GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.6

Based on 1.552 opinions finded in 4 websites

site_photo4

Nº 128 in 951 in Wigan

Nº 6 of 54 Indian in Wigan

CUSTOMERS TALK ABOUT DISHES WITH..currymustsalmoncookedfishmeatgarlicchillispicychickenricelambonionbeautifultandooriround

comment_iconOpinions

Nan bread very small since last time ordering. I ordered a chicken Tika with curry sauce . Didn’t lke curry sauce need to make more tasty it’s expensive life’s little things now are meant to enjoy was OK

site_logo

Lorraine . 2025-06-07

MORE AT Just Eat

the curry from here is so good, worth every penny

site_logo

Grace . 2025-06-03

MORE AT Just Eat

Great service and portion sizes - very tasty

site_logo

Lesley . 2025-05-27

MORE AT Just Eat

Always great food from here & delivery within the time given.

site_logo

Yvonne . 2025-05-27

MORE AT Just Eat

The chicken tikka masala is like tomato soup and the chicken korma tasted fishy. It said 30-50 mins delivery and took 1 hour 40 minutes. Won’t be going again.

site_logo

Ellisse . 2025-05-19

MORE AT Just Eat

Popped into Bindi today after Christmas,had to come back because of Debbie! The food was unreal as always. Service was spot on, Debbiee honestly never disappoints. Can’t fault her at all. Lots of love, will definitely be back again soon!!!

site_logo

Laura Johnson . 2025-05-14

MORE AT Google

Food was cold and all had to be put in the microwave and quite bland really

site_logo

Rick . 2025-05-03

MORE AT Just Eat

Absolutely delicious as per usual. I love that I can order curry with tofu to make it vegan!

site_logo

Heather . 2025-04-30

MORE AT Just Eat

Easy to book a table through Foodhub. Friendly and welcoming staff, who gave you the time to relaxant enjoy meal. Good selection of dishes to suit all. We dined but saw number of people collecting takeaway meals

site_logo

Andrew Smith . 2025-04-27

MORE AT Google

Been several times recently always a fantastic meal, staff are brilliant

site_logo

elaine chapman . 2025-04-26

MORE AT Google

Perfect delivery time unfortunately food not, premium price but quality and taste not so much....

site_logo

Mark . 2025-04-26

MORE AT Just Eat

Mi pareja y yo arreglamos que mis padres tuvieran los hijos y tuvimos una merecida noche libre de niños, algo que no hemos tenido en mucho tiempo Toda la semana, hemos estado hablando de emocionar a un curry para comer una comida que no hemos cocinado o que no pasaría frío, comer alimentos sin ser molestado. La cuenta regresiva para el sábado por la noche había comenzado y después de ser recomendado Bindis Antes de pedir, había mirado el menú, pero fui con nuestro pedido habitual de cebolla bharji, pakora de pollo, pollo tikka masala, arroz pilau, patatas fritas y un pershwani nan. Comimos el pakora de pollo primero, muy seco y la capa del pollo era muy suave, no crujiente en absoluto Luego comimos los bharjis, de nuevo muy suaves y ambos sintieron mucha comida del horno. Nada fresco, sin humedad. Sólo sequedad suave. Luego tuvimos nuestro pollo tikka masala. NO PIDAS LA TIKKA MASALA. No es tikka masala, es sopa de tomate. No era el rojo de un masala, era la naranja de la sopa de tomate. Sabía a sopa de tomate, nada en ese curry sabía nada remotamente cerca de un curry. El único cumplido que puedo darle es que estaba más cerca de la sopa de tomate de Heinz. El pan nan estaba empapado y suave, de nuevo probado y la textura era lo que podía explicar como si estuviera metido en el horno. Nada de ninguna parte de esa comida reflejaba frescura. Todo parecía sopa suave, seca y heinz. No satisfecho, no lleno, no feliz. De vuelta a nuestra comida india habitual, nunca más. Adiós Bindi.

site_logo

Leapolitan96 . 2025-04-26

MORE AT TripAdvisor

Driver phoned and said was out side was at wrong property said that’s where post code sent him kept saying at address look at number that you are delivering to once he realises that he has wrong address food was cold will never pay in advance again as when you pay cash they seem to find you

site_logo

paul . 2025-04-20

MORE AT Just Eat

First time eating in after having a lovely takeaway a few weeks ago. Chose to come for our anniversary meal, they went above and beyond! Arrived to a lovely rose board with happy anniversary in lights, flowers on the table and a happy anniversary banner. Each member of staff were very happy to help and made it a really special treat, especially the main waitress (which I unfortunately didn’t catch the name of). The food itself was outstanding, fresh and tasty with very good portion sizes. Prices were extremely reasonable! A lovely anniversary meal, we will 100% be back to dine in and takeaway. Our new number 1 in Wigan!

site_logo

Liam Whittle . 2025-04-20

MORE AT Google

We have only ever eaten inside at Bindi. This is the first time we have had a delivery and it was as good as eating inside.

site_logo

David . 2025-04-20

MORE AT Just Eat

excellent food and service. now please stop messaging me.

site_logo

Steven . 2025-04-19

MORE AT Just Eat

Always piping hot and good quality. Tasted amazing, as always

site_logo

Janette . 2025-04-18

MORE AT Just Eat

My absolute favourite place to order a curry. Always comes hot and the food is flavoursome. I also LOVE that I can order tofu as the protein in my curry. Thanks for a great meal as always

site_logo

Heather . 2025-04-08

MORE AT Just Eat

popadoms soggy and chips cold and curry luke warm.

site_logo

chantelle . 2025-03-25

MORE AT Just Eat

thankyouuu so much amazing food as always, still hot too! and early. lots of love

site_logo

Robin . 2025-03-22

MORE AT Just Eat

Absolutamente fantástica experiencia gastronómica! La comida estaba deliciosa, llena de sabor, y muy bien presentado. El personal era amable y atento, haciéndonos sentir como en casa. ¡No puedo esperar a volver por más!

site_logo

Nathalia H . 2025-03-20

MORE AT TripAdvisor

Had my daughter’s 40th birthday at Bindi last night. 15 family attended . Brilliant food. And service. Highly recommended. X

site_logo

Lynne Mears . 2025-03-19

MORE AT Google

First time ordering and I ordered popadoms where missing I ordered 4

site_logo

Beverley . 2025-03-10

MORE AT Just Eat

The best Indian meal I’ve ever had and I’ve had quite a few! Thoroughly recommend Bindi’s to everyone

site_logo

Susan . 2025-03-05

MORE AT Just Eat

Very good environment, delicious food and staff are very humble.

site_logo

Parth Parekh . 2025-03-03

MORE AT Google

Gran atención al cliente. Comida a buen ritmo. Y buena relación calidad-precio. Los platos principales eran deliciosos y el saag aloo era devine. Sin embargo, el entrante de pakora estaba muy seco y la manchuria era demasiado dulce, casi enfermiza. La próxima vez elegiría otra cosa. Total 8/10.

site_logo

PipLittle . 2025-03-02

MORE AT TripAdvisor

Food was really tasty, fresh & hot. lovely presentation and packaging. Great service would recommend thank you

site_logo

Susan . 2025-03-02

MORE AT Just Eat

We always have a nice experience here and the food is always excellent. Staff are very friendly.

site_logo

Alex Aspinall . 2025-03-01

MORE AT Google

Came for food and drinks for Mum’s 40th and Grandma’s birthday. Amazing service, food was brilliant and the staff were very polite and made us all feel very very comfortable. Would recommend and will definitely be back again soon.

site_logo

Liam J . 2025-02-22

MORE AT Google

Good food and good atmosphere 👌

site_logo

Jatin Patel . 2025-02-21

MORE AT Google

Great service superb food quiet through week so good to get table and take away too

site_logo

ste matthews . 2025-02-20

MORE AT Google

Tuvimos una comida increíble en Bindi! La comida estaba llena de sabor, el servicio era de primera categoría, y el ambiente era cálido y acogedor. ¡Recomiendo encarecidamente el Cordero Shank Bhuna y chile paneer! Sin duda volveré. xx

site_logo

Dean M . 2025-02-17

MORE AT TripAdvisor

Had an amazing meal at Bindi! The food was full of flavour, the service was top-notch,and the atmosphere was warm and welcoming. Highly recommend the Lamb Shank Bhuna and chilli paneer! Will definitely be back.xx

site_logo

Dean Max . 2025-02-17

MORE AT Google

Food come soggy! Like it’s been sat sweating in the wrapper for hours! Took 2 hours to come would not recommend

site_logo

Chelsea Hibbert . 2025-02-17

MORE AT Google

Excellent food, customer service. Will definitely go again. Highly recommended.

site_logo

jyolinshukla . 2025-02-17

MORE AT Google

Took two hours to deliver a pre-ordered meal. With prices charged you would expect more and at least a call from the restaurant to explain. Poor overall, will not order again

site_logo

Joseph Nicholas . 2025-02-17

MORE AT Google

Pedí una korma, era sosa, la korma de jarro del supermercado es más agradable y el arroz sabía a lima y no era agradable en absoluto, mis amigos jalfrezi sabía a salsa. El naan sabía a ajo crudo. ¡Desperdicio de 36 libras!

site_logo

Samantha H . 2025-02-14

MORE AT TripAdvisor

Being in walking distance of home we use this restaurant on quite a regular basis and it is up there with the best. A great selection of vegetarian dishes as well some excellent meat feasts. Debi and Mansi are superb front of house staff and indeed all the staff are efficient and friendly. Although the main entrance has steps there is a wheelchair ramp at the side of the building but you will have to let them know in advance if you need it and there is no adapted toilet. That is the only negative I have for Bindi!

site_logo

Glynis West . 2025-02-10

MORE AT Google

Ordered a takeaway last weekend and the chicken shashlik was dry and inedible. The chilli chicken was dry and the sauce watery, Nothing tasted freshly cooked. I complained to the restaurant who apologised and offered us a free meal, which we had delivered this weekend. The whole experience was completely different, the food was fresh and the chicken in both dishes succulent and tasty. Customer service is obviously valued by this restaurant who went out of their way to rectify the issue. I have only given 3 stars due to the inconsistency, but we do plan on using them again.

site_logo

Debbie Moss . 2025-02-10

MORE AT Google

We enjoyed excellent starters, mains and drinks at a comfortable table for two. The service from Debbie and the team was also excellent.

site_logo

21RichardJ . 2025-02-09

MORE AT TripAdvisor

Bindi is our local Indian and our go to. food is always lovely and the service is brilliant. we went today for my partners birthday and I only told them when leaving and they made us stay for an extra drink on them. lovely!! and the food is perfect.

site_logo

Fiona H . 2025-02-05

MORE AT TripAdvisor

Would definitely not recommend - never been so ill from a takeaway. The Korma tasted rotten and gave me severe food poisoning - stay away

site_logo

Toni Hill . 2025-02-03

MORE AT Google

This is my second visit 1st time in the week and was not disappointed. Food is beautiful, service fantastic, would reccomend eating here through week or weekend. Staff are really special, my go to Indian by far

site_logo

Angela Lee . 2025-02-03

MORE AT Google

I’ve ordered takeaway from Bindi of Aspull countless times, and it has always been perfect. The food is consistently fresh, flavorful, and of the highest quality. Every order arrives hot, well-prepared, and exactly as expected. This is without a doubt one of the best takeaways around. Highly recommend! 💯

site_logo

Mark Lever . 2025-02-03

MORE AT Google

worst Indian food from Bindi restaurant. ordered a chicken shaslick chicken was dry and over cooked onions and peppers slimy, actually looked like someone's left over food. Nan bread inedible hard as cardboard. £40 for a takeaway most of which went in the bin. avoid this place

site_logo

Phillip . 2025-02-01

MORE AT Just Eat

Delicious food will order from here again. Highly recommend 👍

site_logo

Emma . 2025-01-31

MORE AT Just Eat

No Nan bread delivered with lunsikui as per menu Over all very poor

site_logo

Paul . 2025-01-18

MORE AT Just Eat

Brilliant food and great service 👍

site_logo

SirCreef . 2025-01-04

MORE AT Google

Quite disappointed with the Biryani. Very fragranced and not for me. Peculiar taste to this dish. Biryani abandoned. Other elements of the order seemed ok

site_logo

Rai . 2025-01-01

MORE AT Just Eat

Bindi is local to us and we're grateful for that. We always enjoy our meals here either when we eat in, or grab a takeaway. When we eat in we are made to feel so welcome and as if we are part of the family. The service is amazing and the staff are always attentive even with our young child. Our food is always delicious and the portions are a good size too. Thank you to all who work there

site_logo

Kim Barker . 2025-01-01

MORE AT Google

Faultless..everything was bang on.. food,service ,entertainment Made new years eve a great night.

site_logo

Steven Harrison . 2025-01-01

MORE AT Google

Waited for 2.30 hours , food was cold , driver claims he broke down , when restaurant said she spoke to him and he was 2 mins away , which I waited another 45 mins

site_logo

Ian . 2025-01-01

MORE AT Just Eat

Faultless ...everything bang on,food service and the entertainment for new years eve, the singer Rachel Evans was brilliant. Thoroughly recommend Bindi..

site_logo

steh1963 . 2024-12-31

MORE AT TripAdvisor

really disappointed half my order missing an wat I did receive was not nice ;; goin take this further

site_logo

Trevor . 2024-12-29

MORE AT Just Eat

Absolutely stunning food! The chilli chips were insane! We will definitely be ordering again :)

site_logo

Ellise . 2024-12-27

MORE AT Just Eat

Tuvimos una experiencia increíble en el restaurante el día de Navidad, y una gran parte de eso fue gracias a la gerente, Debbie. ¡Es una joya absoluta! Desde el momento en que reservamos nuestra mesa, ella fue más allá para que todo fuera perfecto. Ella nos mantuvo actualizados en cada paso del camino llamando para confirmar detalles, lo que hizo nuestro día mucho más fácil y libre de estrés. La comida era absolutamente increíble cada plato estaba lleno de sabor y bellamente presentado, haciendo nuestra comida de Navidad verdaderamente especial. El ambiente festivo y el servicio excepcional hicieron que el día fuera inolvidable. Normalmente no escribo reseñas que mi pareja suele hacer, pero para esto, ¡simplemente no pude detenerme! Muchas gracias a Debbie y al equipo por hacer que nuestro día de Navidad sea tan mágico. Sin duda volveremos!

site_logo

Laura J . 2024-12-27

MORE AT TripAdvisor

One of the best curries we have had this year! Arrived on time and arrived hot! The portions are a good size, even the kids size is a generous amount. Will be ordering again.

site_logo

michelle . 2024-12-26

MORE AT Just Eat

Food is delicious from here and worth the wait. I love that I can get a curry with tofu. I'd like to see a mild vegan curry with tofu one day

site_logo

Heather . 2024-12-26

MORE AT Just Eat

Fabulous food very good staff management top class well done fantastic Christmas dinner 🍽 😀

site_logo

Graham C Bradley . 2024-12-25

MORE AT Google

excellent food and. excellent delivery

site_logo

Danielle . 2024-12-23

MORE AT Just Eat

Onion bhaji was frozen when bit into it and food was cold. Disappointed for the amount of money spent.

site_logo

Liz . 2024-12-22

MORE AT Just Eat

Otra experiencia fantástica , excelente comida y excepcional atención al cliente. El personal es muy amable, profesional y muy bien informado sobre la comida que se ofrece. Justo allí con el mejor restaurante indio que hemos visitado y hemos estado en un montón!

site_logo

Alfred . 2024-12-15

MORE AT TripAdvisor

Third of fourth visit with my wife and mother in law Can’t speak highly enough of the quality of the food and the superb staff that work there. We’ve eaten at many Indian restaurants over the years and this is without any doubt one of the very best. We aren’t in Wigan very often but if we are we always try to fit in a visit

site_logo

Richard Aiston . 2024-12-15

MORE AT Google

Delicious food .. ordered on time

site_logo

Nancy . 2024-12-14

MORE AT Just Eat

best Indian we have had really tasty

site_logo

Deborah . 2024-12-02

MORE AT Just Eat

La primera vez aquí, habíamos querido visitar por un tiempo después de escuchar grandes cosas y leer las críticas. No nos decepcionaron. Buen servicio, buena relación calidad-precio y excelente comida. Particularmente disfrutamos de los dos platos principales de pollo asado y cordero Sagwala. Tanto de los chefs especiales como muy únicos y sabrosos. ¡Volveremos!

site_logo

Tom . 2024-12-02

MORE AT TripAdvisor

This is by far our favourite Indian restaurant to come too, we’ve been coming here for years now and are never disappointed. The food is absolutely delicious every time, we have never had a bad meal! They always go above and beyond, are so attentive and the service is amazing! We come in here with our 2 young children and they couldn’t be more accommodating and welcoming. We love it here as a family. Highly recommend to everyone :)

site_logo

Katie Z . 2024-11-27

MORE AT Google

Great food & cooked the curry I wanted Not on menu(Potato & pea madras) Deb (the manager) sorts out anything for you..she is superb

site_logo

Jackie Walton . 2024-11-23

MORE AT Google

Great food , happy , pleasant waitress debbie who even brought my grandma a cake out for her birthday thank you so much for the great service debbie & Janesh

site_logo

Nicole Molyneux . 2024-11-18

MORE AT Google

This is a very very poor restaurant. Tandoori Mix starter was completely cold. Staff very apologetic and said they would bring fresh. It was the same dish but microwaved, had exectly the same cut I made in it. Staff clearly embarrassed. Not recommended.

site_logo

Russ Jackson . 2024-11-16

MORE AT Google

The best Indian in Wigan. The food is fantastic and fresh. Great service and value. Can't recommend enough.

site_logo

Phil Taylor . 2024-11-09

MORE AT Google

Somos habituales en bindi, simplemente porque la comida es increíble. Quería pasar mi cumpleaños número 40 aquí con mi familia y estoy muy contenta de haberlo hecho. No podía creer cómo salieron todos por mí. Me sentí tan honrada. Debbie especialmente estaba allí para mí y me hizo sentir increíble. Es adorable, como todo el personal. Estoy tan contenta de haber elegido aquí para pasar mis 40 años. Gracias desde el fondo de mi hogar. De verdad os quiero chicos xxxx

site_logo

Rachfaz . 2024-11-07

MORE AT TripAdvisor

Didn't disappoint as always the staff are so friendly helpful and just lovely service will defo again or order takeaway .great value for money and the food is amazing clean and lovely

site_logo

Joanne Eccles . 2024-11-04

MORE AT Google

Always our go-to Amazing quality everytime and extremely consistent

site_logo

Alex . 2024-11-04

MORE AT Just Eat

Delivery took over an hour and 15 minutes. Chips were stone cold. Popodam were all broken. Not a great experience.

site_logo

Vickie . 2024-11-03

MORE AT Just Eat

Wow fantastic food and great staff the best make you feel so welcome

site_logo

Hazel Heaton . 2024-10-25

MORE AT Google

Deliciosa comida, el pollo era tan tierno y la salsa bhuna perfección! Gracias a todo el personal, especialmente Imman y Debbie. Lugar maravilloso x

site_logo

Nic M . 2024-10-20

MORE AT TripAdvisor

Very polite delivery driver and food was fab!

site_logo

Jo . 2024-10-19

MORE AT Just Eat

Great, authentic cuisine, with plenty of dishes to choose from and vegan options clearly marked.

site_logo

Simon Brotherton . 2024-10-18

MORE AT Google

Excelente! Es la primera vez que come comida de este establecimiento. Pedí una comida para llevar para recoger. Maravillosa comida india. La próxima vez cenaremos de visita. ¡Dale una oportunidad!

site_logo

William B . 2024-10-14

MORE AT TripAdvisor

¡Wow! Nunca antes habíamos visitado a este indio a pesar de vivir en la zona. Todos estábamos muy sorprendidos por lo buena que era la comida. Los entrantes más deliciosos y el pollo tandoori fue de lejos el mejor que he probado. Servicio muy bueno, ambiente relajado muy agradable para los niños. No veo la hora de volver.

site_logo

Toni I . 2024-10-09

MORE AT TripAdvisor

La primera vez que he estado, definitivamente voy a volver. La comida era brillante y la camarera que tuvimos era fantástica, muy atento y muy amable.

site_logo

ellie s . 2024-09-29

MORE AT TripAdvisor

Absolutely delicious, very fresh and carefully prepared, very impressed thank you

site_logo

Nina . 2024-08-03

MORE AT Just Eat

Great food, nice atmosphere, very attentive staff. Excellent

site_logo

Benny Ball . 2024-08-02

MORE AT Google

Poor service only two staff on waited awhile for food, the food was excellent on leaving card machine not working could have been told this before we sat down

site_logo

Stuart Bremner . 2024-07-27

MORE AT Google

Hi i have looked on my banking app and have been charged twice but only recieved 1 meal

site_logo

tracey . 2024-07-21

MORE AT Just Eat

Two portions of chips - one is left over n soggy. Small portions of mains. Tiny nan bread. Bird size salad on side

site_logo

Erkan . 2024-07-07

MORE AT Just Eat

Ate in here tonight for the 1st time. It did not disappoint. Everything we ordered was superb, the portions were generous, the service was amazing and the atmosphere was spot on. I honestly couldn't fault any of it and will definitely be going back. Highly recommend 👌

site_logo

Julie Thomas . 2024-07-02

MORE AT Google

Absolutely amazing. The food tasted fabulous, the service was amazing, they're so kind, everytime I visit. While celebrating my sister's birthday, they surprised us with a sticky toffee pudding (I believe that's what it's called). It tasted amazing, along with all the food they served us prior for starters and our main course. Would 100% recommend if you want to go somewhere for special events like birthdays. The people working there were efficient and kind, I love going there.

site_logo

Potato ThePillager . 2024-07-02

MORE AT Google

Went there for daughters 17th with the family, great service and great food, and what's more, its the same story every time we go, can't fault the place!!

site_logo

Peter W . 2024-07-01

MORE AT TripAdvisor

Today we had a family meal for my husband 75th Birthday. Everything was perfect the food excellent the staff were amazing nothing was a trouble and there was 14 adults and 2 children well done to all the staff thank you for making his birthday perfect

site_logo

Linda Wilkinson . 2024-06-30

MORE AT Google

Now I’m not going to lie when I say we are regulars we are regulars. Every other week. This is because the food is seriously out of this world and I’m surprised to see there’s no awards for the food. Amazing as always and we mean it. So we decided to have a different meal, purely because we know how good the food is anyway and wasn’t disappointed. I have the fish sizzler and my god it’s a must. Debbie (the senior waitress) god love her is a true gem and because of the excellent service we receive from her is the reason and because of the food we come as often as we do. Can’t wait to take the family in a few weeks too. They love it too. Bindi all the way . Thanks guys love Rach and Neil xxxx

site_logo

Rachfaz . 2024-06-29

MORE AT TripAdvisor

Called in after reading some online reviews and we weren’t disappointed The 2 members of the front of house team were welcoming, friendly and professional The menu was extensive and full of variety All the food we ordered was excellent, lovely flavours and generous portions. Highly recommend a visit

site_logo

Alfred . 2024-06-27

MORE AT TripAdvisor

Ignorant bar member playing on phone no taste to food. Burnt crusty egg in biryani. Very disappointed and won't be using again

site_logo

alex jones . 2024-06-23

MORE AT Google

Always love Bindi, lovely staff great food

site_logo

Mr Helzbygrad . 2024-06-16

MORE AT Google

Fabulous food, great service, even though they were busy nothing too much trouble for them 😀

site_logo

Kim Bradley . 2024-05-27

MORE AT Google

Tikka masala tasted like tomato soup with spices was not what I expected

site_logo

Reece . 2024-05-17

MORE AT Just Eat

When Bindi changed ownership we worried that our favourite Indian would go downhill, and for a while our concerns were justified but after a bit of a rocky start they seem to have got their act together. We go here regularly and the food is always good the menu and chef haven’t changed, there is a great variety of vegetarian and vegan dishes as well as fish and meat options. What did change was the hands on approach of the previous owners, this left a hole in both the personal welcome and the organisation of staff. However, the promotion of Debi to head waitress has rectified both of these issues, the welcome and service is once again as good as the food. So thankfully our favourite local Indian restaurant remains our No1.

site_logo

cottea . 2024-05-13

MORE AT TripAdvisor

The food smelt lovely from outside front door before we even entered. Friendly, wholesome service from the young lady. I had the tandoori mixed grill and a few other bits and my friend had a balti - Both were delightful. Would dine again if in the area

site_logo

Scotttytooohottty . 2024-05-13

MORE AT Google

Our first visit and definitely will be more A very warm welcome on arrival, excellent food , very relaxing atmosphere and probably most of all it’s friendly on your pocket 😊

site_logo

Paul H . 2024-05-11

MORE AT TripAdvisor

Similary restaurants in North West

restaurant_img
4.6

778 Opinions

location-icon1-3 Gerard Street
Indian
outdoor_seating_207139takeaway_207139delivery_207139

Visited this place on Saturday for my husbands 70th birthday and I Can’t recommend it enough the food and staff were amazing.All twenty of us a brilliant night .Thanks again 👍👍

restaurant_img
4.6

390 Opinions

location-icon104 Elliot Street
Indian
outdoor_seating_81435takeaway_81435delivery_81435

Never had a bad meal here, its lovely

restaurant_img
4.5

660 Opinions

location-icon138 Bolton Road
Indian
outdoor_seating_227227takeaway_227227delivery_227227

Excellent place for dining wide range of choices. Everything order was tasty and well presented. Our server Amin was excellent and went extra mile in engaging our 7 year old son with his funny tricks. Thank you for a lovely innings.

restaurant_img
4.5

1023 Opinions

location-icon190 Upholland Road
Indian
outdoor_seating_207860takeaway_207860delivery_207860

Always super friendly atmosphere and superb food.

restaurant_img
4.7

1080 Opinions

location-iconVauxhall Road
Indian
outdoor_seating_162207takeaway_162207delivery_162207

Business closed down before 2023. Not sure why it's still showing