GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.4

Based on 2.051 opinions finded in 3 websites

site_photo4

Nº 325 in 792 in Bournemouth

Nº 9 of 28 Indian in Bournemouth

CUSTOMERS TALK ABOUT DISHES WITH..oldcookedonionchickenpaycurrylambricespicymeatgarlicprawnvegetablemustbeautiful

comment_iconOpinions

Amazing food, served quickly and hot to the table. Lovely, attentive staff. Great prices.

site_logo

Dr Beatroot . 2025-02-07

MORE AT Google

Viernes por la tarde 6 pm Muy buen servicio atento. Bebidas BYO El entrante para 2 era muy sabroso. Mi principal de pollo tikka era tan grande que tuve que llevar 1⁄2 a casa en una bandeja de plástico que me proporcionaron. Me encantó el arroz de coco. ¡Gracias!

site_logo

Stay18934259896 . 2025-01-25

MORE AT TripAdvisor

Ordené que se entregara una comida para llevar. La comida era deliciosa, fresca, caliente y a tiempo. Excelente relación calidad-precio. Recomiendo pedir desde aquí para entrega a domicilio. También puedes comer si quieres.

site_logo

Tracey W . 2025-01-03

MORE AT TripAdvisor

Naga curry was exceptional. Best Curry in Bournemouth

site_logo

Max Fry . 2024-12-27

MORE AT Google

Wasn’t very happy with my takeaway last night of chicken tikka jalfrezi and garlic naan. Firstly the chicken was plain and not tikka and it was very tough and chewy. It wasn’t very spicy and lacked peppers and onions. Have used before and has been ok.

site_logo

Lee Dixon . 2024-12-24

MORE AT Google

I went there last Wednesday evening (December 11th 2024) with a friend as it's a restaurant we've been to before and we like the ambience, the reasonable prices - & the fact that one can bring along their own wine. My friend ordered a chicken main & 3 side dishes, which he was happy with (eating most of it), while I had a King Prawn Jalfrezie & a garlic nan. It wasn't at all like the Jalfrezie dishes I've had in India (where I lived for the last 4 years) and not as tasty - but it was freshly prepared. However, within 24 hours I began to feel stomach pains and was violently ill (from both ends) for 5 solid hours whilst travelling back to Wiltshire - which necessitated spending those hours in a succession of 3 different toilets in Salisbury until I felt safe enough to catch the last bus home. So, I don't know whether the kitchen either didn't remove the gut thread within the prawns or they were contaminated in some other way, it has put me off ever ordering seafood there again. And it's the restaurant I always go to there as it's convenient for my friend who lives nearby and can't walk far. I phoned to complain yesterday afternoon and was told someone would call me back - but no-one has. Thus I decided to write a review and warn others about ordering the King Prawns there.

site_logo

Jennifer Webb . 2024-12-17

MORE AT Google

Increíble comida, gran personal, los panes Nan los mejores, generosos tamaños de porción, gran entrante de kebab mixto, cordero en mi principal tan tierno, muy buena relación calidad-precio

site_logo

Samantha B . 2024-11-13

MORE AT TripAdvisor

Delicious food, great choice, kind staff. Lively atmosphere and as it is not licensed you can bring your own alcohol. Two sittings are encouraged, 1700 hrs until 2000 hrs, then after 2015 hrs on busy nights.

site_logo

Yvonne Baragwanath . 2024-11-07

MORE AT Google

Ordered Chicken Tikka Madras and got served Chicken Tikka Massala which I never have. The waiter argued that I was wrong. Terrible service Also the Massala was full of coconut which it should not contain anyway.

site_logo

Steven Hull . 2024-11-02

MORE AT Google

Just left the balti house and was very impressed at what the restaurant delivered in class food service and price. The value here and the quality you get for it is exelent you can't go wrong going here exelent I'll be coming back next time I'm down Bournemouth

site_logo

Gareth Evans . 2024-11-01

MORE AT Google

Coming from the midlands, a decent curry house is hard to find outside of here. This didn't disappoint. The special Pathia is amazing and the naan bread is delicious 😋

site_logo

Stezo2k . 2024-10-27

MORE AT Google

Poor service, taste was just ok and nothing special.

site_logo

Sagar Bhansali . 2024-09-03

MORE AT Google

We visited the restaurant on 02 Sep 2024, Alex and saddat Served us very well, with high standards of hospitality, our team of 3 members were also happy with the service. We ordered chicken biryani, chicken curry and plain Naam. We loved the food, we would be visiting again and also recommend our friends to visit this restaurant.

site_logo

sangam ale . 2024-09-02

MORE AT Google

Delicious food but quite uncomfortable/cramped seating arrangement. Still, wouldn't hesitate to come back.

site_logo

Guy Arnold . 2024-08-29

MORE AT Google

We ordered online. When it was delivered after 1hr 20mins on a Wednesday late evening by the time food arrived & the food was good. I’d go so far as to say the lamb Kara is the best lamb dish I’ve ever had from an Indian. The lamb was lean (no grissle or fat), so tender & so delicious. The lamb samosa starter was almost cold & was tasteless really. The Peshwari naan, my husband had, looked / was light & delicious - I couldn’t try it due to wheat allergy. The onion bhajis were almost cold, good quality but not exceptional - as was the vegetable biryani. We’d order from The Balti House to try them again & hope that their delivery is swifter on the 2nd time.

site_logo

Elizabeth Lazell . 2024-08-29

MORE AT Google

We have used Balti House for 30 plus years tonight we ordered a take away to collect priced it up from the website before collecting it came to £22 but were charged £24 and in the shop were told the prices had gone up, not acceptable at all. Then when home and eating the mushroom rice was very spicy and couldn’t eat it. Very disappointing especially as it was for my husbands birthday.

site_logo

Julie Sawyer . 2024-08-28

MORE AT Google

First approach from the staff member was really really bad. Not very welcoming. Specially the staff named sadek was really rude. Mr Himel was very nice and well behaved. Food was good. Interior very old furniture. Specially the chairs.

site_logo

Rafid Islam Plabon . 2024-08-20

MORE AT Google

Would give zero stars if possible. Food never showed. Never using this place again. Very poor.

site_logo

Poole Paul . 2024-08-15

MORE AT Google

Hemos sido clientes leales durante muchos años, pero el otro día nos sentamos en una mesa junto a una ventana rota con cinta adhesiva. Un paso demasiado lejos y vamos a probar el otro indio en el camino muy pronto. ¡Simplemente ridículo que se sienten las personas junto a una ventana rota! 😒 No se sintió como un placer en absoluto

site_logo

Rafaella M . 2024-07-07

MORE AT TripAdvisor

1st class. Food was delivered fresh, hot and plenty of it. Thank you very much.

site_logo

Mark Thomas . 2024-05-20

MORE AT Google

Brilliant excellent food fantastic staff Brillant very helpful in everything

site_logo

Louise Delahaye . 2024-05-13

MORE AT Google

Best Indian in town, in todays market good value!

site_logo

James Edney . 2024-04-18

MORE AT Google

Shame…we were looking really forward to a takeaway treat. Tried to call but no answer after nearly 5 minutes ringing or going to voice mail. Then ordered online on their website direct and received confirmation for delivery 25 mins later. After an hour and a half, called to see where the order was, and they mentioned they had an issue with online orders and we needed re order and would deliver in 45 mins to an hour or so. No apology or sympathy whatsoever😳. Disappointing service as the food is usually pretty good.

site_logo

Helen Piercy . 2024-04-06

MORE AT Google

Fantastic meal tonight. Husan as always was a fine host. Lovely spices lovely ambience. We use this great restaurant every week. Always top notch. And even better tonight thanks.

site_logo

Kevin Brook . 2024-03-25

MORE AT Google

I've always enjoyed the food and atmosphere at the Balti House. They offer a varied menu, with a great choice of house specials. The staff are friendly and welcoming, and they provide an excellent level of service. I'll be back to sample more of their menu for sure!

site_logo

Ben . 2024-03-23

MORE AT Google

Lovely food Great value Slow service

site_logo

jilly phaedona . 2024-03-18

MORE AT Google

Really nice food, had a takeaway last night and really enjoyed it, really good portions

site_logo

Bill Whalley . 2024-03-16

MORE AT Google

A good value meal deal. Too much garlic in the Spinich sagg for me

site_logo

Malcolm Somers . 2024-02-01

MORE AT Google

Have been visiting the Balti house for maybe 15yrs now. Always reliable, good value and good food. But…it’s just not what it was. Don’t get me wrong the food is great in the main, plentiful, tasty (a little more spice would be welcome), hot and well presented. Just no real passion, kinda feels like it’s now ‘going through the motions’. A number of items not available, such as ‘cucumber Rita’…”sorry we don’t have any cucumber” (so a bowl of yoghurt then!) I guess you shouldn’t complain at £93 for 4 people having 4 courses mind you. By the way I’d recommend the tandori mixed grill. We will visit again no doubt, but I guess times change and you just have to accept that and enjoy for what it is, a decent local British Indian restaurant.

site_logo

DorzetDave . 2024-01-31

MORE AT TripAdvisor

I was surprised at how good the food was . Definitely return to this place. 👌

site_logo

harryscat . 2024-01-06

MORE AT Google

Food and atmosphere are amazing. Not to mention the value for money esspecially in this cost of living crisis. 100% recomend

site_logo

Gareth de la Fuente . 2023-12-06

MORE AT Google

Great indian restraunt. Is BYOB which was an added bonus .warm friendly welcome and given a table til 9 as busy. The food was excellent, we all had house specialities which were very generous portions .inexpensive and close to train stations with main bus route outside . We will be going back soon .

site_logo

Gavin Hewitt . 2023-11-12

MORE AT Google

Superb restaurant. Great prices and amazing food and service. Been here twice now when working. Highly recommended

site_logo

David Harvey . 2023-11-10

MORE AT Google

Best in bourmouth 5star. Food fantastic. Staff professional love it here . Higher recommended. Can’t wait to go back . Brill

site_logo

elvis197 . 2023-10-20

MORE AT TripAdvisor

My son, daughter, and myself visited recently, and all we all had different meals. We were all delighted with the quality of the food, and the service was excellent . I will certainly be visiting again and would recommend it to anyone .

site_logo

John Hallam . 2023-10-04

MORE AT Google

We had a sit down meal for 6 people here over the weekend. It was our first visit here and all the atmosphere in here was very friendly and welcoming. Everything was clean, tidy and well organised. The food we ordered was all excellent (especially the anakoli lamb) and served on a relaxed way. Balti House isnt licenced so remember to BYOB. Thanks for a great meal and hopefully well be back soon.

site_logo

Jon Walker . 2023-10-03

MORE AT TripAdvisor

This is one of those hidden gems, modest and as the best Balti houses are, placed in an area that doesn't necessarily float everyone's boat. This should not put anyone off though. The staff are brilliant, food was amazing. Yes it could do with a lick of paint, and equally they could raise their prices. That last point is an unusual thing to say. Affordability-wise this was amazing, I would expect to pay probably 20% more. Thanks for an amazing meal. P.s. they don't have a drink license, do bring a bottle - although the Mango Lassi was amazing.

site_logo

Chris Kerr . 2023-09-16

MORE AT Google

Don't let lookes desive your the food is amazing friendly staff good service, Coming back next week

site_logo

David Boswell . 2023-09-03

MORE AT Google

We ordered a takeaway of 3 different dishes. Two were extremely watery and tasteless, the other was mediocre. Disappointing

site_logo

Steps150542 . 2023-08-20

MORE AT TripAdvisor

Go for the food! Although the restaurant itself is getting tired & in need of a refresh, it is clean & inviting. But the food! It is delicately & authentically spiced. Most importantly there is no oily residue in any dish - not even the deep fried puri (super impressive chef!) and all the breads are light not doughy. I wish you were nearer to me. To put this in context - we work nearer Birmingham so it’s easier to get to a million local curry houses - none of which serve this quality food. Enjoy this Bournemouth! And thank you Balti House

site_logo

Pria AW . 2023-08-19

MORE AT Google

Ordered a takeaway from the hotel. I must say the food was excellent, fresh and testy. This is what Bangladeshi food should test like. We also had a takeaway last night from another restaurant from Dorset and food was not that great. I would definitely highly recommend this place.

site_logo

Morshedm . 2023-08-14

MORE AT TripAdvisor

small, quaint resturant, fancy food, fresh produce, flavour was a let down though I've had better.

site_logo

Afsana Khanam . 2023-08-13

MORE AT Google

Amazing food - try the chef's specials. Really enjoyed the Coco Chicken.

site_logo

Dave Wallace . 2023-08-13

MORE AT Google

The table next to me threw a can a hissing gas at my table and shouted cyanide, I went home straight away and was violently sick in my back garden. Asked them to check CCTV. They wouldn't. Also, they have poisoned me a few times with their poppadoms and food. All occasions I threw up violently. I wouldn't go back here if you paid me any amount of money.

site_logo

Glenn Roast . 2023-08-12

MORE AT Google

Great food and friendly service. The children were made very welcome. Clean and well presented. 5 star food hygiene rating too.

site_logo

rachel9kerry . 2023-07-24

MORE AT TripAdvisor

Not a good choice and food is not worth for the money you spent

site_logo

lalith kanakala . 2023-07-07

MORE AT Google

Excellent food & service - onion bajhis amazing !!

site_logo

Jan Bell . 2023-07-03

MORE AT Google

After just eating a gorgeous meal from the Balti House I felt it necessary to comment on the experience. What a lovely, clean and generous offering. This restaurant is fairly priced (a welcomed offering in today's climate) the food fresh from the stove even though ordered half an hour before closing. Two of us ate for under £30 leaving us both with a tiffin each for lunch tomorrow. The saag bhaji was absolutely delicious. Highly, highly recommend. Go!!

site_logo

Holly C . 2023-07-02

MORE AT TripAdvisor

Great place to eat out with small number of friends. Service and attention from the staff was first class and the food was amazing.

site_logo

David S . 2023-07-02

MORE AT TripAdvisor

Excellent food and take your own drink a really cheap night out.still as good as ever with really friendly staff and good service.

site_logo

John London . 2023-06-21

MORE AT Google

Excellent local curry house. Also love getting a takeaway from here. Chilli paneer is delicious.

site_logo

Rob Clare . 2023-05-21

MORE AT Google

Excellent food, very good service.

site_logo

Jim Bald . 2023-04-22

MORE AT Google

Visited this small restaurant today. Everything was wonderful. We even had some food with us home... 😁 👍 Amazing food, friendly staff.

site_logo

Irina Stapley . 2023-04-19

MORE AT Google

Amazing, friendly place. My family and I always feel welcome at the balti house where the food and service is certainly worth heading outside of the main square for. Thank you again, every takeaway we have is balti!

site_logo

Connector28196537893 . 2023-04-19

MORE AT TripAdvisor

Great service and warm place delicious food 😋😋 never disappointed will be back again specially Thanks To Himel for outstanding & welcoming and friendly service

site_logo

Tufayel Ahmed Zahid . 2023-04-18

MORE AT Google

Excellent food and very attentive service, have been here before many times and will return many more times!

site_logo

Rahman Shitu . 2023-04-18

MORE AT Google

What's not to like ! You can even bring your own alcohol !!

site_logo

patsy badgley . 2023-04-17

MORE AT Google

Fantastic food, take your own alcohol as they do not sell

site_logo

David Jackson . 2023-03-31

MORE AT Google

Had a lovely meal. Very friendly service. Food was amazing. Just a heads up It’s a BYO Alcohol, as that caught me out, but there is an off-licence shop a few doors down. Definitely recommend.

site_logo

Goldi Locksmith . 2023-03-22

MORE AT Google

One of the best vegetable dansak and vegetable balti we've had in a very long time. Well worth a visit. Staff are lovely and friendly. You do have to take your own alcohol, but that's not a big deal for such amazing food. 🌟🌟🌟🌟🌟

site_logo

Pip Carr . 2023-03-16

MORE AT Google

Great place. Had a curry with a few friends last night. Lovely food and staff.

site_logo

Jason Sheridan . 2023-03-05

MORE AT Google

We had 3 different curries for takeaway and each of us really enjoyed our choices

site_logo

Neil S . 2023-02-17

MORE AT Google

Saw mixed reviews for the place but thought would give it a try as more good than bad. Firstly the manager needs some lessons in customer service, rude and has a lot of attitude in him.! Ordered kebabs for starters, half way through there was a hair cooked in.! Called the manager who took the plate and offered a replacement but no apology or explanation for how a whole hair over 2” long is cooked into the food.! His response “we can just take it off the bill if you want”. The mains arrived a little better but still not as ordered, asked for no garlic or ginger garnish and both the biryani and naga were full.! The waiter who served us after was a lot more professional and courteous. Overall was a bad experience and would not come here again. At any point throughout no apology was offered for the service provided by the manager and hair cooked within the food.!

site_logo

Rey Shafiq . 2023-02-12

MORE AT Google

Just so good. Full of flavour and quick delivery

site_logo

Laura Haydon . 2023-02-11

MORE AT Google

Brilliant second home always excellent service and excellent quality food

site_logo

Richard Evans . 2023-02-09

MORE AT Google

Wonderful food lovely staff and just a cosy atmosphere cant wait to go back

site_logo

Joanne House . 2023-02-06

MORE AT Google

Amazing food, friendly staff, nice atmosphere. Will definitely visit again

site_logo

Jason Bale . 2023-02-04

MORE AT Google

Always a very good meal and staff all lovely 10 out of 10

site_logo

Corrine Williams . 2023-01-30

MORE AT Google

An amazing experience! Authentic Indian food at its finest!

site_logo

Tamarin . 2023-01-24

MORE AT Google

The best restaurant I have ever been absolutely love it here the food is amazing and the service is amazing the owner is a really nice person and a the restaurant design I gorgeous I would highly recommend it and hope you come dine here beacuse this place is amazing and whoever. Hasn’t ate here should bc omg the food is so good

site_logo

Rafael Dunford-Castro . 2023-01-13

MORE AT Google

Constantly think it is ok to dump broken or unusable chairs etc on the pavement. It is not...why should other people pay to remove their rubbish. Reported to the council with photographic evidence.

site_logo

Pete jones . 2023-01-07

MORE AT Google

Had a takeaway from Balti House and it was not up to standard, in fact it was awful. It was surposed to be 2 Jalfrezi Curry, but was just Curry Sauce with Tomatoes and uncooked large pieces of oniion, no chillies or spices! I phoned to complain and this very unfriendy man answered and told me, bizarrely, to take my refund request and complaint to "JUST EAT" as i had ordered online! So sent them a e-mail, next day recived a reply saying they would investagate. I recived another email, next day saying they require photo of the two meals. I told them I had bined it and I was not going to search my communal bins! Needless to say no refund or apology!

site_logo

delboy7777 . 2023-01-02

MORE AT TripAdvisor

It was a bit cold in the booth where we were seated by the window, my companion kept her coat on throughout the meal. There was a wall heater situated nearer the inside tables. We ordered poppadoms which came with some garnishes to start with and half way through we were asked for our menu choice, we didn't understand why they didn't want to let us finish the poppadoms first, maybe it was a time thing to get our food cooked. The main meals of mixed grill with a plain naan and a chicken korma dish with a garlic naan and salad were delicious and plentiful. This restaurant does not have a drinks licence so you can bring your own without any corkage charge which makes it inexpensive. Worth a visit to this establishment in Christchurch Road, Boscombe.

site_logo

steve mac . 2022-12-11

MORE AT Google

Good food,friendly and the service is great. Looking forward to when their Queen Momtaz opens

site_logo

Lynne Gallagher . 2022-12-10

MORE AT Google

We have been here many times in the past and recently returned to the area so thought we’d come again. As always the quality was fantastic. Curries we’re delicious and staff very friendly. Very fair pricing and the joy of bring your own booze makes for a cheap night out! We will certainly be coming back next time we’re in the area. I strongly recommend the pathia and the makhani if you don’t like spice.

site_logo

dansullivan96 . 2022-11-21

MORE AT TripAdvisor

Have visited balti house many times. Wonderfully tasty and well priced food. Staff very friendly and obliging. BYO alcohol is great. Very popular and often full.

site_logo

The McRobbs . 2022-11-12

MORE AT Google

Nice food but waiter hamal was the worst, the worst waiter/manger I have come across, because of him I would never come here again, asked him about best curry dish and he said look at the menu I had to ask him multiple times before I got an answer, I thought maybe it's a one of and went the next day and ordered over the phone to eat in and when I arrived food was made to takeout, I said I want to eat in and he said its for takeout, borderline refusing to let me eat in, anyhow he seated me next to the toilet even though the rest of the restaurant had only a few customers, he served me a curry without a naan, then it gets worse I ask for a naan and he said would you like 2 naans I said 1 for now and he said if you want 2 naans order them now as the kitchens busy, I requested 1 and he walked of. Very rude person, and I will never be coming back here again. This person should be sacked.

site_logo

Smart Bill . 2022-11-08

MORE AT Google

Went with friends Lovely staff Tried each other’s curry’s as all different but ALL were very good nice to go to a restaurant that does not use bronze level chicken as silver is so much better. if they use Gold this would set the standard locally currently held by Standard Bengal in Christchurch with dedicated Chef Mad Dog the legend. But in Bournemouth the Balti House Food is extremely Good !

site_logo

Mark G . 2022-11-05

MORE AT TripAdvisor

best indian I ever had got it delivered and it was hot definitely going back again very happy with my food well dont staff

site_logo

carla jefferies . 2022-11-04

MORE AT Google

Wednesday and Sunday special pricing is the best.

site_logo

Gordon Fong . 2022-10-30

MORE AT Google

Table for one as I was filming in Bournemouth. Very busy restaurant that looked full, but they squeezed me in with no drama, and gave me a table for 4 all to myself. Served by one of the most beautiful human beings I have ever met, and subsequently ordered drinks and food after getting settled in. It's worth noting that they don't serve alcohol, but are more than happy for you to bring your own drink with you. Food arrived within 7 or 8 minutes and was very hot in temperature, and perfectly flavoured. Lamb Saag is a dish I tend to order as its a good benchmark. It was tasty, full of flavour and really nice lamb that wasn't at all gristley or chewy, just nice chunks of meat. Price, October 2022 for Lamb Saag with Mushroom Rice and a large glass of Coke, £15.05 - very reasonable. I would definitely recommend this restaurant.

site_logo

boyrevel . 2022-10-30

MORE AT Google

Great place with great staff. Bring your own drinks in from the corner shop down the road. This place always has a good atmosphere too. Never xan gi wring with the set menu

site_logo

James Landen . 2022-10-25

MORE AT Google

Nice food, great atmosphere, could not understand why the waiter wanted to input the WiFi password himself. Other than that great little place. Have to bring your own alcohol (not a problem for me as I don't drink).

site_logo

Luigi Grimaldi . 2022-10-18

MORE AT Google

First visit to the Balti House and had to write a review as food was absolutely fantastic, staff friendly and will certainly be returning.

site_logo

Lydia Burt . 2022-10-08

MORE AT Google

Great curry menu and service Accommodated 13 of us Tues Night bring your own booze keeps the cost down. Place was nice and busy

site_logo

John Blake . 2022-10-03

MORE AT Google

Really good food. Staff very attentive and happy to help. One of the best curries we have had and great value for money.

site_logo

M Wilson . 2022-09-25

MORE AT Google

We’ve been coming to the Balti House for years, never had a bad meal but the last few times have simply been amazing. Best Indian in Bournemouth

site_logo

MrsJenkinsUK . 2022-09-10

MORE AT TripAdvisor

i have only had take away but always very good and the portion size is large for veg balti will be my regular from now on

site_logo

Ciaran Baddiley . 2022-08-31

MORE AT Google

Very tasty Indian food. Good selection. Ordered by phone. Food ready at the time indicated . Friendly staff

site_logo

Jeff Mason . 2022-08-29

MORE AT Google

We always turn up late! Not on purpose, more on a whim of just fancying a curry after a late walk on the beach. Staff are always super polite and welcoming and the food is perfect. I usually go for a Jalfrezi but sometimes the heat is too much so this time I went for the chicken curry, pilau rice and a garlic naan. This was recommended by my partner and is perfectly spiced. Nice flavours and not too spicy but still has a kick. Child came along with us this time and shared mine, as portions are perfect, and liked the spiciness of it too, (he loves a curry). Service, speed, friendliness all spot on.

site_logo

Lala BeeGee . 2022-08-29

MORE AT Google

Best Indian ever. Everything cooked fresh, served very hot and is so tasty. All staff are lovely and is reasonably priced too. can get busy on weekends to eat in so book if you can, also bring your own drink. 100% would recommend :)

site_logo

Alicia Macleod . 2022-08-28

MORE AT Google

Tasted like really authentic Indian, lovely flavours,all curries cooked nicely, naans were a bit undercooked but we visited shortly after they opened, around 5.30 so Tandoori oven might have been not hot enough yet. Defo will eat there again

site_logo

maria damaschin . 2022-08-23

MORE AT Google

Good food and reasonably priced. Food is also Halal. Our mains were Chicken Tikka Jalfrezi and Tarka Daal. The food was flavoursome but the Chicken Tikka was really over cooked. Only issue we had was receiving a glass containing a few drops of coka cola, which clearly wasn't washed properly before receiving. I did request a clean glass and this was rectified promptly. Also the music was rather loud which made the experience less enjoyable, as we were hoping for a relaxed evening. Decor is also really dated and could do with some freshening up. Service was also generally polite and attentive. Would give 5 stars if the issues above were resolved.

site_logo

Soyodhi Alam . 2022-08-12

MORE AT Google

Always a good meal with a friendly welcome

site_logo

Lisa Scrimshaw . 2022-08-04

MORE AT Google

Superb food and service. Can highly recommend them. Our family tends to want a wide variety of choices and the Balti House menu caters to all. Delicious and fairly priced, you won't be disappointed with a meal here. Excellent!

site_logo

James Alexander . 2022-08-01

MORE AT Google

Recommended by many locals and definitely with good reason

site_logo

Anthony Norris . 2022-07-25

MORE AT Google

Fantastic food. Lovely, cosy restaurant and friendly staff... Highly recommended. Easy 5 stars.

site_logo

Jenny Hulbert . 2022-07-19

MORE AT Google

Order aloo chaat but received aloo sabji. Not liking it. The aloo chaat does not look like what i got on the pic

site_logo

Kaustubh Behere . 2022-07-08

MORE AT Google

Lovely curry with friends good service, polite friendly staff, ps,wish other food outlets,could learnfromthem

site_logo

Annie Foy . 2022-07-06

MORE AT Google

I recently attended this restaurant on my birthday with a few friends and had good experience with food and service. I would definitely come again and every plate, bowl and dish was polished off completely as the food was LUSH.

site_logo

Robert Leech . 2022-06-17

MORE AT Google

Similary restaurants in South West

restaurant_img
4.4

1655 Opinions

location-icon33 Seamoor Road
Indian
outdoor_seating_198670takeaway_198670delivery_198670

Very friendly, personable and attentive team. Made a lovely effort for our meal. Great food, would really recommend visiting here.

restaurant_img
4.3

1414 Opinions

location-icon286 Wimborne Road
Indian
outdoor_seating_94026takeaway_94026delivery_94026

Fab food and service. Take your own booze! Lovely People, very helpful as I suffer with Mobility. Food was divine. Deffo will go back. Thanks peeps. Xx

restaurant_img
4.5

1448 Opinions

location-icon782 Wimborne Road
Indian
outdoor_seating_101409takeaway_101409delivery_101409

You can tell the food is freshly prepared, it was delicious. Found our new go to!

restaurant_img
4.3

182 Opinions

location-icon77 Southbourne Grove
Indian
outdoor_seating_93888takeaway_93888delivery_93888

Best curry in Dorset. Always fresh food and super tasty. Will use again and again. Cheers.

restaurant_img
4.5

64 Opinions

location-icon489 Christchurch Road, Bournemouth BH1 4AE England
Indian
outdoor_seating_263195takeaway_263195delivery_263195

The food at Baboo Ji is among the best vegetarian Indian cooking I have come across. I first visited in April 2022 with a work colleague and now it is one of my go to eateries when I'm in the area. The staff are friendly and seem to know most of their customers well, always a sign that they care about returning trade. Definitely a 5 star venue. Sadly, I've just found out they are having to close this restaurant but are looking for new premises to re-open. Keep an eye on their social media pages on Facebook and Instagram for info on the new site when it comes.