GastroRanking-logo
whatsappWhatsapp
phoneCall
desktopWebsite
menuMenu
bookingBooking
4.9

Based on 272 opinions finded in 2 websites

site_photo4

Nº 34 in 359 in Blackburn with Darwen

Nº 7 of 49 British in Blackburn with Darwen

CUSTOMERS TALK ABOUT DISHES WITH..onionpotatoescookedroastroundmeatsandwichcheesepiesaladsteakvegetablesbaconlambcoffee

comment_iconOpinions

Super. Loved everything about it.

site_logo

Barbara Parker . 2025-01-14

MORE AT Google

Sharon and Simeon are very friendly as are the Staff and I would Definitely recommend the Steak and Ale pie you will not get better anywere I Would Definitely recommend the Arches to anyone

site_logo

Gordon H . 2024-11-20

MORE AT TripAdvisor

Great food quality produce service impeccable a bit pricey but absolutely worth it we arrived five minutes after the breakfast menu had finished but it wasn't an issue so we both had a full breakfast and we were very happy with the food and service.

site_logo

Lee Fowley . 2024-11-09

MORE AT Google

Love the arches, food, service with a smile and atmosphere first class, always return

site_logo

Carole Golden . 2024-11-09

MORE AT Google

Always absolutely excellent, food and service is first class.

site_logo

1chesterjb . 2024-11-01

MORE AT Google

Had breakfast here yesterday,, was very tasty, hot and delicious would certainly recommend

site_logo

ian walsh . 2024-10-20

MORE AT Google

Went yesterday for lunch with my mum, brothers and my partner. We was blown away with the food. Its always good as usual never had a bad meal. Highly recommended

site_logo

Laura Worrall . 2024-10-17

MORE AT Google

Called in before a meeting at Cherry Tree Library. Really wonderful atmosphere & Great food! Perfect place for lunch.

site_logo

Martin Roberts . 2024-09-26

MORE AT Google

The food is good with an interesting menu.

site_logo

Jean Harris . 2024-09-24

MORE AT Google

We were a small group visiting the area and needed somewhere for breakfast on a Sunday morning. Found this little gem on a Google search. Cannot fault the food or the service at all. Very friendly staff, great service and the breakfasts were excellent. Good coffee also. Selection and price brilliant. Just disappointed we don’t live nearby or we’d be frequent customers!

site_logo

Sarah McFadyen . 2024-09-22

MORE AT Google

A real gem of a place. Our tennis team was in the area for a match (had travelled from Scotland) and needed a hearty start for our day. Wonderful ambience, incredibly friendly staff, brilliant breakfast and coffee, and great prices. If I lived nearer I’d be here a lot!!! Highly recommend.

site_logo

Suzie78_10 . 2024-09-22

MORE AT TripAdvisor

Excellent food. Freshly cooked and very reasonable price. Definitely worth a visit. Sunday lunch exceptional. Dessert's are excellent.

site_logo

Ju G . 2024-09-22

MORE AT Google

Really nice. Was at the hairdressers next door with the lovely Jodie and called in.

site_logo

Jo Davies . 2024-09-18

MORE AT Google

Found this gem today. We were on our way to a funeral and had over an hour before the service (travelled from Blackpool). I’m coeliac and they were very knowledgeable about what I could and couldn’t eat. I had the most delish Stilton, broccoli and cauliflower soup with gluten-free bread. I could even hear them say in the kitchen to open a new butter so there was no chance of me getting contaminated. One of my friends had the bacon and black pudding salad which was so big he had to take most of it as a doggie bag. We managed to get the last unreserved table - the afternoon teas seemed to be very popular. Staff friendly and attentive. Would definitely return but under better circumstances.

site_logo

Alison M . 2024-08-09

MORE AT TripAdvisor

Go here regularly, good food, friendly staff, great service abs reasonably priced, can't fault it at all.

site_logo

Barbara Hibbert . 2024-06-12

MORE AT Google

This is my 4th time here, the food is all home cooked, served hot, very well presented too. The place has a lovely ambience about it. Excellent value for money, we had the afternoon tea, it's huge, we brought half of it home ☺️ we will be back. What a fab family run business!

site_logo

Emma Tarr . 2024-06-08

MORE AT Google

Excellent sandwiches made to order to take out. Plenty of choices of bread & fillings. Good one.

site_logo

Simon Tomlinson . 2024-05-12

MORE AT Google

Great food, cooked well, nice atmosphere, good staff

site_logo

curtis godber . 2024-04-06

MORE AT Google

We are so impressed with this place. Superb service, top class food and the best plate meat pie I have ever had in my life. Absolutely boiling hot, fresh and hand made all the way. Well done to The Arches a real gem and we will definitely be back ❤️❤️❤️❤️❤️❤️❤️

site_logo

carole f . 2024-03-28

MORE AT TripAdvisor

The best food I've had in a long time ,very filling and delicious,the staff were lovely. Thank you .

site_logo

Allan Hartley . 2024-02-17

MORE AT Google

A little gem all home cooked fresh food ,the atmosphere and service wonderful .

site_logo

Marie . 2024-02-15

MORE AT Google

Came across this lovely place when passing. Food was lovely and fresh had beef and onion gravy was fab!

site_logo

alex bannister . 2024-01-27

MORE AT Google

Booked table for lunch. Could not fault, staff friendly and welcoming. Good, varied menu. Food arrived in good time, presented well and tasted - very good. Definitely a place to return

site_logo

Richard . 2024-01-14

MORE AT TripAdvisor

Wonderful gem of a place. Amazing breakfast selection and friendly staff.

site_logo

Fiona Waterfield . 2023-12-22

MORE AT Google

Called for breakfast and it was excellent. Food was great and the staff were very helpful. Can't wait to go back.

site_logo

Ian Aspinall . 2023-12-11

MORE AT Google

A lovely lunch food was lovely & fresh & very good quality

site_logo

Jane Windle . 2023-12-09

MORE AT Google

Went there to meet up with a couple of friends. We all had the Bumper Breakfast, which was delicious and definitely hit the spot. Friendly, helpful staff. Very pleasant, clean and a nice atmosphere. Keep up the good work!

site_logo

Pete Unwin . 2023-11-24

MORE AT Google

Lovely afternoon at the Arches. No rush at all and the service, food and atmosphere was as amazing as ever

site_logo

Margaret Morley . 2023-08-14

MORE AT Google

Lovely breakfast although a tad pricey dare I say ?

site_logo

Chris Rostron . 2023-08-07

MORE AT Google

Me and my mother both got the lamb Sunday dinner, the vegetable where very nice well cooked. But the lamb tasted off my mother is 85 she knows when meat isn't right we left the meat. The waitress said they tried the meat and said it was alright, but believe me it had a very funny taste.

site_logo

Mr “Mambo” Kirby . 2023-07-28

MORE AT Google

Awesome place, I'd give it 6 stars! Yx 🥳

site_logo

Yeti Malyckyj . 2023-06-01

MORE AT Google

Food was excellent staff lovely but don’t order garlic bread 2 small pcs of baguette and cost £4.25 thought that was extortionate. Staff told us it is because it was a side dish. Will certainly go again but won’t order garlic bread!

site_logo

Pam W . 2023-06-01

MORE AT TripAdvisor

Lovely atmosphere, food is excellent whether breakfast or lunch, staff are very friendly and would definitely recommend to anyone! 😀

site_logo

Deborah Cotton . 2023-05-25

MORE AT Google

Love this place food good staff lovely

site_logo

beth sale . 2023-05-20

MORE AT Google

Visited the cafe on a Sunday 14/05/23 after recommendations from friends who had been before. What a complete mess! Staff are so unorganised. There was literally 5 tables to serve so half of the cafe. The staff appeared clueless and looked like they were running round like headless chickens. After waiting for 15 minutes I asked a young girl if we could order and she said yes. Walked off told a older lady that we was ready to order. She replied I'm busy. A further 5 minutes we finally ordered. The food then arrived around 20 minutes later. Full of grease, sausages were had black crispy bits all over them, the bacon was like cutting into a brick. I went to cut it and it literally broke like a crisp. I don't mind crispy bacon but that was absolutely burnt to a crisp! I cut into the hash brown oil poured out and the whilst we was sat with our awful breakfast. The security alarm went off for over twenty minutes and all the staff were stood there gormless not having a clue how to turn it off including the owner! So poor service, dreadful breakfast, alarm going off for nearly half an hour and the most unorganised staff I have seen. To top it all off the bill was just short of £30 which is on the more expensive side for breakfast so I would expect food to good standard. Needless to say I won't be visiting again and I won't be recommending to anyone I know. Furthermore, a friend visited the same morning and rang us the day after to say it was the worst breakfast he'd ever had! So that's two lots of unhappy customers. Seriously need to sort your standards out because you definitely should not have a good rating on here. Anyone wanting a good breakfast go elsewhere!

site_logo

leah c . 2023-05-16

MORE AT TripAdvisor

This is an amazing little cafe, excellent food, lovely staff, next level cheesecake!

site_logo

Debra Bird . 2023-05-10

MORE AT Google

Wow wot can I say slow service staff dint have a clue all just walking round I watched a blonde hair girl drop a cake on the floor and serve it to a customer never again really poor service orderd 2 meand n put both meals in 1 box

site_logo

Mathew Hinton . 2023-05-07

MORE AT Google

Our first visit today, but definitely not our last. A warm and friendly welcome as we arrived. We took Dad, who had been before, and he was welcomed back by the lovely staff. A good menu with lots of choice. All home cooked, fresh and hot. 😃 One of my pet hates is luke warm food but this certainly was not an issue. We had cheese and onion pie, mixed potatoes, and vegetables. The Dauphinoise was delicious. 😋 Steak pudding, wedges, and mushy peas did not disappoint. Packed with chunks of tender steak and lots of thick gravy. Tuna and cheese pannini was hot and full of melty mature cheddar. 😋 Although full from the generous portions, we had an apple crumble and a berry crumble with custard. 🍎 😋 Both generous portions with lots of hot custard. A cappuccino finished our lunch. Dad took some of their homemade scones home as they are some of the best we've had. ❤️ It's a hidden gem and definitely needs to be tried.

site_logo

Christine Mero . 2023-04-27

MORE AT Google

Our first visit today, but definitely not our last. A warm and friendly welcome as we arrived. We took Dad, who had been before, and he was welcomed back by the lovely staff. A good menu with lots of choice. All home cooked, fresh and hot. 😃 One of my pet hates is luke warm food but this certainly was not an issue. We had cheese and onion pie, mixed potatoes, and vegetables. The Dauphinoise was delicious. 😋 Steak pudding, wedges, and mushy peas did not disappoint. Packed with chunks of tender steak and lots of thick gravy. Tuna and cheese pannini was hot and full of melty mature cheddar. 😋 Although full from the generous portions, we had an apple crumble and a berry crumble with custard. 🍎 😋 Both generous portions with lots of hot custard. A cappuccino finished our lunch. Dad took some of their homemade scones home as they are some of the best we've had. ❤️ It's a hidden gem and definitely needs to be tried.

site_logo

Christine M . 2023-04-27

MORE AT TripAdvisor

Visit regularly for lunch with friends. Always excellent food and service at a good price. The staff are lovely and we are never rushed. Would recommend.

site_logo

Loretta D . 2023-04-20

MORE AT TripAdvisor

Best Scones in town Thank you Sharon for todays freshly baked Cherry ones, with Jam & Cream , absolutely delicious 😋😋😋😋

site_logo

Michelle Fray . 2023-04-08

MORE AT Google

Lovely food, friendly people, freak service, ample portions too!

site_logo

Kate McSweeney . 2023-04-01

MORE AT Google

Amazing food amazing place lovely staff and owners will definitely be calling in again for food love it!

site_logo

Sandie Willis . 2023-04-01

MORE AT Google

We ordered a buffet for 50 people attending a funeral and it was delicious and plentiful. We discussed the menu first with Sharon and it was delivered to the venue at the requested time, with dishes still hot. We had a variety of sandwiches (extremely well filled), home made pies, home made sausage rolls, chicken and other dishes. Guests commented on how much they enjoyed it.

site_logo

Judith K . 2023-02-26

MORE AT TripAdvisor

Went for lunch today, my what a lovely find this place is. The food was plentiful., delicious and served hot. Highly recommend . We’ll be back. Thank you

site_logo

missvivvy . 2023-02-25

MORE AT TripAdvisor

Superb food and service would recommend and good value for money

site_logo

Trish May . 2023-02-23

MORE AT Google

The staff here couldn’t have been any more helpful…… and one of the customers. My friend (who has mobility issues and has to use a wheelchair) and I rocked up with no reservation. They found us a table for 2 and the chef helped me get my friend into the building, as there was no ramp but 2 steps to tackle. The service was A1. The food (Sunday roast) was absolutely delicious, with 3 types of potatoes, a good selection of veg, Yorkshire puddings to die for and melt in your mouth beef…… All very good value for money. When we were ready to leave one of the customers helped me to get my friend out. My friend is generally housebound and doesn’t get out very often, mainly only when I go to visit her…. A very big thank you to everyone there who helped put a smile on my friends face, this made her week….. or maybe her month…… she’s still talking about it now!

site_logo

BohoSassyChic . 2023-02-13

MORE AT TripAdvisor

Best restaurant for miles around food is always excellent would Definitely recommend this place to anyone will certainly be back

site_logo

Gordon Hardman . 2023-02-08

MORE AT Google

A really delicious meal. Very tasty. Really enjoyed it and will visit again soon.

site_logo

Joan Connelly . 2023-01-26

MORE AT Google

Thank you for accommodating us today. 3 adults and 2 children. We were well looked after. Our meal was a roast. The food is beautifully cooked with lovely flavours. Highly recommended 👌.

site_logo

annedB7920HE . 2023-01-15

MORE AT TripAdvisor

I took my daughter for lunch to this beautiful family run cafe we were not disappointed the food was fantastic with very large portions you will not leave hungry! Staff are friendly most definitely recommend we will return ⭐️⭐️⭐️⭐️⭐️

site_logo

Zoe40X . 2022-12-15

MORE AT TripAdvisor

Lovely little place so warm and comfy. As always the food is excellent. Everything in the menu is delicious but Simeon’s cheese pie and Sharon’s Bailey and toblerone cheesecake are not to be missed. Just had a lovely Christmas lunch and the atmosphere was just right. Gets busy but you can book.

site_logo

Dot Whiteley . 2022-12-15

MORE AT Google

A cosy little cafe with great food and friendly staff, loved it.

site_logo

Catherine Mcinerney . 2022-11-22

MORE AT Google

We have had breakfast here often, which is always good. Today however we are having lunch, we both gone for Steak & Ale Pie. Good size pie with lots of steak, a lovely filo pastry lid, the gravy is deliciously rich and plenty. Served with mash potato and selection of veg, sprouts, broccoli, cauliflower cheese, parsnip and red cabbage, all delicious. Would highly recommend, top it off, staff friendly and attentive. Cakes are always good as take away option.

site_logo

DebsH-S680 . 2022-11-19

MORE AT TripAdvisor

Never been before but my friend suggested it for my belated birthday treat and it was lovely.

site_logo

William Pang . 2022-11-07

MORE AT Google

oh hell yeah this is an amazing little cafe/bar epic service food the lot can't recommend highly enough the warm beef baguette was out of this world and a large cappuccino is what it is a large frothy hot cappuccino it is value for money to say the least ....

site_logo

Michael N . 2022-10-26

MORE AT TripAdvisor

I would recommend The Arches to all who enjoy delicious, home made food. I had the roast lamb dinner 10/10. I will go back again......and again! Excellent, friendly service. Book a table though.

site_logo

Linda Love . 2022-08-15

MORE AT Google

Takeaway buttie Was horrible, greasy sandwich Lots off excess fat undercooked on the bacon Bearly edible, Avoid at all costs

site_logo

nathan taylor . 2022-06-04

MORE AT Google

Really nice place service polite and perfect

site_logo

Chris Holloway . 2022-05-19

MORE AT Google

Lovely little place, we moved round the corner a year ago and have never got round to visiting then twice in one weekend. Gorgeous breakfast, very accommodating of our little dog as we sat out on the deck. Food was hot which is a novelty sometimes these days. Everything cooked perfectly. Good coffee. Good service. Nothing more to ask for really. I think we will be regulars from now on!

site_logo

Rebecca Kenyon . 2022-05-16

MORE AT Google

We had breakfast today. It was good value for quality food. Pleasant owners and offered water with our meal which was nice. Very impressed and will be returning very soon.

site_logo

rachel alker . 2022-04-16

MORE AT Google

I ordered at the last minute for a birthday treat and then altered the amount at the very last minute. It didn't faze them at all. Arrived to collect and they were ready on time. Everyone enjoyed no matter which sandwich filling they had, and all mentioned just how delicious and how much filling there was. Yes, the café was busy when we went to collect but that goes to show how well thought of this place is. I would not hesitate in recommending or using them again. Thank you.

site_logo

M890DJritaa . 2022-04-04

MORE AT TripAdvisor

I visited here for afternoon tea, was meant to be eating in, as I was ill I ordered it as a takeaway! This was still amazing, presented beautifully in a huge box, excellent value, great home cooked food all to a high standard! Well worth coming here, can't wait to visit again and have the eat in experience, thanks Simeon and Sharon 😊

site_logo

emma g . 2022-03-29

MORE AT TripAdvisor

Popped in on the off chance to order from the takeaway sideYou could see it was very busy in the cafe / bar areaHoweverWe ordered a sandwich and a salad nothing to hard to prepareBut everyrhing was prepared using the ladies fingers not tongs so all salad was put in box with with her handsMy sandwich was buttered with out me asking and again fingers where used to put things on sandwichI personally have no allergic reaction to foods but my son doesI had a sandwich which being prepared in that way would have left residue of a food product on it from another mealNo washing of hands in between eitherIt's a small gripe but it needs to be addressedAlso hairnets need to be worn I feel

site_logo

samamyluke . 2022-01-06

MORE AT TripAdvisor

Everything was fine bar the fact the tables are too small.. Or plates too big, I also don't like that all the vegetables are brought on separate plates, there is no from on the tables for 4 big main plates, 4 drinks, 2 plates of veg.. Just put the veg on the plate. But the place was nice, the staff where nice and the food tasted great.

site_logo

Bob Dent . 2021-09-21

MORE AT Google

Best breakfast place in blackburn!

site_logo

laura eccles . 2021-08-14

MORE AT Google

The food is always amazing quality. I've been here 4/5 times now and they do not disappoint. They do get lots of bookings but when ever I have walked in theybhave always accommodated me. They are a busy cafe but that is because how good they are. The staff are always polite and welcoming.

site_logo

Jessica . 2021-07-21

MORE AT Google

Awesome busy little place, but all the best tables pre booked, food and service is excellent, in the words of a famous Austrian, "I'll be back".....

site_logo

Ian May . 2021-07-17

MORE AT Google

The meal was lovely, the service is great and I will be eating there each week after I have my hair done.

site_logo

susan james . 2021-06-11

MORE AT Google

Fantastic food great outdoor seating and friendly staff 5 stars all the way

site_logo

Mohammed Qurban . 2021-06-09

MORE AT Google

At last we are able to eat out in a fashion. Luckily a lot of cafés have managed to survive so far by takeaways and home deliveries and we have been doing our best to support them. Yes they may be a little more expensive but the main thing is survival. We called on spec and were lucky enough to get a table for a while. Very friendly staff , an outdoor heater was put on as we arrived and drinks ordered. We had a prawn baked potato and homemade cheese pie with wedges and baked beans followed by an excellent scone with clotted cream and jam . An excellent lunch in an excellent atmosphere. Five easy stars . Thank you The Arches

site_logo

andrew h . 2021-04-21

MORE AT TripAdvisor

First time I've used this sandwich shop and I've got to say it is really good. 10/10

site_logo

Jim One Fit . 2021-04-04

MORE AT Google

Customer service is second to none. A must go to if you're in the area! Will definitely be back, thankyou for a great service 😇

site_logo

Jordan Ball . 2021-02-16

MORE AT Google

Nice local cafe. Great for breakfast. 👍🍳🥓

site_logo

Dale . 2020-12-30

MORE AT Google

The food is brilliant can't better it any were . 5 stars.

site_logo

Derek Lobb . 2020-11-08

MORE AT Google

Very friendly and helpful staff. Great food.

site_logo

John Walker . 2020-11-06

MORE AT Google

10/10 will return. Best breakfast she has ever had in a restaurant. Delighted. Well done and thank you

site_logo

georgewinkyandrews . 2020-10-23

MORE AT TripAdvisor

Lovely food and friendly atmosphere

site_logo

Wendy Sharples . 2020-10-23

MORE AT Google

Lovely afternoon t with excellent service n good food, only disappointment was the toilet in rest room with the Same loose old wooden seat!?

site_logo

Paul Farrington . 2020-10-05

MORE AT Google

Lovely little caffe with friendly service and nice outdoor seating area. Highly recommended

site_logo

Ivaylo Petrov . 2020-09-26

MORE AT Google

Whilst driving home with the family we weighed up the usual restaurant chain lunch options when we spotted the street sign advertising take out roasts so we thought we would go for a closer inspection. Glad we did great service, lovely food and licensed to boot for a cheeky beer.

site_logo

Leon Porter . 2020-09-07

MORE AT Google

Great food, lovely staff...had a delish lunch 😋

site_logo

Janet Harrison . 2020-08-27

MORE AT Google

Very impressed we loved our breakfast it was of high quality and tasted very nice. Would defo return again

site_logo

travelgirll653 . 2020-08-19

MORE AT TripAdvisor

Excellent food and friendly staff

site_logo

Kirt Birney . 2020-07-16

MORE AT Google

Once again we phoned and ordered our Sunday lunch takeaway today and it was wonderful. I had raast beef and my husband had roast lamb and they have never been better! The beef was delicious and just "fell apart" and the gravy was superb. Well done!! You have cheered us up during lockdown.

site_logo

Daisyrex1 . 2020-06-28

MORE AT TripAdvisor

We were delighted in our neighbourhood when The Arches re-opened for takeaways. As a group of neighbours we had a Sunday roast dinner in our separate houses and it was absolutely lovely with all the trimmings. Highly recommend you try it but remember to pre-order hot food during these social distancing times.

site_logo

tillyflop1 . 2020-06-07

MORE AT TripAdvisor

We had the Sunday roast, this tasted great and there was plenty of it. Would recommend

site_logo

Michael Jones . 2020-05-24

MORE AT Google

After seeing that The Arches was starting to do takeaways, during this present lockdown, my husband and I decided to treat ourselves today to a Sunday lunch. We were very impressed at how easy it was and when we arrived the pre0ordered , piping hot food was brought out to us wrapped up in tinfoil and ready to go. When we got it home we found it was as delicious as usual. I had the roast beef and he had the roast turkey , both with all the trimmings. We were not disappointed and both felt really full after. We will certainly be going again. Thank you for feeding uus and cheering us up so well!

site_logo

Daisyrex1 . 2020-05-10

MORE AT TripAdvisor

Thank you to everyone at Arches, in Blackburn, for the delicious food you delivered to all of us in women’s Health. On Friday the 24/4/20 all of the staff in the Ultrasound department where truly grateful, your gesture is extremely appreciated by all

site_logo

diane cousins . 2020-04-24

MORE AT Google

Amazing food. Amazing staff couldnt recommended enough

site_logo

Tina Bennett . 2020-03-12

MORE AT Google

A wonderful selection of delicious food for our afternoon tea at The Arches this afternoon.Everything freshly prepared, soup nice and hot, pastries delicately warm, sandwiches filled ,desserts beautiful to look at and delicious in the mouth.Even so we had doggy bags each to take home what was impossible to fit in Very,very nice

site_logo

elainewG124CL . 2020-02-19

MORE AT TripAdvisor

Always a pleasure, nice relaxed atmosphere, lovely people, great food, might be a good idea to pre book a table.😊

site_logo

Steven Hurtley . 2020-02-19

MORE AT Google

Fabulous place highly recommend food always scrumptious and great friendly service 👍

site_logo

susan taylor . 2020-02-16

MORE AT Google

Delish breakfast friendly staff definitely go back xx

site_logo

Sharon Weir . 2020-01-31

MORE AT Google

Been going here since they opened. The place is amazing, the staff fantastic, and the food is second to none. I have had most of the menu, and would try anything on it. They just have something special in their service. Becca,Elanor, Jess,Sharon and Simeon run a fantastic business. Be careful, the plates are hot, but it keeps the food warm. It's the extra touches like this that makes this a great place to eat. Can't fault anything.

site_logo

narsiccus . 2020-01-25

MORE AT TripAdvisor

Visited today for afternoon tea as a birthday treat. WOW ......so fresh, tasty, scrumptious delight was served us a feast for the eyes and it didn't disappoint the taste buds either. Presented with love and you could tell it had been prepared with love also. The best afternoon tea I have EVER had. They even prepaired a vegan one for us which did not disappoint either. How many marks on 10........12 !!!! We will return

site_logo

picofdarwen . 2020-01-24

MORE AT TripAdvisor

What a delightful little place. We had a lovely Sunday lunch here today. Friendly staff and food to die for!. Ring and book as they get very busy. Five stars from me

site_logo

Kirk Bramley . 2020-01-19

MORE AT Google

Fantastic food, would definitely go again.

site_logo

Joe Bywater . 2020-01-14

MORE AT Google

Nice little place for breakfast,

site_logo

Craig Denmark . 2020-01-13

MORE AT Google

Had afternoon tea which was preordered. Everything was freshly made to order and to choice, service was excellent and venue comfortable and cosy. Not my first visit and never disappointed, highly recommend

site_logo

Carol G . 2020-01-09

MORE AT TripAdvisor

Similary restaurants in North West

restaurant_img
4.9

54 Opinions

location-iconFrederick Street
British
outdoor_seating_226914takeaway_226914delivery_226914

Me and my partner went for the first time yesterday and as soon as we arrived we were greeted with a warm welcome by David who we now know runs the restaurant with his wife and a team great staff. The food was delicious and freshly made. It was relaxing and spotless and anyone who likes good home cooking at a reasonable price won't be disappointed. We will definitely be back. Darwen's best kept secret.

restaurant_img
4.6

1138 Opinions

location-iconQueen Street
British
outdoor_seating_187001takeaway_187001delivery_187001

Great place to visit. Never before has 1 pub ever been able to plz me my wife and 2 kids when out for a meal. This place did. The food is fantastic 4 separate dishes was loved by us all . The service , the beer (gold) was unreal. 100% will visit again.

restaurant_img
4.5

45 Opinions

location-icon453 Whalley New Road
British
outdoor_seating_205166takeaway_205166delivery_205166

Lovely bacon and egg butty for breakfast. Well worth a visit if your in the area for something to eat. Cash only by the way.

restaurant_img
4.5

248 Opinions

location-icon11 Railway Road
British
outdoor_seating_212522takeaway_212522delivery_212522

Had such a fun time here, atmosphere was awesome and the bar staff were amazing

restaurant_img
4.5

14 Opinions

location-icon300 Blackburn Road
British
outdoor_seating_187090takeaway_187090delivery_187090

Excellent full English breakfast. Lovely surroundings at an excellent price. I am staying 5 minutes away and the hotel breakfast is almost double in price. No brainer!