GastroRanking-logo
whatsappWhatsapp
phoneCall
desktopWebsite
menuMenu
bookingBooking
4.2

Based on 1.242 opinions finded in 2 websites

site_photo4

Nº 638 in 1508 in Islington

Nº 10 of 51 Chinese in Islington

CUSTOMERS TALK ABOUT DISHES WITH..cucumbernoodlesporkspicysouppigladysaladchickenfriedvegetablericedumplingsoilmeatchillimust

comment_iconOpinions

Complete rip off! £12 for basically noodles no meat. Black Lotus and Pork Ribs, total £30?!? Food came out within two minutes obviously premade. Dont understand the reviews?! Stomach is horrible few hours later... :(

site_logo

HM . 2024-12-27

MORE AT Google

Nice little restaurant. Good variety of dishes, but other than the chili oil, our noodle dishes were lacking in flavor, very simple. Not a fan of the pig's ears, but mostly a personal distaste for the texture. Great service, quickly served. Drinks/teas were a bit overpriced, but they are happy to serve only tap water.

site_logo

Tom S . 2024-12-25

MORE AT Google

If I could give negative stars, I would. My recent visit to this place was terrible from start to finish and left me wishing I hadn’t given the place a second chance. I visited a few months ago and wasn’t impressed, but decided to try again. Sadly, it was even worse this time! As several others have mentioned, the staff were cold and unwelcoming from the moment we walked in. There was no warmth, no friendliness. The food was the biggest letdown. Almost every dish was swimming in oil—bad-quality oil that completely ruined the flavors, while the portions of meet(beef) were shockingly small, same as last time. It was impossible to enjoy anything, and most of the food was left uneaten. What made it even worse was the waiter’s attitude. Despite seeing our plates barely touched, he didn’t bother to ask if we liked the food or if anything could be improved. Instead, he was only concerned with getting us to pay and leave. There are plenty of way better Chinese restaurants in that area

site_logo

Andreas Markou . 2024-12-22

MORE AT Google

Gem right across from the Emirates. Noodles are to die for.

site_logo

Jeffrey Lau . 2024-12-14

MORE AT Google

Biang biang noodles were unreal. Loads of chilli oil and super tasty. Street food 'burger' for starters was also very good. Small restaurant with only a few tables so worth getting there early, but can also order for takeaway.

site_logo

Lara Keay . 2024-12-08

MORE AT Google

Ordered the beef noodles and wonton soup for delivery, nothing too special if you're used to Chinese food, it will do.

site_logo

Josephine Choy . 2024-12-07

MORE AT Google

One of my favorite takeaways in London. Their signature hand pulled noodles and their side dish of the brown mushroom/fungus was the perfect cozy meal. I got it delivered, so no experience with the service or atmosphere, but they packed the noodles thoroughly so there wasn't any leakage.

site_logo

Stephanie Hoang . 2024-12-03

MORE AT Google

Honestly love this place for take away, yet to go to the restaurant. Flavors are so tasty. So far I've tried the dumplings, black fungus, biang biang noodles, ho fun and cucumber salad. Their flat noodles are perfection. My only complaint is they could be a bit more generous with the beef as at times it's not been enough protein for a main meal. Also I need to find out the recipe for the dressing of the smashed cucumber.

site_logo

Amanda . 2024-11-27

MORE AT Google

Its my favorite restaurant in the world. Biang biang & cucamber. I can eat that everday

site_logo

Dominika Dekiert (Domi) . 2024-11-27

MORE AT Google

Pig ears, smack cucumber, big pot chicken, their signature beef hand pulled noodles and pot stickers. Tasted as good as it looks. Wheelchair access ♿✔️ - small lip to get in but the place is tiny, with only a few tables but it was accessible enough

site_logo

Sau Tran . 2024-11-23

MORE AT Google

I had the veggie pulled noodles, the Mrs had beef pulled noodles. Both very nice. Side dishes of cucumber, Pak Choi and egg fried rice all pretty standard. I think they exist for the noodles tbh so if you don’t like them go elsewhere. If you know your Chinese food good Xi an food, if you don’t but want to try something a bit different solid option. Got takeaway so not sure about atmosphere but came very quick!

site_logo

michael hill . 2024-11-22

MORE AT Google

Ordered takeaway, portion looks small but very filling, for London prices this is good value for money

site_logo

Vuong Tuan Khai . 2024-11-14

MORE AT Google

Noodles and dumplings are excellent.

site_logo

Sasha Copin . 2024-10-30

MORE AT Google

Very tasty food! The hand pulled noodles were delicious 😋 My only critique would be that there is only one veggie option for the main course. I'm surprised to see that there are no dishes with tofu, maybe it's not traditional for Xi'an cuisine, but in this case it could have used to make veggie/vegan options of traditional dishes.

site_logo

Martin Söderin . 2024-10-28

MORE AT Google

Authentic flavours. Make sure you go with time as you might have to wait to get seated.

site_logo

Karina Duarte . 2024-10-23

MORE AT Google

A now not-so-hidden gem that absolutely slaps every time! I have never been disappointed and would crown Xi'an as my favourite takeaway in London by a good margin. Best on the menu for me is to kick off with the dumplings and the shredded chicken in special sauce and then finish with any of their amazing noodles. Would recommend every day of the week!

site_logo

Alex Shooter . 2024-10-23

MORE AT Google

Absolutely delicious food. Can highly recommend the noodles. Authentic and tasty. Will come again and again!

site_logo

Art Kul . 2024-10-19

MORE AT Google

Best Asian food in the UK. Best noodles I ever had..!

site_logo

Rohit Mitra . 2024-10-19

MORE AT Google

Super yummy, I’d come back for the pig ears alone. I believe they don’t take reservations so it’s best to go at an off-peak time or you may have to queue.

site_logo

Jasmine Lee . 2024-10-16

MORE AT Google

Not the typical Chinese food you are used to. A must try if you happen to be around but definitely worth the travel if you want to come here specifically for this restaurant. Hand pulled noodles are the main protagonist here and they are very flavorful. Can't recommend enough.

site_logo

Stefanakis Adv . 2024-10-11

MORE AT Google

Saw this on the Noodles episode of Chef's Table and never knew what a great place this is, having gone by dozens of times before. Short walk from the tube station. Humble and cosy premises. We had the smashed cucumber salad, black mushrooms, pig ear, pig bun, salt and pepper spare ribs, noodles with chunky beef, ginger chicken, cold noodle salad, pork dumplings and sweet and sour pork. All of it was excellent. Amazing food, filling but not heavy. Beautifully nourishing. We will be back.

site_logo

Isabel W. . 2024-10-09

MORE AT Google

Great food and great value. They need to buy bigger premises as so popular.

site_logo

David Chapple . 2024-10-05

MORE AT Google

Amazing food! Must try the biangbiang noodles and the beef noodle soup! Everything was so tasty

site_logo

sona visavadia . 2024-09-23

MORE AT Google

Xi'an family members, personally tested. The taste remains 80% of Xi'an. It's not easy. recommend.

site_logo

Vanessa QIN . 2024-09-18

MORE AT Google

The braised pork bun is underwhelming, nothing really special, the bun unpleasant doughy, the braised pork can be dry at times. I would get rid of the menu, add another vibrant side salad like the smashed cucumber xxx But always a nice meal and takeaway from here!

site_logo

Lucas gomes . 2024-09-17

MORE AT Google

Amazing hand pulled noodles! We got the spicy veggie and the spicy chicken. Would super recommend.

site_logo

Shilpa Balaji . 2024-09-16

MORE AT Google

Some of the best food in London.

site_logo

SAIA . 2024-09-15

MORE AT Google

Recommend the noodles more than the murgers/roujiamo. Authentic Xian cuisine. The biangbiang noodles, and cold noodles in sesame sauce are very good!

site_logo

Maxwell Chen . 2024-09-15

MORE AT Google

Just had an excellent lunch here. Tasty good-sized portions. Definite find.

site_logo

Rupert Holderness . 2024-09-14

MORE AT Google

The restaurant provides chinese street food. The food was quite tasty and the service was quick and friendly. The restaurant is cozy and nice. I wish there were more vegetarian options though

site_logo

Hasnan Hussain . 2024-09-14

MORE AT Google

Great food, table for 4 peopletook about 30 minutes waiting time at 7:30pm but it was well worth the wait! Amazing flavors, kind staff and well priced BYO

site_logo

Alice W . 2024-09-09

MORE AT Google

Recomendado por compañero de 70 años, taiwanés amigo en sus 30 años e hija / (+ novio) en sus 20 años. V picante. Diferente a la mayoría de los chinos. Lleno de estudiantes chinos entre semana y locales al final

site_logo

David Poyser . 2024-09-08

MORE AT TripAdvisor

Because it was a bit late, I randomly selected a nearby noodle shop. The 12.8-pound bowl of noodles was average in weight. I wonder if it was because I added too much vinegar and it was very sour. In the end, a 12% service charge was charged. My friend was not hungry. After asking if he was eating alone, he took away two plastic bowls and another pair of chopsticks. The only service he received was probably a cup of hot water that his friend asked for. This may be the general level of Chinese food in London! It’s hard to describe in one word.

site_logo

Chen Irene . 2024-08-19

MORE AT Google

One of the staff( tall guy) very rude and aggressive person.should not be handling with driver and customer

site_logo

Yassine Dlalah . 2024-08-16

MORE AT Google

Very rude and aggressive staff.I was pushed out by one of the staff tall young guy.because u step up inside in rain day.after I get the food was broken he give it in a aggressive way after was all packaged and food broken inside.very bad experience I will never pick up from there.

site_logo

Fado Bado . 2024-08-06

MORE AT Google

Delicious!!! Fresh, hand pulled noodles with beef .. 100% recommended!

site_logo

Sara Chemali . 2024-07-31

MORE AT Google

Terrible for vegetarians or pescatarians.

site_logo

Scarlet Mae . 2024-07-30

MORE AT Google

Lovely charming restaurant with powerful food

site_logo

Pietro S . 2024-07-15

MORE AT Google

Deeeelish - particularly recommend the cucumber salad, biang biang noodles and the noodles with beef mince and sesame and chilli sauce! Super quick no fuss no frills service which I appreciate. Bursting with flavour and reasonably priced too!!

site_logo

Alice R . 2024-07-11

MORE AT Google

Have been wanting to try this hole in the wall for a couple months now and it did not disappoint! They don’t do reservations and the restaurant is a bit small, but the food was amazing and the service was great! I absolutely loved their hot and sour soup and the biang biang noodle sauce was unforgettable! Would also recommend their beef ho fun.

site_logo

Katrin P . 2024-07-10

MORE AT Google

One of the best biang biang noodle shops I have had the chance to visit in London. The locale is small but almost always jam-packed and for good reason. The menu is not too extensive but from the dishes that they make none is a miss; Xinjiang Stir Fried Chicken With Bones deserves special attention. Their starters are also very good, I wholeheartedly recommend the black fungus, there is something specially tasty about its dressing. If you are around Islington, you can't pass it!

site_logo

Rafael Carrascosa Marzo . 2024-07-01

MORE AT Google

Ignore reviews saying it's closed - they shut temporarily for refurbishment but have now reopened as of early July. I'm currently living just round the corner and I'm obsessed with this restaurant. I've been to China twice (including Xi'an) and this is my favourite regional Chinese restaurant in London. My go-to dish is the pork noodles with tomato, egg and chilli sauce, but I've visited several times recently and have tried various dishes - all delicious, and good value too. BYOB with reasonable corkage (there's a Co-op right across the street). In summary: go here, go often, and make sure you're hungry!

site_logo

Claire Pettitt . 2024-07-01

MORE AT Google

Closed at 5pm despite times saying open. No answer on phone.

site_logo

Sam Johnson . 2024-06-16

MORE AT Google

Closed at 19:20 Saturday but opening times say open. No answer on phone. Very disappointing. This needs fixing

site_logo

David Miscnx . 2024-06-15

MORE AT Google

This place is really the most disgusting Shaanxi rice I have ever eaten. Not only is the staff low-quality, but the food is really unpalatable. They only give you two noodles for a little over ten pounds.

site_logo

really We . 2024-06-11

MORE AT Google

This restaurant is excellent, each time. They are even mentioned in Ottolenghi’s books because that’s how iconic their recipes are. The Biang Biang noodles are of another world * salivating as I am writing this *

site_logo

Matisse Ciel Pagès . 2024-05-30

MORE AT Google

Delicious authentic Chinese pulled noodles and dumplings!

site_logo

S L . 2024-05-30

MORE AT Google

Small restaurant in front of the Emirates stadium. The restaurant has a handful of tables so can quickly get a good atmosphere feeling with a few seated customers. Food is authentic and excellent chunky thick noodles.

site_logo

Travelling Gillespie . 2024-05-29

MORE AT Google

I feel like this restaurant is not targeting Chinese customers. Maybe their food is only for customers who have never really tasted authentic Xi'an food. If you are looking to taste authentic Xi'an food, please avoid this restaurant.

site_logo

ERIC ZHANG . 2024-05-28

MORE AT Google

The staff has bad attiude. She allocate us in a table that has no space to move around,and behind me is another customer.When i tried to move to the aisle table the lady said to me “go in there”. Never have I ever been so upset in my life. We had to leave the place immediately . I think we had a lucky escape. If you need customers, treat them nicely if you want your business to survive. Start by educating your staff with good customer service.

site_logo

Grace Quinlan . 2024-05-25

MORE AT Google

Absolutely fantastic. This place worth a 5 star comment. Being back in this place after a year and the foods are still flawless.

site_logo

Jiongyan Lei . 2024-05-24

MORE AT Google

AMAZING DUMPLINGS!!! I literally ordered a second portion because it was so good. I came here after my first Arsenal game and what a perfect meal (helped with the pain of the gunners losing the Aston villa game). The servers were nice and did not pressure me even though there was a large rush of people from the game. Thank you!! :)

site_logo

Francesca 5 . 2024-05-11

MORE AT Google

I got Food Poisoning from this place. I will never Return.

site_logo

Tyrell Campbell-Riley . 2024-05-03

MORE AT Google

After living in Xi'an for a while, I now miss the combination of flavours that differs from many other Chinese cuisines. Middle eastern scents of herbs and spices with the use of lamb likely an influence from the western/northern ethnic minorities of China who have ancestors spanning Mongolia and the Middle East. The Altaic fusion with more traditional Chinese hand pulled/cut noodles in clear(ish) broth, xi'an sandwich etc bring me back to my home away from home. Although in Xi'an you can expect the sandwich to be a lot more oily from the street vendors as well as more generously packed with fillings. Even the smell of the place when you walk in reminds me of xi'an, it's only missing the smell of exhaust fumes and rampart use of car horns to make it 100% authentic. It is the closest I've come to the food of xi'an since leaving, and it's a relief to see someone specialise in one area of cuisine rather than trying to do everything. The staff are great and when not busy juggling customers and plates, are warm and enjoy conversing if that's what you want. You should book if you plan to eat from 6pm onwards as it gets very busy. They do takeaway too. Don't expect your English 'Chinese' food here, but if you've been to northern China and miss it, you can come here to reminisce a little.

site_logo

Adam Joseph . 2024-05-02

MORE AT Google

Small “street food” eatery in front of the Arsenal stadium. Just follow where the two guns are pointing! Delicious and authentic spicy Chinese food. Fast service and fast turnover of tables. (40 covers?) I had to wait in the queue on weeknight at 7.30 for about 15 minutes. The cold chicken in chilli oil starter was try to its Chinese name: “mouth watering chicken”. The famous biang biang noodles are messy to eat (one long sheet!) but worth the mess. (Bring a bin.). Plus pot of tea made the bill £28.

site_logo

Quantumlondon . 2024-04-13

MORE AT TripAdvisor

I’m gluten free and this restaurant literally went above and beyond to cater for my needs. I’m so thankful and can’t wait to return. Thank you for having me!

site_logo

Christina OD . 2024-04-12

MORE AT Google

Best noodles I’ve had in London. Go to delivery place for Asian food. The pulled noodles are sensational!

site_logo

Rose Smith . 2024-04-09

MORE AT Google

Delicious food (esp the hand pulled noodles), quick service. They accept cards. No alcohol served but you can BYOB for a small corkage.

site_logo

Beth J . 2024-04-09

MORE AT Google

Best hand-pulled noodles you will ever eat. Must visit for authentic Xian food. Just a shame of the view across the street, COYS.

site_logo

Ingo Schilken . 2024-03-29

MORE AT Google

Authentic Chinese food. Noodles and dumplings were good. Small restaurant with limited space, tables placed very close together.

site_logo

Xyn Xu . 2024-03-25

MORE AT Google

Brilliant food! Highly recommend.

site_logo

Ellen . 2024-03-25

MORE AT Google

Best noodles in London! Been coming here for years, get a lot of delivery as well and this place never fails. The flavours are so unique and I would honestly recommend anything on the menu. My favourite are the veg Bang Bang Noodles, pork and veg dumplings, smacked cucumber and Xian cold noodles. My partner loooves their spicy chicken noodles too. No frills interior with extremely fast service. Friendly staff. Highly recommend this place :)

site_logo

Carson Mathis . 2024-03-10

MORE AT Google

Loooovethe hand pulled noodles! Side cucumbers are nice to go with the spicy noodles. Get the mince pork noodles if you can’t handle spice.

site_logo

Mai Minh Pham . 2024-02-24

MORE AT Google

One of the best places for noodles in London.

site_logo

Jenny Hu . 2024-02-15

MORE AT Google

I love this place. I come here every time that I'm around this area.

site_logo

Paola Sarappa . 2024-02-13

MORE AT Google

Love the food and nice place to eat too very cozy! Love the burger bun too!

site_logo

Yi Kang Choo . 2024-02-11

MORE AT Google

Accidentally ended up here whilst attending an event nearby (I’m based in south London). This is incredible! Probably best Chinese I’ve had in London in a long time. Will definitely come back just for that! Had to queue a little bit, but the staff is very efficient and the food is definitely worth waiting for!!!

site_logo

Angela Maasalu . 2024-02-08

MORE AT Google

I wish there was a sixth star ⭐✨. Best Chinese restaurant I've ever been. A real (hidden) gem in upper Holloway, right next to the Emirates stadium. The black fungi were excellent, and all the noodles served in the restaurant are hand-stretched. Really recommended.

site_logo

Michelangelo Casini . 2024-02-01

MORE AT Google

Very casual place directly opposite the Emirates. We had heard amazing things about here but it wasn’t as great as we had hoped. The noodles lacked flavour and the meat was very fatty. It was still quite good but we wouldn’t rush back unless we were in the area

site_logo

Ellie . 2024-01-28

MORE AT TripAdvisor

The food was absolutely amazing, some of the best East Asian I've had - especially for very reasonable prices. I ordered the biang biang noodles with chilli oil sauce (not broth) which was the best but everything we tried was exceptional.

site_logo

Nia Hurley . 2024-01-26

MORE AT Google

Most amazing biangbiang noodles in chilli sauce (25A), highly recommend!!

site_logo

Sophie VBDK . 2024-01-13

MORE AT Google

This tiny Chinese rest is a small wonder, at the foot of Arsenal stadium—eat-in is tiny & welcoming. The food is EXCELLENT, service too & it’s quick. They deliver too. Give it a try 👍🏻

site_logo

Ann Caird . 2023-12-21

MORE AT Google

Really enjoyed: Beef biang biang noodles, potsticker pork dumplings, pork and veg dumplings. However had a big dud with the Sweet and sour pork, and their steamed rice. Sauce was so sweet it was almost like ketchup, with no acidity to cut through (pork was nice and chewy though) and the rice was a bit dry. There's so many great dishes however that I wouldn't hesitate to come back!

site_logo

Jack Tongeman . 2023-12-17

MORE AT Google

Food was ok, hand pulled noodles are their speciality and it’s not bad and if you lived nearby perhaps you would frequently visit this place but nothing extraordinary or worthy of traveling for. And the service is pretty authentic countryside Chinese 😅🤣 blunt, direct and borderline rudeness 🫣

site_logo

Akira Saito(SBTM) . 2023-12-16

MORE AT Google

Amazing food, this place is my go to for the best Chinese food in London.

site_logo

redpixel7000 . 2023-11-28

MORE AT Google

get the biang biang noodles, one of the most satisfying dishes I’ve had in London

site_logo

e holm . 2023-11-26

MORE AT Google

Fantastic noodle house. More like a mini cafe but worth a visit.

site_logo

Feroze Antia . 2023-11-10

MORE AT Google

The menu is indeed very much like a local restaurant in Shaanxi Province, however, the food wasn’t local enough (I used to live in Xian so I know what I’m saying). Overall it’s pretty good if you’re not chasing the really local Xian food.

site_logo

Xiao Z . 2023-11-10

MORE AT Google

Not sure why this place has so many positive reviews, mediocre Shan xi cuisine, terrible seating and cash only service….pay your taxes!

site_logo

Yassin Ahrazem . 2023-11-04

MORE AT Google

Big fan of this spot, does the best biang biang noodles, and the chilli beef burger is the truth.

site_logo

Trev Evans . 2023-10-31

MORE AT Google

Visited a while back. I had taken a friend there. We got the chicken pot stickers. They came raw unfortunately. That wasn’t nice, but I understand mistakes are made. The worst part was, they still charged us for them, I just thought that was unnecessary and inconsiderate. Sorry for the harsh review but that would do it for anyone I imagine.

site_logo

Athanasios Florea . 2023-10-30

MORE AT Google

Quick service, small and cosy. Tasty well priced authentic food.

site_logo

Gus . 2023-10-26

MORE AT Google

Authentic Xi'an noodle restaurant. Best known for flat bang bang noodles. Sauces were spicy, and slightly vinegary, but very well balanced. Pork ear appetizer was my favourite. The seasoning was great, and the cucumbers gave another depth of texture.

site_logo

Joshua Young . 2023-10-22

MORE AT Google

Wow! All I can say is wow! I ordered hot and sour soup along with X’ian biangbiang noodles with beef - the soup was quite delicious but the noodles were superb! I could tell that they were homemade with high quality ingredients. This is the place to go if you are craving for authentic Chinese food

site_logo

Jen . 2023-10-21

MORE AT Google

Noodles here are super tasty. Nice quick and easy meal that’s right across from the emirates if you’re looking for a pre/post match bite.

site_logo

Grace Cho . 2023-10-12

MORE AT Google

Very tasty food and very friendly staff

site_logo

Paul Taylor . 2023-10-08

MORE AT Google

A real local gem! Highly recommend! Dishes are packed with flavour and the noodles are amazing! Not many options if you don’t eat meat

site_logo

Anya Mo . 2023-10-08

MORE AT Google

Food was really good and so was the service. Loved the atmosphere as well, cozy and homey

site_logo

Alon Peled . 2023-10-02

MORE AT Google

I was with my boyfriend to see an arsenal match (we won!) and then we decided to go and eat at this restaurant. What a nice surprise! The noodles were delicious, as was the beef. I really had a great time there.

site_logo

priya a . 2023-10-01

MORE AT TripAdvisor

heard so many great reviews about this place near arsenal, so went down last thursday. i called to check if we could book but it's walk in only - we went down at 7pm on a thursday and got pretty lucky to get a table for 4 with no wait. i went for beef noodles and the beef burger - really different to any other chinese food i've ever had, but sooo tasty. particularly loved the burger / bun!

site_logo

sam stringer . 2023-10-01

MORE AT Google

I love this restaurant with all of my heart, we go here nearly once a week! The women who work front of house are so lovely and amazing at their jobs. The food is unbelievable, and I think Xi’an Impression is one of the best restaurants in North London.

site_logo

Hanna Weimerskirch . 2023-09-28

MORE AT Google

Had a wonderful lunch last weekend. Beef with the big fat noodles and funghi to start with. All my family have been there and similarly rave. What a spot. I will return!

site_logo

John T . 2023-09-27

MORE AT TripAdvisor

I love this place with all my heart. I accidentally discovered Xi’an Impression on Deliveroo during the first half of the pandemic and I’ve never looked back. I always order the same thing wether I’m in house or at home: the hand pulled noodles (v), the sweet and sour soup (v), the smacked cucumber (v) and occasionally the veggie dumplings and the mushrooms. Considering this is all vegetarian- it’s absolutely divine and it’s my go to on a bad day or sick day. Anytime it’s been a rough day, Xian Impression is there. The food always tastes the same, so hearty and so delicious. It’s more than just food, it is a religion. It is love. It never gets old. It is always there - rain or shine. Bonus: the restaurant is also a BYOB so if you wanna spice up your winner with a decent bottle of something to go with it - anything is possible.

site_logo

Kris Svet . 2023-09-24

MORE AT Google

A wonderful, authentic restaurant. Reasonably priced and delicious. Would recommend to anyone.

site_logo

Adam Tyson . 2023-09-15

MORE AT Google

Xi'an Impression in London is a hidden culinary gem that I stumbled upon by accident during my travels in 2015, and it turned out to be one of the most amazing dining experiences of my life. The restaurant's specialty, Xi'an cuisine, is a delightful departure from the ordinary. The flavors are bold, aromatic, and utterly unforgettable. The hand-pulled noodles, in particular, were a revelation – perfectly chewy and accompanied by rich and flavorful sauces that left my taste buds dancing with joy. What added to the charm of Xi'an Impression was its unassuming and humble setting. It felt like a true neighborhood gem, where the focus was on the food and not on the frills. The staff was warm and welcoming, making me feel like an honored guest. That accidental discovery in 2015 has stayed with me ever since. Xi'an Impression is more than just a restaurant; it's a culinary journey that transports you to the heart of Xi'an. If you find yourself in London and want to embark on a unique and delicious adventure, do yourself a favor and seek out Xi'an Impression. It's a culinary experience you won't soon forget.

site_logo

Alain Mari Alonso . 2023-09-13

MORE AT Google

Always good food. Friendly efficient staff

site_logo

ramah Arabaedh . 2023-09-12

MORE AT Google

Best Xibei cuisine in London, ordered thousand times, never disappointed

site_logo

Tristyn Wen . 2023-09-09

MORE AT Google

Nice but overpriced and small portions. A starter/not main is at least £7/8 but despite the price the portions are small. If you are having a solo dinner and you are hungry or simply want to try 3/4 dishes, you'll pay around £35 without drinks. I have tried better hand pulled noodles: those were quite tick and a bit heavy where normally Chinese hand pulled noodles are really light and thin. The cucumber salad and the pig's ears were tasty but very small portion. The best was the cold Xian rice noodles. I didn't fancy that the service charge was over £5 but, of course, it was discretional. I wouldn't come back soon since the prices but overall a nice experience and staff was kind, especially the older lady with a bob. Thank you.

site_logo

fiorina martucci . 2023-08-28

MORE AT Google

Marvellous. Maybe the nicest Chinese I’ve ever had

site_logo

neilo3333 . 2023-08-27

MORE AT Google

Best Chinese food I've ever eaten. No MSG, thank goodness, and the noodles are long thick and wonderful. Highly recommend but you have to be prepared to wait for a table as you cannot book. Really worth the wait

site_logo

Janine Amar . 2023-08-22

MORE AT Google

Similary restaurants in London

restaurant_img
4.2

148 Opinions

location-icon61 Cowcross St
Chinese
outdoor_seating_87463takeaway_87463delivery_87463

Great fresh hot meals for a good price! People complaining about the price must really not know London prices…

restaurant_img
4.2

903 Opinions

location-icon70-72 Liverpool Road
Chinese
outdoor_seating_86750takeaway_86750delivery_86750

I lived and worked in China for three years and feel I can claim to have a reasonably extensive experience of Chinese food. This restaurant is the first that I have eaten in outside of China that comes close to delicious authentic Chinese cuisine, it is simply brilliant. The premises is modest but correct and the atmosphere nothing extraordinary......but it is the food that is special.

restaurant_img
4.2

708 Opinions

location-icon124 Whitecross St
Chinese
outdoor_seating_112191takeaway_112191delivery_112191

Generally Good. Not cheap but worth it.They cooked the food in their own way but really cooked. Far more better than a lot of restaurants that using factory food or prepared food. So respect them and will pay a visit again.

restaurant_img
4.2

1072 Opinions

location-icon14 City Road, London EC1Y 2AA England
Chinese
outdoor_seating_274050takeaway_274050delivery_274050

Good and authentic flavours, generous and fairly priced portion... lovely service:)

restaurant_img
4.0

5 Opinions

location-icon669 Holloway Road
Chinese
outdoor_seating_121924takeaway_121924delivery_121924

First ever trip to a vegan restaurant it was very nice not the best I've ever had but given it was vegan I didn't feel the need to lie down afterwards so that's definitely a plus. It would help if the menu was more informative - the menu still said 'beef' and 'shrimp' and things like that without explaining what it was which was a bit odd.