GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.1

Based on 1.547 opinions finded in 4 websites

site_photo4

Nº 1630 in 2913 in Edinburgh, City of

Nº 6 of 9 African in Edinburgh, City of

CUSTOMERS TALK ABOUT DISHES WITH..turkeysoupricepepperfishyamchickenmeatfriedspicycoconutgoatmustbeautiful

comment_iconOpinions

Great place - had cow feet, was great

site_logo

François de Tournemire . 2025-04-26

MORE AT Google

Had a gorgeous tilapia with yam chips and plantain as a starter - all super delicious and the server took his time to take us through the menu

site_logo

Leopoldine Parczanny . 2025-04-26

MORE AT Google

Food really nice, but my soup was small unlike before. Don’t know what happened today 😒

site_logo

Vivian Onyeneke . 2025-04-26

MORE AT Google

Great experience Customer service was topnotch

site_logo

comfort jesutofunmi . 2025-04-25

MORE AT Google

The best location for Nigerian meals, You’d struggle to get better foods even at Nigeria… Visited from Belfast.. Absolutely no regrets 10/10

site_logo

Don Mac . 2025-04-25

MORE AT Google

This restaurant was simply amazing, from the food, to the atmosphere, to the service. 3 people shared a platter and it was more than enough. This restaurant is a 10 out of 10 and I highly recommend

site_logo

Favour Edomwande . 2025-04-25

MORE AT Google

Amazing food, lovely staff would highly recommend

site_logo

Flynn Glen . 2025-04-24

MORE AT Google

Great atmosphere, food on point

site_logo

Amada Anderson . 2025-04-24

MORE AT Google

Best Nigerian food ever. So delicious and generous portions.

site_logo

May . 2025-04-24

MORE AT Google

Nice meal. Fast service. I will come here to eat when next I visit Edinburgh. I recommend them to everyone.

site_logo

Asuzu Mezico . 2025-04-24

MORE AT Google

Amazing food and superb service

site_logo

Sara . 2025-04-23

MORE AT Google

Amazing service, worth sitting in!

site_logo

chloe maxwell . 2025-04-23

MORE AT Google

Enjoyed the food, ambience, good music

site_logo

CHIOMA EGBUNIWE . 2025-04-23

MORE AT Google

We tried Nigerian cuisine for the first time and it was a pleasant surprise. The environment is welcoming and the young waiter is kind and available to suggest dishes suited to your taste

site_logo

Andrea Vianello . 2025-04-23

MORE AT Google

The service guy was a good guy, well cultured Indian lad.

site_logo

Marcel Umeh . 2025-04-23

MORE AT Google

As a European, you often can't imagine anything about the dishes. Many dishes were not available or were advised against us by some because they are traditionally eaten by hand or taste special...then apparently only served to Nigerians. Too bad! Overall, the taste was average, the portions were just enough and the price was clearly too high. £30 for a main course + 1 drink per person is clearly too expensive for what you get.

site_logo

Philipp Leue . 2025-04-23

MORE AT Google

Always going to support my people, the vibes are lit 💕

site_logo

Teresa Cutabiala . 2025-04-23

MORE AT Google

Positives: Good atmosphere, really nice and well decorated. Good customer service, friendly and apologetic despite the delay in bringing the food Negatives: Received the order and just like others have mentioned, it was a small portion compared to the price. Also, the sauce had too much oil. Hope they will take feedback and improve in some of the areas

site_logo

Esthy Bakery . 2025-04-22

MORE AT Google

Egussi Soup was fab. one of the best I have had and the goat meat was really tender and sauce was yummy our waiter was so attentive

site_logo

Libby Chambers . 2025-04-22

MORE AT Google

My sister did her engagement party here. The food was good but we paid extra for exclusive dinner, decoration and photography and they messed that up so badly! They’re not ready for events! They should kindly stick to restaurant business and stop deceiving customers!

site_logo

Queeneth Agu . 2025-04-22

MORE AT Google

The customer service was excellent and the poundo yam with eggs I soup was 100% delicious

site_logo

Daodu Oluwaseun . 2025-04-22

MORE AT Google

Simply best african restaurant in town, the customer service by the Indian guy , top notch. Love it.

site_logo

Richard Adetoye . 2025-04-22

MORE AT Google

Awesome experience and great meal. Was here last in 2023 and the first place I visited when I came visiting again. Will always come back anytime I get to visit Edinburgh. 🥰

site_logo

Olaniyi Opeyemi . 2025-04-22

MORE AT Google

Welcoming service, yummy and hot food, good waiters.

site_logo

Orogbade Itunuoluwa . 2025-04-21

MORE AT Google

I mean where else would you go to get great quality food, a. Feel of. Back home with amazing customer service

site_logo

Henry Adebayo . 2025-04-21

MORE AT Google

Great meal with excellent service by the waiter.

site_logo

olamipo abiola . 2025-04-21

MORE AT Google

Chilled party vibes, amazing food and service! Will be coming back. Thank you to our server Aaliyah!

site_logo

Emma Campbell . 2025-04-20

MORE AT Google

Lovely place with amazing food. Alia our server was very attentive

site_logo

Feyisayo Falode . 2025-04-20

MORE AT Google

Lovely Nigerian food, great service

site_logo

Joey Robertson . 2025-04-20

MORE AT Google

I had Meat Banga soup and it was a banger 😍😍😍

site_logo

Omatsuli Mofe . 2025-04-19

MORE AT Google

Efo riro and poundo is spot on. Could have more spice but I guess that is preference. The taste is perfect. Atmosphere is lovely and service is fantastic. This will be my place to visit when I hit Edinburgh now 👌🏼

site_logo

Michaela Tressat . 2025-04-19

MORE AT Google

Food was delicious. E sweet kpa!

site_logo

Omoria I . 2025-04-19

MORE AT Google

Great food, Great service from Ranga, great ambiance and good music❤️❤️ I definitely recommend💯

site_logo

David Oyeniyi . 2025-04-19

MORE AT Google

I had seafood banga and eba. Great food, great customer service. Ranga attended to me and he was amazing.

site_logo

Bolu Sofodun . 2025-04-19

MORE AT Google

Cool place with delicious food. Stand out dishes were the red sauce stew and the jollof (of course).

site_logo

Jim Rouse . 2025-04-19

MORE AT Google

Had a splendid time at Uwagboes Kitchen & Grill, the waiter was so great! Abula was so tasty.

site_logo

njideka obi . 2025-04-18

MORE AT Google

It was a blissful experience. Rangan who attended to us was very helpful and willing assist. His service today was excellent.

site_logo

Kehinde Olorunfemi . 2025-04-18

MORE AT Google

The service was good and the food taste very good also.I will give a 4.9/5

site_logo

mide Jamiu . 2025-04-17

MORE AT Google

Best Nigerian food around! loved the giant Turkey wings and jollof rice. I was not lucky as there was no fufu that day, otherwise will have gotten the 5 stars!

site_logo

Gabriela Leger . 2025-04-17

MORE AT Google

It was a fantastic experiences, will look forward to another experience in future.

site_logo

Usimkah Asuquo . 2025-04-17

MORE AT Google

Really great place, awesome food,the stars of the day were the goat and the chicken wings ,friendly staff and I would definitely recommend this restaurant

site_logo

Denisse Labastie Hours . 2025-04-16

MORE AT Google

Food and service was great. Interesting and deep flavours. Good level of spice. Highly recommend.

site_logo

rafal rzeszut . 2025-04-16

MORE AT Google

Tried Jollof, Turkey and plantain and it’s so delicious. 😋 Nigerians and Ghanaians, this should be your spot! Great customer service too

site_logo

Edna Agyeiwaa Kena . 2025-04-16

MORE AT Google

I have visited Uwagboe's restaurant a few times with my husband. We absolutely love the atmosphere of this place. It has great afrobeat music with delicious nigerian food. My favourite is beef suya, its a must try!! Its especially nice for my husband to get a taste of his own country in this lovely restaurant! All the staff are super friendly and attentive! We always make a point of visiting whenever we are in town! Thank you all for an amazing meal 😁

site_logo

Maria Lucia Fatola . 2025-04-16

MORE AT Google

Had a fantastic experience at this Nigerian restaurant in Edinburgh! The food was absolutely delicious — full of authentic flavour and served in generous portions. The atmosphere was warm and welcoming, with beautiful decor that really added to the overall vibe. Our server was incredibly friendly and accommodating, which made the visit even more enjoyable. Highly recommend for anyone looking to try some tasty Nigerian food!

site_logo

Victoria Fadare . 2025-04-16

MORE AT Google

I visited this beautiful restaurant with my family and we had jollof rice with beef and Abula.The beef served with jollof rice is soft and the best for me...Also,the assorted meat served with the abula is soft and exactly how i like it.Weldone guys,you brought back beautiful memories. From-Aberdeenshire.

site_logo

Popoola Titilayo . 2025-04-15

MORE AT Google

We tried pounda for the first time and it was really delicious!

site_logo

Nathalie Pellicoro . 2025-04-15

MORE AT Google

Food is tasty and a good experience if you’ve never had Nigerian food but a little overpriced in our opinion. We ended up spending 40-50 each for a small starter and a main. Good experience and we would be back if it was a bit less pricey. The waiter was nice but kept coming to check if everything was ok every 5 minutes which we found a little too much

site_logo

Alessandro . 2025-04-14

MORE AT Google

In Edinburgh for the weekend and walked 30 minutes for this jollof, which is hard to come by where I live. It was 100% worth it. Great service and great food!

site_logo

Bobby Bretz . 2025-04-13

MORE AT Google

Everything is on point mostly the delicious meal and Ranga his services is amazing very friendly. I came in for holiday visit with my family and we requested for an nigeria meal and the hostel lady give me the address. I'm very pleased to be here and I will come back again before I travel back to London.

site_logo

Mercy Edet . 2025-04-12

MORE AT Google

Delicious food and great oxtail! Incredible service- Ranga was excellent

site_logo

Ishbel Carson . 2025-04-12

MORE AT Google

Great food and lovely service - Ranga provided quality service and a great experience.my favourite dish was the oxtail.

site_logo

Jacob Babumba . 2025-04-12

MORE AT Google

I had an amazing time here. The service was absolutely amazing, the food was fantastic and the atmosphere was on point. If you are wanting to try something different and are open to new ideas of foods, try this place!

site_logo

John Tolmie . 2025-04-12

MORE AT Google

I really enjoyed myself. Their service was top notch too

site_logo

Daniel Umoren . 2025-04-12

MORE AT Google

Great customer service/staff Food is good and tasty

site_logo

vivian ometere . 2025-04-11

MORE AT Google

Was a great place to be. Food was good plus amazing service rendered by Rangar. Welcoming atmosphere

site_logo

Precious Ijeoma Chibuife . 2025-04-11

MORE AT Google

Looking for authentic african food in Scotland, come down to Uwagboe's Kitchen &Gril. Lovely experience from the server to the food and great ambience. The food was lovely from the starter to the main. I had the fried yam with sauce, Plantain and Abula. And not forgetting the pepper soup. Also, big praise to Ranga for being a great host and server.

site_logo

Motunrayo Oshodi . 2025-04-11

MORE AT Google

First time trying African food, wanted to try the swallows for a long time and I should say I really enjoyed it especially with efo riro if you can handle a bit of spice.

site_logo

Bhuvana Sai Reddy Komaragunta . 2025-04-11

MORE AT Google

First time here and will definitely come back. Food is real home style and very kind , friendly staff. Don't miss it out if you want a good Nigerian food! 👌🏾

site_logo

Sheila . 2025-04-10

MORE AT Google

Ranga, the service guy, was really kind and helpful by always making sure we had everything we needed.

site_logo

Shamina Chowdhury . 2025-04-10

MORE AT Google

Always a banging time at uwagboe’s and food is incredible and so is the service

site_logo

Gemma Lauchlan . 2025-04-10

MORE AT Google

First time trying Jollof rice and so glad I did! Got it with fried beef and plantain, beef was unbelievable. Server was very attentive. Music great as well! Will be back

site_logo

Caroline North . 2025-04-10

MORE AT Google

Great food and service. Will come again!

site_logo

Abz 122 . 2025-04-09

MORE AT Google

Food is fantastic and kudos Ranga excellent service

site_logo

Xleyparnor Xilus . 2025-04-09

MORE AT Google

Wonderful food, chill atmosphere. Everything's marked with gluten free, vegetarian, etc. Highly recommend.

site_logo

Kennedi Blake . 2025-04-08

MORE AT Google

I really enjoyed the service,the food too is tasty and filling. I'll surely recommend any time any day.

site_logo

Smith Damilola . 2025-04-06

MORE AT Google

The service was top notch and the food is yummy

site_logo

Aishat Obiwale . 2025-04-06

MORE AT Google

Very nice and Ranga is awesome in his service. Would like to be back

site_logo

Ogheneovo Wilson Kuku . 2025-04-06

MORE AT Google

Lovely Nigerian food. Ranga was great at his service. Fast Reliable and delicious. Definitely coming back.

site_logo

Oluwamayowa Ajogbeje . 2025-04-05

MORE AT Google

Amazing food and professional service from Ranga, the whole experience was enjoyable, I would definitely recommend

site_logo

Seun Ojuoko . 2025-04-05

MORE AT Google

Great service from Ranga! Had the share platter, food came out in good time and the food was delicious. The vibe of the place is just amazing!

site_logo

Zhané Ojuoko . 2025-04-05

MORE AT Google

I really enjoyed my food and the customer service was top notch. I would love this in Aberdeen too🤗

site_logo

Odogbili Treasure . 2025-04-05

MORE AT Google

Clean, excellent food, service and atmosphere.

site_logo

Olugbenga Duroshola . 2025-04-05

MORE AT Google

Enjoyed the poundo yam and the edikang ikong had to ask for more

site_logo

Blessing Bamigboye . 2025-04-05

MORE AT Google

The atmosphere is so nice, the food is delicious and sumptuous, the customer service is so nice❤️

site_logo

Aka Omodolapo . 2025-04-04

MORE AT Google

The food taste so great and the service was amazing. I’m definitely coming back with my friends

site_logo

Goodness Nene . 2025-04-04

MORE AT Google

Nice and calm atmosphere. Service is topnotch and the meal is very delicious

site_logo

Ayobami Ojo . 2025-04-04

MORE AT Google

I enjoyed my ofada sauce and rice and the customer service from Mr Ranga was so exceptional.

site_logo

Faithful Chibuike . 2025-04-04

MORE AT Google

My first visit from London. The food was lovely, the scenery beautiful, and Ranga was very professional. Thank you for the service! I will be back!😁

site_logo

Olu Balogun . 2025-04-04

MORE AT Google

If you call yourself African and live in Scotland please come to Uwagboes kitchen and grill and get those cravings sorted.The food was over the top that I bought more to take home. Brilliant service clean and tidy. I highly recommend.

site_logo

Tabitha Anastasia . 2025-04-04

MORE AT Google

Amazing service, food was delicious and the portions are super generous - definitely enough to bring extra home with you!!

site_logo

Flamewafflez . 2025-04-04

MORE AT Google

Well organized and mannered. Services was super good. I love it..

site_logo

ojukwu cynthia . 2025-04-04

MORE AT Google

Prompt and polite service. Great music. Delicious food with generous helpings. Great experience 👍

site_logo

Antonia Adeniji . 2025-04-04

MORE AT Google

Delicious food and the service was exceptional! Will be returning when back in Scotland x

site_logo

bisi adeniji . 2025-04-04

MORE AT Google

Delicious food, quick service and warm people

site_logo

Tade Adeniji . 2025-04-04

MORE AT Google

I can’t even walk cause I am too full

site_logo

Sergio Sautoho sepa . 2025-04-03

MORE AT Google

Fantastic food and great service. I highly recommend.

site_logo

Tommy J. Curry . 2025-04-03

MORE AT Google

Good meal and excellent service delivery. Home away from home feelings 😁.

site_logo

Adeyemo Ademayowa . 2025-04-03

MORE AT Google

I had an awesome experience when I dined in. All the food we ordered tasted great. We had fish and assorted pepper soup and edikiakong with Eba and poundo. They were generous with the protein in the soup and the pepper soup. The proteins was soft and tasty. I also ordered via deliveroo, I loved that the food was properly packed to ensure no spillage. Their jollof rice had the proper smoky patty taste, the fish was also very tasty. My partner had their coconut rice and fried rice it also tasted good. We had their moinmoin it was well wrapped in leaves and tasty Their Asun was really flavourful but very hot and spicy. My only complaint is some of the meals had too much oil floating on top like the peppered ponmo, the asun.

site_logo

Abimbola Anjorin . 2025-04-03

MORE AT Google

The food was delicious and the service was quick. I have been craving turkey wings since moving to Edinburgh and finally found the winning combination. The atmosphere is very warm and welcoming.

site_logo

Gwenetta Curry . 2025-04-03

MORE AT Google

Ranga(Chukwudi like we call him) does his job well👌👌Food is supper tasty(You will love it 🥰)

site_logo

tolulope alabi . 2025-03-25

MORE AT Google

The food was nice and exceptional

site_logo

kazeem oluwatoyin . 2025-03-25

MORE AT Google

Great value for money. Excellent service

site_logo

Tamunoene Belema . 2025-03-25

MORE AT Google

Excellent meal and fantastic service.

site_logo

Ashley Ross . 2025-03-23

MORE AT Google

Service was amazing,the food very good.very good and neat environment.I’ll give it a 100%

site_logo

Ateh Bronte . 2025-03-22

MORE AT Google

Hake fish and plantain are delicious and the staff is so nice!

site_logo

Lucia Landa . 2025-03-22

MORE AT Google

Excellent service Good customer service

site_logo

Shyne Pele . 2025-03-22

MORE AT Google

Very good food. Staff were very attentitive and provided good recommendations. Right amount of attention, so the atmosphere was very nice. Looking forward to coming here again! Thanks!

site_logo

Hanming Liang . 2025-03-22

MORE AT Google

Loveed the experience! Never had African food before was awesome service

site_logo

Chongyue Liang . 2025-03-22

MORE AT Google

Amazing staff and table service, good banter and even better food! Loved the food from the turkey wings to the joffol rice to the fish!

site_logo

BEN MCCREE . 2025-03-22

MORE AT Google

Similary restaurants in Edinburgh and Lothian

restaurant_img
3.9

2630 Opinions

location-icon32A Chambers St
African
outdoor_seating_94813takeaway_94813delivery_94813

We visited Nando’s during our trip to Edinburgh, and it was my parents’ first time experiencing it—they absolutely loved it! In fact, they enjoyed it so much that they wanted to come back for dinner a second time. A big shoutout to our server, Ethan, who was fantastic on both visits. My parents were genuinely impressed by his kindness and attentiveness. Thank you, Ethan, and the entire team at Nando’s, for making our experience truly special!

restaurant_img
4.6

149 Opinions

location-icon161 Morrison Street
African
outdoor_seating_321519takeaway_321519delivery_321519

I ordered the banku and tilapia and I was not impressed at all. It is not good value for money. The tilapia was very small for the price. The pepper sauce was nice but I’ll not be buying ever again.

restaurant_img
4.7

1366 Opinions

location-icon3 Lochrin Terrace
African
outdoor_seating_99932takeaway_99932delivery_99932

Absolutely gorgeous food, particularly the specials. Really good portion sizes (so much I ended up taking some home for later!) The staff are very friendly and it’s a great night out

restaurant_img
4.7

147 Opinions

location-icon166 Leith Walk, Edinburgh EH6 5EA Scotland
African
outdoor_seating_245859takeaway_245859delivery_245859

I went for dinner with a friend and was really looking forward to the meal (the reviews seemed great and so did the website and menu). We booked a slot for a la carte menu without realising that if we would like go for the “sharing experience” we should have booked a different time slot (perhaps if this could be better clarified in the website it would have been useful). We were immediately told that changing the slot was not possible as we didn’t have time. We felt rushed during our meal, and although we were finished our main courses within our 1h30 slot, we were not asked for desserts and we were just asked to finish our drinks in the hall because the table was booked for other people…so we felt rushed to pay…Unfortunately I didn’t enjoy the food as I hoped, as I was stressed with the time pressure…

restaurant_img
4.7

1234 Opinions

location-icon6 Chapel Street
African
outdoor_seating_94216takeaway_94216delivery_94216

Great affordable food, & nice staff.