GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.3

Based on 3.888 opinions finded in 4 websites

site_photo4

Nº 228 in 877 in Brent

Nº 27 of 83 Indian in Brent

CUSTOMERS TALK ABOUT DISHES WITH..garlictandoorimustoldbutterprawnschickenchillimeatpayfriedricelambspicychopscurrycookedfish

comment_iconOpinions

Great food, loved all of it and a really good vegan menu. Staff are really attentive and it made a really good experience.

site_logo

DaveRedDog . 2025-04-28

MORE AT TripAdvisor

Amazing quality of food and great price.

site_logo

Arti Tailor . 2025-04-24

MORE AT Google

Heard all the great things about this place and it did not disappoint. Would go back for sure.

site_logo

James D . 2025-04-23

MORE AT Google

Truly a top tier venue for a birthday celebration - excellent staff who consistently accommodated a dairy allergy, the food was delicious, and the atmosphere was lively while not overwhelming or excessively loud.

site_logo

Joey Solomon . 2025-04-22

MORE AT Google

Last night, we celebrated my son’s 18th birthday with family & friends at The Regency Club. The food was great - and spicy - but it was the service that stood out. Our waiter, Kamal, was outstanding!! We had 4 people with a dairy / milk allergy and he guided us on ordering and checked everything was dairy-free. Every dish was delicious and we all had an amazing time. Thank you and we will be back!!

site_logo

Lisa Penn . 2025-04-22

MORE AT Google

Food is amazing testey. Very good service.

site_logo

BHARAT JOSHI . 2025-04-21

MORE AT Google

Regency Club: A Feast of Flavour Regency Club delivers an unforgettable vegetarian dining experience with rich, authentic Indian flavors. Their vegetable biryani is fragrant and perfectly spiced, packed with tender vegetables and aromatic basmati rice. The vegetarian curries showcase bold flavors, each offering a unique balance of warmth and spice. The garlic naan bread is freshly baked, soft yet crisp, making it the perfect companion to soak up every delicious sauce. The welcoming atmosphere and attentive service elevate the experience, ensuring every dish is served with care and precision. Whether you’re seeking comforting classics or vibrant new flavors, Regency Club delivers on quality and authenticity. A must-visit for Indian food lovers!

site_logo

Tomislav Maric . 2025-04-21

MORE AT Google

Food is so tasty, and not too spicy. We really enjoy the food. 😍😍❤️❤️

site_logo

Kalpana Joshi . 2025-04-21

MORE AT Google

One of my favourite restaurants to go to! The atmosphere was buzzing, super lively but still comfortable, and the staff made us feel really welcome from the moment we walked in. Now the food—honestly incredible. We started with the garlic mogo, which was perfectly crispy with just the right kick of heat. The mixed grill was massive and full of flavor—every bite of the chicken tikka and kebabs was on point. I also tried the lamb naan (a must!) and it might be my new favorite thing. Everything just tasted fresh and full of flavor. They’ve also got their own house beer, which paired really well with the food—not too heavy, just crisp and refreshing. Overall, such a good experience. Great vibe, amazing food, and solid service. Definitely coming back soon.

site_logo

Akash . 2025-04-21

MORE AT Google

Love the food, specially lady finger is the best.

site_logo

Giu Lia . 2025-04-20

MORE AT Google

Love the new refurb, the food is amazing hidden gem worth checking out.

site_logo

Vikash K . 2025-04-19

MORE AT Google

Positive: know this place run nicely from last 25-30 years by same person. Always good vibe & good to see busy places like this. I won’t say myself regular customer but had food 3-4 times before. Negative: I would say service would have been lot better but this is the first time we had a bit bad experience with food. Chicken lollipop arrived cold inside. We return them back & no issue created by either side. Rest starter good & mains good as well. Overall my thinking: This place carries legacy of so many years. First time I felt in my 3-4 visit that there is nothing special. This is my opinion & I might be wrong.

site_logo

Nilesh Patel . 2025-04-15

MORE AT Google

Top notch place. You want a full Indian grill come here!

site_logo

Anil “DJ UNKNOWN” Vaghela . 2025-04-12

MORE AT Google

Best restaurant ever. I always order from them whether that be takeaway or on uber. Food is always amazing and they always make the butter chicken splendid. Would proudly recommend

site_logo

Sonia Ali . 2025-04-11

MORE AT Google

Amazing Indian food! Excellent service!

site_logo

Ashish Naran . 2025-04-11

MORE AT Google

What a gem. Amazing experience.

site_logo

Shannon . 2025-04-10

MORE AT Google

Food and service was excellent, Manchurian chicken curry was so flavourful, garlic fries were incredibly tasty and so crisp! Garlic naan of course was fresh and the portions were so big! Visiting from Birmingham to London I wasn’t expecting such good value for money, for me the chilli chicken didn’t have much flavour so I wouldn’t get that again. But overall it was top notch, will be bringing the family here soon! Wish it wasnt a 2 hour drive or I’d be a regular!

site_logo

Amandeep Sangha . 2025-04-10

MORE AT Google

Love the curries from this restaurant.

site_logo

K Charles . 2025-04-07

MORE AT Google

Amazing👏 Mogo chops Lamb Masala Thanks ebrahim for guiding me

site_logo

Saadeldin Hassnein . 2025-04-06

MORE AT Google

Always the best Indian food. Good service from Rahul.

site_logo

dipan shah . 2025-04-06

MORE AT Google

Been to the regency a couple of times and it’s delivered every time. The venue is smart and the food and drinks are great but what makes it memorable is the service always polite and on hand they are very good at what they do. Many thanks for looking after us

site_logo

Alexandros Korasanis . 2025-04-06

MORE AT Google

Our friends recommended this restaurant, so a group of us came all the way from central London. It didn’t disappoint. Everyone thought the chicken wing starter was amazing. The portion was good, we all left with a full stomach.

site_logo

William W . 2025-04-06

MORE AT Google

Mind blowingly brilliant! Brilliant place.full of patrons enjoying food and drinks. The food is incredible! I had the zeera chicken (cumin) and butter chicken and it was delicious. Service is fast and staff are polite with a large screen for viewing cricket.

site_logo

Vik . 2025-04-06

MORE AT Google

I went to The Regency Club with some friends to celebrate one of the group retiring. The staff were friendly, knowledgeable and provided great service throughout. The food was excellent and the mix platter for starters was superb. All the dishes were well cooked and the meat of good quality. We had a couple of main dishes including the lamb and chicken biriyanis, absolutely lovely. There is a fantastic range of drinks and I can recommend the Tusker beer, light, refreshing and didn't bloat you out. I would definitely recommend and will visit again.

site_logo

Paul D . 2025-04-06

MORE AT TripAdvisor

Local go to for many customers for so many years. It’s always busy but not worth the hype. There was no wow factor to any of the dishes apart from the lamb kebabs and the tilapia fish. I found it average and over priced. The customer service was amazing but I wouldn’t go back in a hurry.

site_logo

Priti Patel . 2025-04-03

MORE AT Google

The food is great as usual. Fantastic staff always helpful. Evryone in the group loved the food especially their starters.

site_logo

Bapan Roy . 2025-04-03

MORE AT Google

I made a reservation at Regency Restaurant for Mother's Day, hoping for a special and relaxed meal. While the food itself was quite good, the service was incredibly rushed. Despite being within the timeframe of our booking, we felt pressured to finish our meal quickly and were essentially ushered off the table by Pankaj and our waiter. I communicated to Pankaj there was alot of empty tables around us and that there was no need to be standing over us. They then started putting new plates near us for the next seating. This completely ruined the experience and made for a very stressful Mother's Day. I have been a loyal customer to this restaurant for many years. However, this has happened on our last two visits.

site_logo

Hiran P . 2025-04-01

MORE AT Google

Fantastic service, atmosphere and quality/size of dishes. Attentive and polite waiting staff all around.

site_logo

Chris . 2025-03-30

MORE AT Google

Best Indian restaurant, great atmosphere. Staff are amazing.. Great value for money. Just wish it was closer to me.

site_logo

Cyrus Talati . 2025-03-29

MORE AT Google

Excellent service from Ash, amazing food and great atmosphere. Great variety of food and just really authentic flavours. Will definitely visit again.

site_logo

Kilo56 . 2025-03-28

MORE AT TripAdvisor

2025 - still excelent Updated Sept 2021- Amazing classic indian dishes with links to kenyan tastes. Finally re-opened for lunch time post covid. Plenty of veg and non veg options available. New vegan menu also available. Very popular spot so can get busy especially weekends. Would reccomend booking in advance. Best veg burger in town for sure. Best paneer butter masala in town.

site_logo

Priyen . 2025-03-28

MORE AT Google

Went for dinner with friends - from the start. Waiter made it known that we need to be out by 8 From that point it was just down hill Did not enjoy the food - sadly - money oriented concept. Like a production line - it will be a long time before for I even think of going to regency

site_logo

kiran Vyas . 2025-03-28

MORE AT Google

Very busy. One of the best lamb chops i have had. Service was very polite and reasonably attentive.

site_logo

Hamid Afshar . 2025-03-27

MORE AT Google

Best food in the area, and I really like the warmth and friendliness of the staff. Feel like I’m a part of the family whenever I go!

site_logo

Panayiotis Koizi . 2025-03-24

MORE AT Google

initially was told they could cater for gluten free and veggie. noticed they had an extensive gluten free menu but when i got there was told it was still cooked in the same fryers as gluten and therefore there’s a cross contamination risk. technically they cannot claim for any of that food to be gluten free, and therefore have falsely advertised. despite this, they assured they could make my curries entirely gluten free yet i’ve gotten home not even two hours later and am insanely unwell. i’m having a full reaction and am very disappointed given we spent over £500 here on food for a family meal. would not recommend if you suffer with dietary requirements.

site_logo

zara . 2025-03-23

MORE AT Google

Terrible experience when i visited them in my last visit to London . Shocked with how greedy this establishment is . On entering they mentioned that we have the table only for two hours - which we accepted . However , midway in our meal their waiter started pestering us to order more and only about 40 mins in , started hovering around telling us we need to finish our meal quickly . This guy and his manager ( mr pankaj ) - their greed to rotate the tables as quickly as possible was centre stage . Disgusting to see how these guys give a bad name to Indian origin ( myself being one ) ppl and establishments .

site_logo

Bobby Bazaz . 2025-03-23

MORE AT Google

Wow what can I say, best Indian food I've had in my life, sensational. Great atmosphere giving pub/restaurant vibes, good selection of drinks with the cricket playing. Guinness is served, £5.20, outstanding price for London. Would heavily recommend the lamb, and the Tilapia, so delicious, the paneer was amazing as well, wasn't any dishes I didn't like, but these were the stand outs! Service was fast and friendly, right by the tube station, what more could you ask for ?

site_logo

Daniel . 2025-03-23

MORE AT Google

Regency Club has a buzzing pub-style atmosphere with some seriously good Indian food. It’s lively, casual, and always busy — the kind of place that feels like a local favourite. The dishes are full of flavour and well cooked, especially the grills and classic curries. Service is efficient and friendly, and the place runs like a well-oiled machine even when packed. However, some of the prices do feel a bit exaggerated, especially for what is essentially a casual pub-restaurant setting. A few dishes seem a little overpriced compared to similar spots. Still, it’s a great place to enjoy quality Indian food with friends or family — just be prepared to spend a bit more than you might expect for the vibe

site_logo

G B . 2025-03-23

MORE AT Google

Never allowed to enjoy your meal in peace by staff. Always rush you out the door and tell you it's time to leave.

site_logo

Vivek Govind . 2025-03-23

MORE AT Google

Love it here my favourite go to for Indian cuisine highly highly recommended

site_logo

Mark Warren . 2025-03-22

MORE AT Google

It's a nice Asian pub with nice food Wings is a must

site_logo

Mr Perfect 007 . 2025-03-21

MORE AT Google

Absolutely delicious food you can find nowhere else

site_logo

Futureproofer . 2025-03-20

MORE AT Google

food is amazing at the same service was so rude especially guy who is at the enternce PANKAJ so rude while communicating no sense.

site_logo

yash Shah . 2025-03-18

MORE AT Google

Got the mixed grill, wings, garlic naan and pilau rice 11/10 everything!! I will definitely be back⭐️⭐️⭐️⭐️⭐️

site_logo

Miriam Ezinne . 2025-03-17

MORE AT Google

Respected Navin bhai & Rahul - Regency Family . Continued success & blessings on the anniversary of regency . As always the best -service - ambience- professional excellence - food - special attention to detail. 👏🎉 Anil M Pandya

site_logo

Anil Pandya . 2025-03-16

MORE AT Google

Food was prepared and not cooked to order. Service very rushed so they can get more customers but we would have spent more if we were left to enjoy the food etc. Very noisy and had to talk very loudly to make conversation. Please less is more.

site_logo

Jitendra Shah . 2025-03-15

MORE AT Google

I came to this place after seeing a TikTok review of it. To be honest we really loved the food as it was so flavourful and of good quality. I loved tge fact that their kitchen was central and open so you coukd see how clean and organised it was. Very reasonably prices. Will surely be going regularly.

site_logo

Mahmoud Makki . 2025-03-15

MORE AT Google

This is an amazing place for Indian food! Great customer service and excellent food.

site_logo

Simran Sakaria . 2025-03-15

MORE AT Google

This place is insanely good. Recommend: Lamb chops, Chilli Paneer, Egg curry and Crispy Bhindi. The German style Wheat Beer is also good.

site_logo

Suresh Kerai . 2025-03-14

MORE AT Google

Best food and even better customer service! Highly recommend!

site_logo

Isa Mya . 2025-03-12

MORE AT Google

The food is pretty ok. Absolutely loved the Okra fry and the Rogan Gosht was nice. Pista kulfi is definitely recommended. The music was very loud. And because of that the customers are pretty mush shouting at each other..so the place sounds like a concert hall. My girlfriend definitely wants to go back just for the Okra fry and kulfi. But that's it.

site_logo

Colin S . 2025-03-09

MORE AT Google

The food is incredible. I had the regency kebabs and they were perfectly cooked and delicious. The lamb curry was also absolutely superb. The portions are huge and the balance of flavours sublime. Be warned, though that hot means hot here! Service was incredible. Our waiter was so helpful and couldn't do enough for us. The place was packed and the atmosphere was great, has a really nice and friendly vibe. Can't recommend the Regency Club enough. Had not one complaint.

site_logo

Alonzo Harris . 2025-03-09

MORE AT Google

Was great to meet Rahul. Food was brilliant as always. Always a pleasure to come along - now the wife is on my case to come with her!!

site_logo

Amit Sindha . 2025-03-08

MORE AT Google

Upon arrival Greeted by the ever welcoming doorman. Offered a table and explained how long we could have it. The restaurant was busy. Tables are cramped to get more customers. I ordered an aloo methi and immediately the waiter referred back to my last tripadvisor review I can only imagine. He said rather aggressively “too hot for you you don’t like hot curry” well I was flattered to be remembered but I don’t expect this from a waiter. I laughed it off. I asked if a spoonful of dhall could be added as I really wanted Bombay aloo and and other restaurants always oblige with a teaspoon of lentil. He was quite sharp in his reply “NO” he replied abruptly. Anyway my curry arrived and it was oily and still too spicy hot. I have eaten curry for 50 years and eaten aloo in all its different forms. This was not a dining experience and to be honest the waiter was rude. This is a local restaurant but there are plenty of others nearby. Oh and they don’t serve poppadams with the pickle tray. They plonk that awful Plastic bottle of mint sauce on the table. Sorry to say won’t be returning

site_logo

Netteflondon . 2025-03-05

MORE AT TripAdvisor

Lovely place for lunch, dinner and drinks. I popped in here for the vegan options and was pleasantly happy with protein options. Haven't had plant based lamb before and was happy with the dish. The menu is clearly labelled and the staff are knowledgeable.

site_logo

Neil T . 2025-03-03

MORE AT Google

One of the most authentic Indian restaurants I’ve been to “ever” and that’s saying a lot, I’m a food lover, been to thousands of different restaurants. The Regency Club is a unicorn, one of those finds, where the food blows your socks off. The flavours were incredible, just enough spice to give you a kick not not to blow your head off. The Lamb Chops were unbelievable, my friends all want to come back asap. Quick tip - connect to the WiFi and join their loyalty and grab yourself their loyalty wallet and a free drink ++ get those loyalty points collected for your next visit. And lastly the staff were superb, always there if you needed anything - super quick to get you drinks and they had a QR code if you wanted to quickly place a drinks order too!

site_logo

Adam Forman . 2025-02-25

MORE AT Google

Always very good for food, service and ambience. Didn't disappoint, lamb chops were the best i have had in a while and beer was great and service from the waiters was faultless. keep it up ! We also had garlic butter chicken, garlic moga , sheekh kebabs and few other meat dishes.

site_logo

JUPPAL74 . 2025-02-25

MORE AT TripAdvisor

This place is brilliant! Staff so attentive and food delicious! Will definitely be returning!

site_logo

Kat Young . 2025-02-23

MORE AT Google

Went there again for the 100th time 🤭 and I was not disappointed. This is the original Indian gastro pub/club in UK. Food is exceptional as is the attentive service. Always so busy due to its ambiance and delicious food, that you don’t mind waiting sometimes. This restaurant has for many years, set the bench mark which many restaurants find hard to uphold. Regency have never let me down. Well done guys 👏

site_logo

Hitesh Visavadia . 2025-02-22

MORE AT Google

Great atmosphere with a bar and lovely food freshly made to order. The food is outstanding and amazing with taste like no other place unique to it's self with a blend of spices and flavours to suit all.

site_logo

C . 2025-02-22

MORE AT Google

Used to be more personal and authentic…has become a bit too much about getting people in and out and prices have gone up a fair bit since the old days, but still a good night out with decent food and plenty of variety.

site_logo

Sukh H . 2025-02-22

MORE AT Google

Best Indian restaurant in the world

site_logo

Jason Meadows . 2025-02-20

MORE AT Google

One of the bests Indian restaurants I have ever tried! Service is really good and food is absolutely delicious! I take family and friends every time they come to visit! Went last week and ordered the slow cooked lamb to share? It was amazing!

site_logo

Ignacio Martin . 2025-02-20

MORE AT Google

Shame everythings halal. I have many friends who would like to try the meats but cant because you only cater for a ppl who eat halal. Theres already so many halal places, you should have the option to serve both meats depending on customer needs. Most good restaurants serve both meats, and dont ignore customer requests. There's plenty of non halal butchers in West London too, so dont use that as an excuse.

site_logo

D Singh . 2025-02-16

MORE AT Google

Really great place for some proper authentic spice. Staff and service very welcoming and can't do enough for you. I'll be back again for sure! 🔥⭐⭐⭐⭐⭐🔥

site_logo

Peter Flewitt . 2025-02-15

MORE AT Google

Great, friendly service from everyone, and equally great food. We can’t wait to come again! Thank you

site_logo

David Jacobs . 2025-02-15

MORE AT Google

Best tasting lamb chops so juicy and flavourful, tandoori wings are fire too🔥🔥

site_logo

Nyal . 2025-02-12

MORE AT Google

Consistent in providing excellent food and service

site_logo

Sunil Odedra . 2025-02-12

MORE AT Google

12 of us went there, not the first time. We love the place for group meetings. Food can be spicy, but that's why we go there.

site_logo

Hilarass Kazlauskas . 2025-02-09

MORE AT Google

Food, service, and ambience was absolutely 💯 👌. Parking wasn't a problem. Must book else expect to wait which wasn't bad as the bar had ample choice of drinks. Will definitely come back.

site_logo

Vekesh Bhoola . 2025-02-02

MORE AT Google

Excellent Indian food experience

site_logo

Pravin Aracchande . 2025-02-02

MORE AT Google

Always the 1st place we think of for proper Indian delicacies. (Albeit with east african influence). Been going here since the early 90's and they keep getting better and better. Well done!!

site_logo

Rakesh Patel . 2025-01-22

MORE AT Google

Kamal & John have both take good care of us. It’s my second time here,will definitely recommend. Well done to the owner too,place is well organised with everything.

site_logo

Peiris Asoka . 2025-01-19

MORE AT Google

Received a very standard response after my review of 7 years!! This was a birthday celebration in Dec 2018 Has the management changed? Very crowded, food below average, and not disabled friendly. Venue needs updating.

site_logo

Suketu Sudra . 2025-01-18

MORE AT Google

Tasty food served in cramped surroundings. Food orders can get mixed up & if ordered egg bhurji , make sure that there are no egg shells left inside the preparation by kitchen staff! Parking can be a problem.

site_logo

Nirvana Dutt . 2025-01-17

MORE AT Google

being honest food was below average.

site_logo

Nawaz Meo . 2025-01-17

MORE AT Google

Over rated restaurant, Travel 1.5 hours to try food with 5 other friends and all felt rough after eating food. Entirely waste of money and time. Staff was nice though

site_logo

Khawaja Awais . 2025-01-17

MORE AT Google

Tasty food served in cramped surroundings. Food orders can get mixed up & if ordered egg bhurji , make sure that there are no egg shells left inside the preparation by kitchen staff! Parking can be a problem.

site_logo

Nirvana D . 2025-01-17

MORE AT TripAdvisor

6 years later, a response asking for my concerns. Stopped going there after it became a factory line, serving a school canteen with timed seating.

site_logo

John Beet . 2025-01-17

MORE AT Google

Food always on point, one of the best Indian restaurants around! Service was slightly slower than usual, however the food more than makes up for it. Cutlets and karahi chicken are my faves.

site_logo

Sanj . 2025-01-15

MORE AT Google

Great food and service. Regency doesn't disappoint. Was a little noisy and had to raise our voices to hear each other but all in all had a very nice evening.

site_logo

Dilip Patel . 2025-01-13

MORE AT Google

As per usual, the Regency hits number one with its service, ambieance, staff & its food, nothing is closer, nothing with ever top Regency ❤

site_logo

Jayesh Patel . 2025-01-12

MORE AT Google

Always great food, lovely staff & fantastic atmosphere.

site_logo

Jayesh Patel . 2025-01-12

MORE AT Google

What's not to love! Fab food and good size portions, been a while and did not disappoint

site_logo

Hema Clarke . 2025-01-06

MORE AT Google

Been coming here for years food is always on point

site_logo

Avi Ruparelia . 2024-12-31

MORE AT Google

“Exquisite dining experience! Flawless service, beautifully plated dishes, and flavors that amaze. The ambiance is elegant yet welcoming. A true culinary masterpiece—worth every penny. Can’t wait to return!”

site_logo

Mayalcito Bhalala . 2024-12-30

MORE AT Google

Excellent food always first class

site_logo

Siobhan Nelly . 2024-12-28

MORE AT Google

The service from the team was excellent. Pankaj is a mainstay and it’s great to see him and the team still providing fantastic service after 30+ years! Highly recommend

site_logo

Hemant Patel . 2024-12-28

MORE AT Google

Ordered a leg of lamb for Christmas day, normally the standard of food is very good but on this occasion very disappointed. It was meant to be medium spice but at best very mild and the cooking instructions quite poor. Real shame as expectations were high but did not deliver....

site_logo

nimesh patel . 2024-12-27

MORE AT Google

Food is amazing but under 18 not allowed so restricts our visit to the place as we have young kid

site_logo

D S . 2024-12-27

MORE AT Google

We went there for a end of year celebrations and we weren't disappointed. Great place to have a get together with colleagues and friends. Food: first class. Lots of choices for both meat and vegetarian alike. You’ll be spolit as my colleagues and friends told me and they're in the know as most of them are from India subcontinent and from Africa. Service: Top, top drawer. Especially mentioning Ash, who's the waiter for our table. He's superb. He also recommended some good dishes for our table too. Atmosphere: Fantastic, especially we were there just before Christmas. It's buzzing!

site_logo

Sam Smith . 2024-12-26

MORE AT Google

Really disappointed with the size of the whole chicken. It seems to be literally half the size of a chicken and cost £45. I understand it also includes kheema gravy but for that price, you would expect a larger chicken. This can barely feed two people. Don’t get me wrong, I love regency and have been going there for years but I am really disappointed at what I’ve picked up….its really small!!!! I felt I had to leave a review but this is not relating to their food as it’s great. I only have a gripe towards the whole chicken. Please maybe change your description. Happy to share a photo once I’ve opened it and cooked it.

site_logo

Chirag Patel . 2024-12-25

MORE AT Google

We’ve been customers for quite a number of years, the quality control is truly outstanding! You can order 10 portions of the same item and they all taste the same. We always have a 5 star service from all staff! Tried the lamb burger for the first time, WOW oh WOW is all i can say. So fresh, full of flavour and cooked perfectly! Always recommend “The Regency Club” to my friends and family

site_logo

k99nal . 2024-12-23

MORE AT Google

Very worsted and bad service by staff members and forgot some item in orders.

site_logo

Dhyey Rojivadiya . 2024-12-21

MORE AT Google

Been going here for over 15 years, and I would recommend. There are live sports on multiple screens. Would recommend the garlic mogo as no other place makes it like Regency. Regularly also get their lunch box for takeaway as it is a great value meal, I really enjoy the tawa chicken box.

site_logo

Dipen Dhutia . 2024-12-18

MORE AT Google

Regency Grill. Chilli Mojo. Chilli Paneer,. Passion fruit. Service outstanding. I would happily recommend this joint for a mix of starters. Nice place to watch the sport. Cocktails are OK.

site_logo

Carl Mendes . 2024-12-18

MORE AT Google

Lamb Mushkaki Lamb chops Chicken wings indian style Chicken kadhi

site_logo

Vinay Patel . 2024-12-18

MORE AT Google

We had the best night there. The waiters were really attentive and the food was as good as it always is! Special thank you to Kamal who looked after us really well

site_logo

Anuj Khamar . 2024-12-17

MORE AT Google

We visited on Saturday as a group of friends. We felt the waiting staff were not very helpful. They gave us a slot for our table but the service was not that quick so we didn’t have enough time for dessert despite at 2.5 hr slot. We said the service was slow but they didn’t seem bothered. It felt like just getting as many people in, serve them, and then move them on so the next booking can be seated but without helping them really enjoy the experience. The food was good but not as good as it once was. I think I’ll give this place a kiss in the future, we travelled from quite far and expected better.

site_logo

Sundeep J . 2024-12-17

MORE AT TripAdvisor

Portions are big, nice choose, however u are kicked out after 2 hrs.

site_logo

Prem Singh . 2024-12-16

MORE AT Google

Similary restaurants in London

restaurant_img
4.3

633 Opinions

location-icon205 Watford Road
Indian
outdoor_seating_208116takeaway_208116delivery_208116

Excellent food with friendly service, a must try!

restaurant_img
4.3

2290 Opinions

location-icon59 Salusbury Road
Indian
outdoor_seating_72646takeaway_72646delivery_72646

chicken a bit dry but the sauce was great!

restaurant_img
4.3

550 Opinions

location-icon96 Llanover Road
Indian
outdoor_seating_118200takeaway_118200delivery_118200

Made a pit stop here before a game (visiting from out of town) at Wembley and was blown away by the quality and taste of the dishes + owner’s hospitality. Highly recommend trying out the lamb chops, chicken wings, mushroom, lamb momo, biryani (get it spicy)—absolutely no dish disappointed. Large selection of beverages at the bar and ample seating to accommodate our large group. Hands down one of the best restaurants we’ve been to—we came back twice! Sincere thanks to the chefs, staff, and owners for the amazing service and delicious meals.

restaurant_img
4.3

878 Opinions

location-icon58 Chamberlayne Road
Indian
outdoor_seating_71343takeaway_71343delivery_71343

Lovely food. Great flavours. Would definitely order again.

restaurant_img
4.4

1434 Opinions

location-icon12 - 13, Queensbury Station Parade Edgware, HA8 5NR
Indian
outdoor_seating_121016takeaway_121016delivery_121016

I'm definitely coming back for more food!!! Food is absolutely delicious!!!! Hands Downs