service I have ever experienced. Go ANYWHERE else.

site_logo

Hana NCU . 2022-11-04

MORE AT Google

Yes! Despite the efforts of your three Thai cooks, the food did not have a genuine taste. Yes! I agree with you that we didn't order the drinks. But you should know that we asked for the glass to take the water from the bottle placed on the table. If you want your consumers to drink the water right from the bottle, then that is perfectly OK. When it came time to place the order, we had made our selections of products quite thoroughly. When we saw that there was no bowl of rice accompanying the red curry, we asked for it to be added. Typically, red curry is given alongside a bowl of rice at Thai restaurants. Regarding the English language, I believe that in order to place an order, one does not need to take a specialised English speaking course. Many thanks for providing such amusing justifications!!!

site_logo

Anubhav Dwivedi . 2022-11-02

MORE AT Google

Normally love this restaurant but went last week for one of their “ banquet “ meals and were extremely disappointed. The menu was very limited compared to the normal menu, and the portions were small. We asked for 1 extra starter when we had finished ours, and that was fine with them. We then ordered the duck and pancakes which came very small. When finished, we asked for another portion. They were not pleased but it turned up, equally as small.a portion, but very tasty. For main course we ordered three dishes , a half portion of noodles and some rice. They said we had ordered a lot of food and would be charged full menu prices if we left any, which we already had been told. At the Parasol restaurant the attitude is completely different. They actually invite you to have more, and it comes with a smile. Chiba Thai, you let yourselves down this time.

site_logo

yvettee858 . 2022-11-01

MORE AT TripAdvisor

The best place in Abingdon I’ve tried so far- Massaman curry was beautiful as was the sticky mango rice. Great and fast service will definitely be returning!!

site_logo

Eleanor Lupton . 2022-10-18

MORE AT Google

Food and service alway excellent. Visit on a regular basis and would be happy to recommend to anyone looking for Thai food. It is always busy when we visit which is a good sign but the service is still excellent and prompt.

site_logo

fionawZ1353RM . 2022-09-23

MORE AT TripAdvisor

Chaba Thai has become one of our favourite places to eat in Abingdon. Tonight we were celebrating our wedding anniversary. We ate from the all you can eat menu, which is cooked to order for the number of people at the table. You can have starters,soups, possibly salads? and main dishes. You can keep ordering from each course until you decide to move on, but can't go back once you have. So, make sure you've had enough tempura prawns before you do! The food is always incredible and not over priced. The staff are very polite, friendly and accommodating. We ate in the downstairs restaurant area and I love the eclectic, travel based decorations/photos/maps. It is very clean and the staff are quick to clean tables and clear dishes. I would however recommend a shall or cardigan if wearing something sleeveless or thin. They have a fantastic aircon unit which is lovely when the restaurant is full but if you are there later in the evening, the number of people in the room tends to decrease and it becomes a little chilly. As that is the only negative I can think of, and I'm already looking forward to my next visit/takeaway, it goes without saying that, I highly recommend this restaurant. I have done to many people in the past, who have all be very happy I did.

site_logo

Nicola Morgan . 2022-08-25

MORE AT Google

Spent an enjoyable evening at this popular Thai restaurant. Many people were choosing the eat-as-much-as-you-like menu for about £21, but I think that works better in a large group, giving you the opportunity to experience a variety of tastes. We chose starters and mains from the A la Carte menu. I understand the food to be authentically Thai, but it is accessible to British diners, with pictures showing what the dishes look like. You are not expected to use chopsticks, though of course you can if you like. Pleasant atmosphere and good service. Would come again.

site_logo

Michael K . 2022-08-22

MORE AT TripAdvisor

No doubt very tasty food, nice restaurant but customer service is rubbish. Food is served without smile, staff body language is like dead person, sound like not happy to serve.

site_logo

Mukesh Bharti . 2022-08-20

MORE AT Google

Fantastic food and great service.

site_logo

Glenn Sawyer . 2022-08-17

MORE AT Google

Fantastic food! They have a super deal for an "all you can eat" Monday to Wednesday and it did not disappoint. Speedy service and good hot food, the Massaman curry was excellent. I would advise booking as it it not a large restaurant and clearly popular.

site_logo

Andrew Davies . 2022-08-11

MORE AT Google

Response to the most ridiculous and rude response I got from owners, no wonder this place gets lots of 1 star reviews. No I didn't have covid and nor did my girlfriend. Your response to my review shows you have zero customer service skills and dont care about what people think about you. I suggest if anyone reads this avoid this place like the plague. Go to Hugomango a bit further up the road where you will be treated with great customer service and the best proper thai food in Oxfordshire. Ahh once again this owner finds it impossible to to actually apologise. The potatoes were not the bad bit it was the fact that it didnt taste of anything we had to add a salt. I'm an ex chef and it was awful I do know the difference. Instead of blaming everything on something else take some responsibility for your own bland food and also stop arguing with previous customers it's not a good look. Yes I am a customer of Hugomango because their food is exceptional and they treat customers with respect. I'm not the only one star review and also several complaints of your rudeness. Shocking to say the least! Yes I think anyone reading this will see the owners inability to apologise and take some criticism. That in any business is not how to treat customers. A simple apology and a promise of better experience next time would have been advisable. To actually accuse me of having covid-19 something that killed 100,000 of people and millions globally shows your lack care and also contempt for anyone that tries to be honest about your food. Shameful response.

site_logo

Kennedy Beddowes . 2022-08-09

MORE AT Google

It's all about the £21.99 buffet!!! Great choice and tasty food.

site_logo

Norma Grant . 2022-08-09

MORE AT Google

Excellent range of tasty food and presentation, friendly staff plus air-con.

site_logo

IAIN LAWRIE . 2022-08-07

MORE AT Google

The food was lovely, though portions small. Staff were friendly however, on a Wednesday evening there is an offer for £22 - unlimited dishes cooked to order. As single diner I was told I didn’t qualify for the offer. Subsequently I paid more for much less food - which seems incredibly unfair is a discrimination against single diners.

site_logo

Louise . 2022-08-04

MORE AT Google

Ordered a delivery when friends came. Never used Chaba Thai before but was most impressed with the level of service and quality of food. Arrived within 40 mins on a Saturday Night and we all considered it excellent value for money

site_logo

Z6834IDjanetm . 2022-08-02

MORE AT TripAdvisor

Eat as much as you like is superb value and quality. staff are amazing

site_logo

Catherine Warrilow . 2022-07-26

MORE AT Google

Worst thai food I've had. Asked for no fish sauce for the vegetarian dishes. This was met with no reply and an unfriendly look. Dishes tasted and smelt extremely fishy.

site_logo

Manny M . 2022-07-23

MORE AT Google

Delicious food , great service. Monday too Wednesday has all you can eat per person £22.

site_logo

Timothy . 2022-06-08

MORE AT Google

A nice place with reasonable quality food. We went for the buffet food option which they do Mon-Wed. The buffet has some strange rules so read the fine print on the menu so you don’t get caught out, eg must order as a group, everyone must have buffet, can’t order starters once you’ve had soup!

site_logo

Chris Gledhill . 2022-06-02

MORE AT Google

I have visited chabba a few times and have always had a good meal. However last night was poor. From entering and being shouted at my a female staff member about our booking, to like warm overpriced food. The green curry which we always have was inedible as too hot, I lived in Thailand for 2 years and am used to spicy Thai food. Will not be returning

site_logo

sarahkP8426HK . 2022-05-28

MORE AT TripAdvisor

Its a bit odd providing a review when i haven't eaten anything but that will come later. Just booked the place for next week to celebrate wife's bday. I am hoping all goes well and cant wait to enjoy the buffet :).

site_logo

Naushad Tahsildar . 2022-05-27

MORE AT Google

Had all you could eat, did really nice, price good. Service lovely. Nice little low cost restaurant with lovely food

site_logo

Rob Archer . 2022-04-29

MORE AT Google

Restaurant was very busy on a Monday night. We had no reservation but they made wife and I welcome. Food was very good, but service was excellent, quick, efficient and friendly. Recommended and we will visit again.

site_logo

Barry Holmes . 2022-04-26

MORE AT Google

I often have a take away from these guys but recently the portions have become half the size and the curries a bit watery. Hope they realise that and improve their dishes again.

site_logo

crisg73 . 2022-04-24

MORE AT TripAdvisor

Cracking little place with fantastic service. Food was full of flavour, pretty close to authentic Thai food. I will definitely be back.

site_logo

ChefRob83 . 2022-04-19

MORE AT TripAdvisor

Good service in a fairly busy Tuesday lunchtime. Food was tasty, hot and, according to my chef son, pretty authentic. Flavoursome and decent sized portions from the fixed price 2 course menu.

site_logo

Keith Wiggans . 2022-04-19

MORE AT Google

Enjoyed a family dinner for 6. Atmosphere was good, service very attentive and the food great quality. Highly recommend.

site_logo

Graeme Marshall . 2022-04-18

MORE AT Google

We hadn’t booked but we’re a little surprised at the somewhat curt welcome, not at all what we have come to expect in Thai restaurants. However that was soon forgotten as the food was fabulous and reasonably priced.

site_logo

P6783DOianc . 2022-04-14

MORE AT TripAdvisor

Went for a meal on a Saturday night, didn't book ahead but managed to get a table. The restaurant lacked atmosphere and the food was good but not great. The beef in the jungle curry was a little chewy, both our curries had really runny...

site_logo

rebeccawX1661TM . 2022-04-11

MORE AT TripAdvisor

We visited on friday evening and not v busy. We had prawn crackers..overpriced at over £2 as most good restaurants offer them as complimentary. I had mussels to start..v chewy and gritty, small portion of 6. Main meal prawn penang insignificant and so mild almost...

site_logo

julie W . 2022-04-10

MORE AT TripAdvisor

Definitely very close to what you can get in Thailand but the staff's service is very selective. I said multiple Thank you when one senior lady came to serve the food, but she never said you are welcome or thanks even 0.5 time! They seem...

site_logo

Sinead_202205 . 2022-03-23

MORE AT TripAdvisor

Best Thai food I've had outside of Thailand 🇹🇭

site_logo

Stewart Smith . 2022-03-23

MORE AT Google

Small portions, not many ingredients, pricey. I guess it must pass muster for the drunken Brits that frequent here and the Sois, but their taste is somewhat suspect at best. Yummy Thai in Wantage far superior

site_logo

miloh488 . 2022-03-11

MORE AT TripAdvisor

Ate here at lunch and took advantage of a lunch special consisting of a starter + main for 11.99. Service was great and the food tasted fresh. Nice spot.

site_logo

Scuba-Lip . 2022-03-04

MORE AT TripAdvisor

Very good food and frendly staff

site_logo

Elaine Erdbeer . 2022-01-01

MORE AT Google

We had a meal here with friends. The food was excellent as was the service, staff were very attentive. We ordered a selection of starters and had main course, all fresh and very tasty, all cooked to order. Would definitely recommend.

site_logo

juliegO3967KE . 2021-12-19

MORE AT TripAdvisor

Awesome food once again 😃 Great night out with friends, brilliant service. Thank you to Da and her staff.

site_logo

steven davis . 2021-12-18

MORE AT Google

Love the food from here. I could eat here everyday from the restaurant. All food is freshly cooked which is better than other places that re heat pre prepared food. What makes it nice is you can choose how you want your ingredients and if something you don’t like you just let the staff know. Even if you want it spicier! Staff are polite and friendly. There are too many dishes to recommend to try. It’s good to see they are practising safe covid guidelines and don’t be afraid to come eat in the restaurant or even order a take away. Food arrived in a very good timely manner and hot even considering some nights it is busy and the 2 delivery drivers are brilliant.

site_logo

Michael M . 2021-12-11

MORE AT Google

We had an enjoyable business dinner here and found the food to be very good, with good portion size. The decor and ornaments are a little strange, but it's good to try somewhere different and the staff were very friendly.

site_logo

Mattinbrum . 2021-12-08

MORE AT TripAdvisor

Not a bad meal and when I queried the bill over drinks they followed up to point out that I was wrong and they were right. I am told that their takeaways are good too.

site_logo

Ben Cooper . 2021-12-05

MORE AT Google

Delicious food good service value for money

site_logo

J. D . 2021-11-23

MORE AT Google

Very tasty food, great atmosphere nice place to eat

site_logo

Karen Laverack . 2021-10-19

MORE AT Google

Friendly staff, relaxed atmosphere and great food.

site_logo

Martha Collins . 2021-10-15

MORE AT Google

Based on a lot of good reviews of this restaurant I got some takeaway there with my daughter and her friend. Although the red curry was ok (edible rather than outstanding), the rest of the food (we had 8 dishes + rice) were at best...

site_logo

190markr . 2021-09-12

MORE AT TripAdvisor

Excellent food and really friendly staff. Fantastic visit

site_logo

Ruth Schofield . 2021-08-28

MORE AT Google

Really friendly people and great food! Be warned though, the bottle of water on your table is £3.

site_logo

David H . 2021-08-25

MORE AT Google

If you like Thai food you really must try this place The food was wonderful and the service excellent; it was all fresh and seemed to be home made - was a real treat

site_logo

Vanessa_123_p . 2021-08-15

MORE AT TripAdvisor

Ordered a takeaway to be delivered locally, needless to say delivery was late, also driver told me to f--k off and food was cold and average. Definitely do not eat here.!!!!!!!

site_logo

mike james . 2021-08-14

MORE AT Google

Lovely takeaway from here, they were very helpful with a coriander free dish (tricky in thai cooking) and both the starters and mains were excellent. Food was ready on time and a good price overall.

site_logo

A Bradley . 2021-07-21

MORE AT Google

We ordered a delivery meal for Father's Day, and they accidentally forgot the coconut rice. No problem - we called them back they came all the way back to drop off the missing rice (4 miles each way). And they included 2 free beers and...

site_logo

AndrewPeterStuart . 2021-06-20

MORE AT TripAdvisor

Similary restaurants in South East

restaurant_img
4.5

1860 Opinions

location-icon15 Bridge Street
Asian
outdoor_seating_118327takeaway_118327delivery_118327

This places is the best place to get curry in abingdon by bar simply because it has the best service and best food and when I go in they always remember my name and give me free sauces and free poppadoms and an excellent curry at an amazing price.

restaurant_img
4.7

110 Opinions

location-icon5 Playfield Road, Kennington, Oxford OX1 5RS England
Asian
outdoor_seating_262734takeaway_262734delivery_262734

First time here , nice chat with the owners over a beer, very good food, will be back !

restaurant_img
4.2

157 Opinions

location-icon29 Market Place
Asian
outdoor_seating_131326takeaway_131326delivery_131326

Great food every time I come here. If you are eating in, it’s bring your own booze.