GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.0

Based on 1.348 opinions finded in 3 websites

site_photo4

Nº 916 in 1508 in Islington

Nº 34 of 44 Mediterranean in Islington

CUSTOMERS TALK ABOUT DISHES WITH..puddingcakeladysaladfishchickenpiesteaklamboldolivesroastpotatoescoffeecookedroastspizzaround

comment_iconOpinions

Great service from Kat here. Enjoyed my time very much she’s a great addition to the team! Didn’t eat so can’t comment on the food

site_logo

dilan gohil . 2025-05-04

MORE AT Google

EXQUISITE!!! A place with a unique atmosphere in London, I came on a Friday and it was with a lot of people, the waitresses are full and you can tell that they are professionals, they know how to serve the tables efficiently and quickly without neglecting good service. The wait was a little slow for the food, in fact the waitress apologized for the delay but it was completely worth it since every piece of my plate was a true delight. There were 5 of us, my girlfriend ordered the Bavette Steak and the meat was tender and very tasty. The rest ordered the lamb and the same, exquisite. Same with the steak sandwich. I preferred to order fish, in this case the butterfly mackerel (photo attached) and I felt like I was eating a piece of heaven on earth, a true explosion of flavors, very, very tasty! I had no expectations and it was a great surprise. They have a quite varied menu. They do not deliver a menu but rather they have blackboards throughout the premises with the available dishes written by hand (attached 2nd photo). I would recommend this place with closed eyes ⭐️⭐️⭐️⭐️⭐️

site_logo

Diego Andrés Santana Díaz . 2025-05-02

MORE AT Google

Honestly, overall this is a beautiful pub. The guy with the long hair, receding hairline at the bar ruined the entire experience. He was incredibly rude to me and my pregnant wife despite us being so polite and waiting a while. Tbqh the food was decent, the beers were great but this guy’s attitude was awful. Is it a coincidence that I’m the only brown person at this pub? Not certain. Seriously, the owners need to get involved here lol

site_logo

Imran Pardhan . 2025-04-28

MORE AT Google

I had a vegan pizza with mushrooms and aubergine. The tomato sauce was a little on the salty side for my taste. I couldn't taste the other ingredients...

site_logo

L S . 2025-04-27

MORE AT Google

Had lunch then dinner here a couple of days apart, just before Christmas, and they were two of the best meals I have eaten out in a long time. The sea Bream was plate sized and superb, as was the grilled Haddock with Turmeric Mash. Not at all expensive by London standards, and I am far from being a rich man. Oh, and I should say that if, like me, you are a Coeliac or cannot eat Gluten, then you will find the staff entirely compos mentis. They always have at least one GF choice available, veggie and vegan too. And also importantly a beautiful place, child and dog friendly. Image of Harry Dean Stanton cooked up in photoshop from a Google image not credited, don't worry Smoking is allowed only outside.

site_logo

petrosros . 2025-04-14

MORE AT Google

Great local pub! Good vibes and friendly atmosphere 😊

site_logo

Stanislava Klymova . 2025-04-13

MORE AT Google

Great pub with an excellent choice of beers, lagers and real ales. I especially recommend the East London Brewery Foundation Bitter. Cool and fresh! The Yes IPA is fizzier but another tasty beer from a north London brewery.

site_logo

Jeff D . 2025-04-12

MORE AT Google

Fuimos a almorzar el domingo con la familia 10 de nosotros 2 niños No reservé, me las arreglé para poner 2 mesas juntas en la parte trasera Tenía el pollo asado para 2 y era absolutamente precioso, un montón de patatas asadas, Yorkshire, y verduras frescas y a un precio muy razonable Mi único problema pequeño era un menú infantil limitado Conducía así que tenía 0% lager en el grifo y sabía como lager normal En general, una gran experiencia sin duda volvería de nuevo

site_logo

Gary H . 2025-03-13

MORE AT TripAdvisor

I recently went to Tufnell Park Tavern with a friend for a Sunday roast, and it was exactly what we needed. We sat outside in the sun, which made the whole experience even better. The outdoor area has a relaxed, welcoming vibe — plenty of space and a great spot for people-watching while enjoying a drink. I had the Sunday roast with beef, and it was spot on. The beef was tender and full of flavor, the roast potatoes were perfectly crispy on the outside and soft inside, and the Yorkshire pudding was massive and beautifully crisp. The gravy was rich and delicious, tying it all together. My friend went for a pizza, which looked amazing — thin, crispy crust and topped generously with fresh ingredients. She said it tasted as good as it looked! We both had a couple of pints of Yes! Beer, which was crisp, refreshing, and the perfect match for a sunny afternoon. The service was great too — friendly and attentive without feeling rushed, even though it was busy. Tufnell Park Tavern has such a chilled, welcoming atmosphere — ideal for a lazy Sunday with good food and drinks. Definitely planning to head back soon!

site_logo

Aaron Green . 2025-03-11

MORE AT Google

Great community pub with a friendly and professional team behind the bar, front of house and in the kitchen. Food is great and lovely garden too.

site_logo

Nick Lansman . 2025-03-10

MORE AT Google

Great lunch lovely new Italian beer Menabrea on tap. Italian sausages with polenta and lovely Italian red wine 🍷. Sometimes life can be good 👍

site_logo

Sean . 2025-03-07

MORE AT Google

What a great place. Visited on Sunday and it was very busy and buzzy with families. Lots of colouring in going on. The roasts were very good and my pizza was standout. We took a selection of puddings to share and they were all superb. Especially, the Tiramisu. We were very well looked after by a team member in a black and white stripped top but all the team were friendly and helpful. We live an hour away but this pub is near to our son. For London, we thought it very reasonably priced and cheaper than our local, comparable eateries…..and better quality. Will definitely be back. Recommended!

site_logo

Alan Jones . 2025-03-03

MORE AT Google

The place and atmosphere is nice but the food is not. Edit: we asked for chips and they served us patatas bravas covered in aioli, onion and parsley (without warning that they did not have normal chips). We asked if they had an alternative, they said they had a 'plain version' of the same potatos . We ordered that (for a child) and we got potatoes with onion, parsley and pepper. So order at your own risk.

site_logo

Elisa I . 2025-03-02

MORE AT Google

Great pub with good food. Menu changes monthly

site_logo

Andy Parker . 2025-02-05

MORE AT Google

One of my absolute favourites in the area - the food is incredible!

site_logo

Sheridan Kates . 2025-02-04

MORE AT Google

Really interesting and unique specials. Unlike any pub I’ve been to. They have a wide selection of drinks from all over the Mediterranean, lots of Greek beers, Portuguese wine etc. great ambiance and service was quick.

site_logo

Pazbi Zavatzki . 2025-01-26

MORE AT Google

Warm friendly atmosphere with excellent food and service. Also dog friendly.

site_logo

m welch . 2025-01-18

MORE AT Google

Typical English atmosphere...good service and good food...a good place to have dinner and have a beer with friends...

site_logo

Igor Muratore . 2025-01-16

MORE AT Google

Great atmosphere and food, however the mushroom risotto main at 14.50, while delicious, was the size of a starter and I was still hungry afterwards. Disappointing. I'll stick to pizza in future.

site_logo

Sandra Forrester . 2025-01-12

MORE AT Google

Amazing service really enjoyed my time here and had a brilliantly made negroni

site_logo

Silvia Crofte . 2025-01-09

MORE AT Google

This place is terrible!!! The service is disgraceful such rude staff!! It’s disgusting!! and the food is nasty! Not how it used to be. I would not recommend this place to anyone!!!! Avoid!!!!!

site_logo

Rio’s Pouch . 2025-01-05

MORE AT Google

We go most Sundays - a day off from cooking. Sunday lunch for the family. Usual good. Small variations in menu. The dogs love it. The pizzas are exceptional.

site_logo

Mark Blooman . 2025-01-05

MORE AT Google

Superb pizzas and fabulous beer from Anspach and Hobday including THE IPA..

site_logo

Christian Kusneraitis . 2024-12-31

MORE AT Google

Only pizzas for walk ins then Chorizo pizza !??? feeling sick after 1 hour . sorry you did better before

site_logo

Alexander Hug . 2024-12-15

MORE AT Google

Had the best home meal today the spices were amazing. Service was by zack he was so nice and attentive even as it was busy. Will definitely come back. Top place to visit

site_logo

Omar O'garrow . 2024-12-15

MORE AT Google

For being in a family area with a large restaurant area, it’s odd that they don’t allow children after 7pm. Even worse we were only told an hour after we arrived! Weird.

site_logo

Ramin Movahed . 2024-12-08

MORE AT Google

I recommend the great atmosphere and good food

site_logo

Marcin e . 2024-12-01

MORE AT Google

Came in for a few drinks and was really impressed with the pub. Nice big space with lots of seating some nice food

site_logo

Dhruv Majumdar . 2024-11-28

MORE AT Google

Excellent food and service. The pizzas are a great option and their menu is very unique that offers a lot of options for vegetarians. Great choice of beers. Loved the atmosphere

site_logo

H D . 2024-11-24

MORE AT Google

Just stopped in on one of my walks for a quick pint and was pleasantly surprised 5 real ale taps 5 points best 5 points xpa sambrooks junction redemption fellowship and Twickenham naked ladies lovely range and a good range of keg beers aswell, will definitely be back to try the food as what I saw coming out of the kitchen smelt fantastic and looked great. Another huge plus friendly staff and exceptional toilets. Well done. Cheers Dermot.

site_logo

Dermot Drea . 2024-11-20

MORE AT Google

First time we have had really bad food here and there was a lot wrong with all courses. V Watery pie filling, uncooked rock hard cauliflower curry, dry chocolate cake and the worst cheeseboard I have ever had and definitely not the cheese or olive biscuits advertised. Real shame as the service was excellent and we come a lot but will have to find a new venue. Pub and dining room are so echoey we couldn’t hear each other talk but have always put up with this as food used to be 5 stars.

site_logo

Louise Faith . 2024-11-16

MORE AT Google

Food is food, customer service is despicable, especially the young guy who was wearing a green top, and to be honest evry one one behind the bar is rude as hell, I’m very local and come to this place because of the kids, the sister pub the landseer pub, the staff are amazing and food is even better, long story short stay away from this place unless desperate

site_logo

Intrepid Fox. . 2024-11-16

MORE AT Google

Incredible warm food. Everything they make is great

site_logo

Aly Mokhtar . 2024-11-15

MORE AT Google

Vamos aquí a menudo para el menú de almuerzo de £ 9, que cambia cada día de semana. Es una cocina fantástica y creativa que saca lo mejor de los ingredientes de temporada. Normalmente no podemos resistirnos a comer postre también. Los niños son bienvenidos antes de las 7 pm y por lo general hay mucho espacio en un almuerzo entre semana para un cochecito.

site_logo

Lauren R . 2024-10-30

MORE AT TripAdvisor

Amazing lunch deal, no wonder it's busy on a Monday lunch.

site_logo

Gavin Hudson . 2024-10-29

MORE AT Google

We keep coming back here even now that we no longer live in the area. The food is great - whether you fancy a Sunday roast, or just a nibble, or a pizza. Lots of options for vegetarians. Great options for kids too. Good wine list and lots of beers to choose from. We love the garden in the summer but the dining room is very nice and airy too. There’s something for everyone!

site_logo

Anna P . 2024-10-27

MORE AT Google

Had great pizzas here and a really good space to relax and have an after work drink

site_logo

Miles Donohoe . 2024-10-25

MORE AT Google

Tuvimos un encantador brindis el domingo con la familia todos disfrutamos de la comida mucho el personal era agradable y servicial pub parecía muy agradable después de haber reformado hecho vendrá de nuevo para disfrutar de otra comida agradable.

site_logo

Brenda W . 2024-10-21

MORE AT TripAdvisor

Chicken was lovely and had very tasty herbs. Family/sharing style is a nice touch. Very friendly family atmosphere on a Sunday.

site_logo

Gina Bond . 2024-10-20

MORE AT Google

The staff is very rude (as noted by many customers on TripAdvisor), which is a real shame considering the food and ambiance are fantastic. If I were the manager or owner of that pub, I would have a serious talk with the team.

site_logo

Aurélien R. . 2024-10-18

MORE AT Google

10 minutes waiting, just to have other people being acknowledged and served before us although they just approached the bar. Awful customer service

site_logo

Alessandro D. S. . 2024-10-03

MORE AT Google

El ambiente es tan agradable, el personal del bar tan acogedor. El bar está bien surtido, un montón de asientos dentro. Era una tarde encantadora, así que nos sentamos afuera. Un tiempo encantador y relajado con la familia. Recomendaría este pub a todo el mundo. Está cerca de la estación de metro de Tufnell Park.

site_logo

Lesley M . 2024-09-18

MORE AT TripAdvisor

Good food and excellent service at our local pub, but it was exceptionally loud on a recent Friday evening in September whilst having dinner. We were a party of 4 and could barely understand each other despite sitting in close proximity. The cackling and screeching of diners seated nearby became unbearable. So we left with our ears ringing, and would think twice about having dinner indoors here again. Overall, it didn’t make for a relaxing experience. Not sure what the solution is.

site_logo

E S . 2024-09-14

MORE AT Google

Pizza menu has changed... Weird toppings like lamb, fennel, tuna, ... but no classics, so fine as long as you like "original" pizzas I guess. Not my cup of tea I'm afraid :-/ I miss the chorizo one!

site_logo

Pierre Lecesne . 2024-09-03

MORE AT Google

Solía vivir a la vuelta de la esquina de este pub. Ha sufrido un cambio completo desde que viví allí y es para mejor. El personal del bar es agradable, hay mesas afuera. Hay un buen menú para todos los gustos. El pago es con tarjeta solo que no se acepta efectivo. Este pub tiene un encanto propio.

site_logo

Lesley M . 2024-07-30

MORE AT TripAdvisor

Good pub fayre - some food overpriced. Pizza good value.

site_logo

Theodore Leslie . 2024-07-16

MORE AT Google

We witnessed two members of staff laying out the outside tables. While doing this they allowed a cat onto one of the tables to eat out of the cat bowl. All the while they set up the tables they were going back to stroke the cat. I assume thi is a breach of hygiene standards!

site_logo

5721bluelotus . 2024-07-15

MORE AT TripAdvisor

Good selection of beers, nice atmosphere and tasty menu.

site_logo

Hamish McLay . 2024-07-13

MORE AT Google

One of our favourite spots in Tufnell Park and conveniently located next to the actual park. Possibly the best place to have bravas in London, especially during the summer. And during the winter is quite cozy and you can sit by the fireplace and enjoy a pizza. And if you are lucky, maybe you can have a pork sandwich, which is by far the best item in the menu. Shame that the menu changes constantly. Price-wise is a bit expensive. Definitely do not get table service because that way you avoid paying for the service charge.

site_logo

Alvaro Conesa . 2024-07-11

MORE AT Google

Really nice pub, great atmosphere and food.

site_logo

Rebecca Bairstow . 2024-07-11

MORE AT Google

Loved the space and happy staff but no atmosphere no back ground music just loud chatter from customers food looked great!!! But did not try on this occasion

site_logo

Pamela Berham . 2024-07-04

MORE AT Google

Fantastic food all around and great staff

site_logo

Corey Yeaton . 2024-07-02

MORE AT Google

Nice Atmosphere to have some drinks :)

site_logo

Di Di . 2024-06-24

MORE AT Google

Worst Roast Chicken Dinner I have ever eaten, the chicken was very dry for 37 pound for 1 whole chicken (NOT 2) Do Not Expect 2 as you will get as little as they can possibly give you, save your money and go to a different pub.

site_logo

Lippy Da Lips . 2024-06-23

MORE AT Google

Had a quick informal business meeting here. Great place.

site_logo

Magz Caldwell . 2024-06-17

MORE AT Google

From start to finish we really enjoyed the experience. It was a busy day (Father’s Day) so it was going to stretch most restaurants and when they said the chicken for 2 had just run out I admit we were a bit crestfallen as we were sharing that with our 92 year old mum. But the manager of the pub was fantastic she got us some chicken breasts with vegetables with all the trimmings and it didn’t disappoint. The chef is fantastic the flavours were so good and perfectly cooked. For after the apricot and almond tart was also fantastic. House white wine is also a hit. Thank you for a great meal and special service.

site_logo

DL_Sid . 2024-06-16

MORE AT TripAdvisor

Really lovely food tonight and the staff were great.

site_logo

David Price . 2024-06-08

MORE AT Google

A lovely pub with friends staff. They also had an alcohol free beer on tap which was a pleasant surprise!

site_logo

Lewis Hall . 2024-06-03

MORE AT Google

Great service and good food 👌 Friendly staff and definitely willing to go the extra mile to help older patrons.

site_logo

Julie Palmer . 2024-05-26

MORE AT Google

Arrived just in time to order from the full menu on a Sunday evening (pizzas only after 7). We had a great table on the terrace with friendly and attentive service. The food was delicious: great starters and all four of us had an excellent main including one fantastic pizza; deserts irresistible. One of the best meals we've had recently while travelling across the UK. TPT is a real neighbourhood gem. Thank you!

site_logo

ChrisandJohnny . 2024-05-20

MORE AT TripAdvisor

Great Pub! We ate well, drank good beers and good cider. Good wine list (Picpoul du Pinet on the menu haha!!!) The relaxed and friendly atmosphere. We were there as a family and we loved it

site_logo

Beny Pa . 2024-05-12

MORE AT Google

Been coming here on a weekly basis for 4 years. First just with my partner, then also our dog and now also our daughter. Very few places in London deliver this well on changing seasonal menu’s which are always composed well to include protein, veg, fibre and lots of flavour. The only thing that would greatly improve this pub for us and lots of local residents is if they would allow children until 20:00 instead of only 19:00. The current cutoff for welcoming kids just makes is hard as we often need to hurry to get our orders in or can’t go because we’re not ready for dinner before 18:30 most days.

site_logo

Hugo op den Dries . 2024-04-21

MORE AT Google

Excellent food and a great selection of beers. A good place to relax.

site_logo

Richard Pyke . 2024-04-16

MORE AT Google

Food wasn’t hot then got microwaved!

site_logo

sally romartinez . 2024-04-09

MORE AT Google

Unreal food in this place. Bavette steak is unquestionably the best thing on the menu have it nearly every time.

site_logo

Ramzi Mehana . 2024-04-03

MORE AT Google

Great food. Very nice wine by the glass and the beer also looked good. Pizza is particularly good. Large place, tables inside and out and very child friendly. Highly recommended although not cheap.

site_logo

David Brown . 2024-03-30

MORE AT Google

Visited while staying in the local area Very busy but that didn't hinder the top quality food and service we had . Just excellent possibly one of the best meals we have had during our trip to London

site_logo

Catherine K . 2024-03-22

MORE AT TripAdvisor

Food and service are great but the only downside is that people bring in a lot of dogs

site_logo

Anderson Munoz . 2024-03-19

MORE AT Google

A great warm Tufnell Park Tavern. I would like some music on and the rule with no kids at all allowed after 7 pm make no sense .Other than that ,a great local pub .

site_logo

Chrysa Kouremeti . 2024-03-15

MORE AT Google

This is our local and I couldn't be happier. The food is always on point. The menu is varied with a Mediterranean twist to it but their pizza is always excellent. Service is always very good. Friendly and responsive even when they busy. For lunch with children this is the place to be. No children after 7.30pm but I understand this. All round excellent gastropub and pub in general.

site_logo

Olly Chammas . 2024-03-10

MORE AT Google

Bourgeois boozer nestled in the heart of North London's greatest locale. Prepare for a dim-lit atmosphere, tasty scran and a spacious outdoor offering.

site_logo

Leon J . 2024-03-06

MORE AT Google

Good beer but some of the food was a bit strange especially the soup.

site_logo

Oliver Kitson . 2024-01-26

MORE AT Google

Good selection of dishes for a £9 lunch main. I had the Beef ragu which was tasty!

site_logo

Alex Perez-Davies . 2024-01-23

MORE AT Google

Great spot for a glass of wine and a light meal. Good atmosphere and dog friendly.

site_logo

Guy Sclanders . 2024-01-23

MORE AT Google

always a winner drink lunch or dinner

site_logo

may b . 2024-01-20

MORE AT Google

Good spot for a birthday and large groups of people, local and has quite a homey feel. Nice staff and cosy inside with a fireplace.

site_logo

moe10ify . 2024-01-14

MORE AT Google

I rang to book a table for Sunday lunch. Never been to TPT before but it had been recommended. The woman on the phone was so abrupt and rude I won't bother again.

site_logo

rintintin4 . 2024-01-09

MORE AT TripAdvisor

Really good food all the time . My favourite gastro pub in London .

site_logo

CHRIS LOIZOU . 2023-12-31

MORE AT Google

Great place lovely atmosphere very nice 👌

site_logo

Ken . 2023-12-31

MORE AT Google

decent food at unsurprisingly full prices

site_logo

Julian Turner . 2023-12-18

MORE AT Google

Usually love this place, me and my partner came here for Sunday lunch we ordered two soups and two roast dinners everywhere we have been a starter comes before the main. To our frustration the roasts came before the soups they did offer to put the roasts back but this would of just sat there and wouldn't be nice to eat after as they were out of roast dinners so wouldn't been replaced. The attitude of a particular staff member was shocking I asked for some sauces for our roasts she came and slammed down the condiments I asked for a refund of the soups and seemed to be a big deal I pulled her on why did she slam the sauces she just replied by laughing in my face and eye rolling she was very strange I don't know how she thinks that's appropriate behaviour. No apology. Won't be coming back to shocking service. The food is nice but I'm old school and do believe in good customer service and it's definitely not here.

site_logo

Carly Anne M . 2023-12-10

MORE AT TripAdvisor

Honestly, I’m very sad to write this review. This pub is one of my favourite local spots - the ambience is always great, the beers and wine are interesting and tasty, pizzas are solid… But I went on a busy Friday night, and had such bad service that we decided to try a different spot. After grabbing two seats at the bar my partner asked to see a wine menu. The server responded by pointing to a wall we couldn’t see from our seats, rolling their eyes, and storming off… We both looked at each other and decided we’d rather try a different pub that night.

site_logo

Ally McDonough . 2023-12-02

MORE AT Google

Great menu, good quality wine and nice atmosphere

site_logo

Alec Morrow . 2023-11-30

MORE AT Google

Amazing pub, very spacious for London. Realty good food and service!

site_logo

Gopi Selveswaran . 2023-11-11

MORE AT Google

Great local pub/restaurant. Lovely vibe.

site_logo

Adam Frazer . 2023-11-08

MORE AT Google

Nice space and a big step up from where it was a few years ago. Menu is interesting and the pizzas are decent, but an over reliance on salt does count against it.

site_logo

Nic . 2023-10-23

MORE AT Google

Could dinner on Sundays be extended to 7:30 pm ?

site_logo

Nina Trankovа . 2023-10-23

MORE AT Google

Atmosphere seemed nice. However, the people serving seemed to have forgotten us. After sitting there for 20minutes we decided to leave.

site_logo

Amir Ahmed . 2023-10-15

MORE AT Google

tasty food, and even tastier waitress.

site_logo

John R. Woodward . 2023-10-12

MORE AT Google

Tonight I had the nest pizza I have had outside Italy. Fantastic!

site_logo

David Wilson . 2023-09-30

MORE AT Google

The best sandwich I’ve had in a while (pork bun). Roasted potatoes were also excellent. We sat outside which was a great atmosphere and had a couple pints—good beer selection on tap. This tavern also has a very nice outdoor back patio for longer sit down meals.

site_logo

Blake Cronyn . 2023-09-26

MORE AT Google

Popped into this pub on a whim and it was a solid choice. Lots of beers on a tap and tons of patio space to enjoy a pint on. We also ordered food, the roast pork sandwich and fried potatoes with garlic aioli. Everything was super tasty; although the chimichurri on the sandwich tasted a bit like soap? Service was friendly and quick. Great spot on a sunny afternoon!

site_logo

Arielle . 2023-09-24

MORE AT Google

Lovely pub with good service and pizza. A few GF beer options and knowledgeable staff.

site_logo

Harry Atters . 2023-09-24

MORE AT Google

Great neighbourhood pub with an extensive food menu and decent pizzas. Lovely large outdoor terraces front and back . Does get busy on evenings and weekends but it's a large venue so doesn't feel packed.. Has a sensible policy of children under 12 after 7pm .

site_logo

Andrew S . 2023-09-13

MORE AT Google

Stopped for a drink on a hot summer day, good hidden terrace at the back but staff don't seem very happy

site_logo

Bruno Zukovskis . 2023-09-13

MORE AT Google

Came here for a Sunday roast which was served incredibly fast and was delicious. Sat out back which had a nice calm Sunday atmosphere. Staff were very attentive and friendly. Little bit pricey but I think that's all roasts in London!

site_logo

Jessica Guy . 2023-09-12

MORE AT Google

Great pub with heaps of outdoor space and great options on tap. Staff are always friendly

site_logo

Adi Rothman Berman . 2023-09-07

MORE AT Google

Went for some spontaneous dinner last night. I’ve lived in the area for 4 years and walked past and was always like “yeah looks okay” but never went in.. then we discovered the awesome hidden terrace area! It was beautiful! We were server by Milo who was lovely, and the food choices were delicious. Excellent vegan and veggie options. I had the chickpea & cauliflower and the broth it came in was well flavoured. Finished off with some red wine which was reasonably priced.. I think you can tell by now I’m a converted fan?? Haha. I’ll be back soon!!

site_logo

Shannon Giles . 2023-09-05

MORE AT Google

We totally enjoy going to this pub. Such a friendly atmosphere, great beers, and the pizzas are brilliant!

site_logo

Eileen McDonagh . 2023-09-03

MORE AT Google

Nice spot for a pint and decent pizza

site_logo

M . 2023-08-29

MORE AT Google

Similary restaurants in London

restaurant_img
4.0

26 Opinions

location-icon113 Upper Street
Mediterranean
outdoor_seating_113289takeaway_113289delivery_113289

Encantador descubrimiento. Sin licencia de licor, pero compre en el camino vendiendo vino. La comida y el personal eran animados. Tuvimos un cambio radical ya que asistíamos a un teatro cercano. Fueron totalmente comprensibles. Las opciones de Meze fueron buenas. Lo único de lo que no estaba muy seguro era de la ensalada Halumi ya que el queso estaba frito en vez de a la parrilla. Pero todo lo demás estaba bien. Fueron muy serviciales allí. Sin duda volveremos de nuevo cuando tenga más tiempo en mis manos para poder saborear y disfrutar más. El corcho también era muy razonable.

restaurant_img
4.1

5984 Opinions

location-icon287 Upper Street, Islington
Mediterranean
outdoor_seating_128982takeaway_128982delivery_128982

Ottolenghi experience: wonderful. Very simply furnished yet cozy. Delicious shakshuka

restaurant_img
3.8

1398 Opinions

location-icon159 Farringdon Rd
Mediterranean
outdoor_seating_72041takeaway_72041delivery_72041

Updated April 2025. Still great food, beer and wine. Thanks to the team at The Eagle. Friendly, busy pub. Food is simple but delicious and fresh, with a short menu that changes frequently. Highly recommend.

restaurant_img
4.2

1997 Opinions

location-icon6 Esther Anne Place Islington, London N1 1WL England
Mediterranean
outdoor_seating_258755takeaway_258755delivery_258755

Went for brunch on a bank holiday Monday. No wait for a table and staff were all very pleasant. The beans with the Megan’s breakfast were lovely, as was the toast which was nice bread, and the iced matcha and smoothie we had were nice. On the downside, the wait for food was around 40 minutes, and unfortunately the sausage with the Megan’s breakfast special was extremely charred on the outside and overcooked, bacon was similarly overdone and both came out barely warm. Eggs had been cooked in oil or the bacon grease and were very oily and had an unpleasant taste to them. Very child friendly restaurant which I expect would be great for families but we found quite overwhelmingly noisy. Overall we won’t return as the food wasn’t good and the atmosphere and long wait for food left quite a bit to be desired.

restaurant_img
3.7

1219 Opinions

location-icon1 - 3 Crouch Hill
Mediterranean
outdoor_seating_77792takeaway_77792delivery_77792

I have been here a few times, previously for birthday parties and dinners with friends. The staff are friendly and the space is so big which is amazing in London but the food has always below average. The last time I ate there I got the worst food poisoning of my life, threw up 10 times between eating there around 5:30 and waking up the next day and continued being nauseous for multiple days. Steer clear of the cod sandwich.