GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.3

Based on 585 opinions finded in 3 websites

site_photo4

Nº 152 in 306 in Harborough

Nº 2 of 3 Other european cuisines in Harborough

CUSTOMERS TALK ABOUT DISHES WITH..mexicangarlicbeautifulsteakchickencookedmeatriceprawnsladyfriedcheesechillisaladmustprawntortillapotato

comment_iconOpinions

Excellent tasty food. Served hot too. Thank you.

site_logo

James . 2025-03-30

MORE AT Just Eat

We have been enjoying the food at Rio Bravo since it opened and always found the quality of food and service to be second to none. Our recent home delivery was once again excellent, it arrived on time , well packaged and hot! We can’t thank George and his team enough for a yet another all round FIVE STAR Mexican meal 🥘😋❤️

site_logo

H Limner . 2025-03-18

MORE AT Google

Fantastic place to have food and drinks, my go to place every time I take someone out, or birthday party, really nice staff with fun atmosphere 😀

site_logo

Bryan Fortnum . 2025-03-15

MORE AT Google

The ambiance at Rio Bravo is as delightful as the food. The vibrant colors, warm lighting, and charming decor create an inviting, cozy environment where you can relax and savor every bite. It's the kind of place that makes you feel like you’re dining in Mexico itself! I went for the "Rio del Mar steak" and my girlfriend for the "Horneadas de Calinda" both were original, bursting with flavours and vibrant colours. While the weekends are popular it's an excellent spot to visit during the week for a quieter, more relaxed dining experience. I can't praise this place enough which I think is a true hidden gem, if you're looking for a place to enjoy fantastic Mexican food, Rio Bravo should be at the top of your list. Best of luck on your culinary journeys!

site_logo

Kevin Fortnum . 2025-03-15

MORE AT Google

If you're in the mood for an unforgettable Mexican dining experience, Rio Bravo is the place to go. From the moment you walk in, you're greeted by a cozy, welcoming atmosphere that instantly makes you feel like a guest rather than just another customer. The restaurant has a charming, intimate vibe, and when it's full, the energy is palpable, creating an exciting, vibrant atmosphere that is hard to find at many other places. The food at Rio Bravo is a standout. The menu offers a fantastic mix of classic Mexican dishes with a twist, thanks to the influence of a talented native chef. The sauces are unlike anything you'll find elsewhere – each one brings a unique and delightful flavor that complements the fresh, high-quality ingredients. For those who love a hearty, satisfying meal, the steak fajitas are an absolute must-try – perfectly cooked, full of flavour, and enough to leave you feeling satisfied. As a starter, the nachos are a real treat, perfectly loaded and great for sharing, ensuring you're well-fed right from the start. What truly sets Rio Bravo apart, though, is its customer service. It's rare to find such a personal touch these days, but the team at Rio Bravo makes you feel like you're the most important guest in the room. They take the time to engage with you and make sure you're well-catered to throughout your meal, making for an experience that feels both authentic and thoughtful. If you're after a meal that not only fills you up but also delights your taste buds with every bite, Rio Bravo is definitely worth a visit. The food, the service, and the lively atmosphere come together to make it an experience that leaves you eager to return.

site_logo

Marcus Snutch . 2025-03-15

MORE AT Google

For the small town of Market Harborough, discovering authentic Mexican food is absolutely fantastic, especially with the pristine quality of the food and the lively atmosphere of a restaurant with gorgeous mood lighting. I visited Rio Bravo last weekend with my partner, and I was impressed by the fantastic selection of drinks available. I ordered the Steak Fajitas, and they were fantastic. They are served piping hot, and sizzling. The whole restaurant (including my partner) was jealous! This restaurant is absolutely worth a visit, the staff were polite and kind, the interior was clean and welcoming, and the food was fantastic. If I could, I would give it 10 stars.

site_logo

Jack White . 2025-03-15

MORE AT Google

Delicious food and reasonable prices. Nice little restaurant

site_logo

Peter rayner . 2025-03-15

MORE AT Google

I come here a lot and it never disappoints. Proper good hearty mexican food!

site_logo

Sam . 2025-03-09

MORE AT Google

Rude personal. We pay for the hats and they take us from it. Said I haven't paid for buy they charge us 4 extra drink. Don't recommend..... Never see some shrimp 🦐 to be that rude. Never come back for sure. Special was someone's birthday and make a bill up to 400£ rude bad no recommend. Karma Will come back to you remember!!!!!

site_logo

Andrei-Alexandru Voda . 2025-03-08

MORE AT Google

This is a great little place been going here for years! ❤️

site_logo

Paul Pearson . 2025-02-15

MORE AT Google

Great food nice and hot friendly delivery service

site_logo

Ian . 2025-02-08

MORE AT Just Eat

Lovely food, excellent service! Highly recommend.

site_logo

Hannah Bentley . 2024-12-11

MORE AT Google

Absolutely fantastic food as always from Rio Bravo. Delicious nachos and the burrito and chimichanga were soooo tasty!

site_logo

Karen . 2024-12-07

MORE AT Just Eat

I must admit I was expecting this to be another generic Sudo Mexican eatery, how wrong I was. Food was amazing and really had some incredible flavours! Genuinely tasty and authentic Mexican flavours. Definitely will be making a visit to the restaurant and working my way through the menu. Would recommend buying an item and letting the flavours do the talking!

site_logo

baljit sangha . 2024-11-29

MORE AT Google

Arrived exactly on time. Hot and very tasty. A bit more guacamole would have been nice.

site_logo

Margaret . 2024-11-23

MORE AT Just Eat

Really awesome Mexican themed restaurant. Really enjoyed the Mexican food that is served here. Always enjoyed ordering the large pizza as the main meal and really loved the idea of the Mexican themed hats too.

site_logo

Kimberley Leiser . 2024-11-13

MORE AT Google

Lovely food and friendly service

site_logo

Peter Melville . 2024-11-12

MORE AT Google

Delicious food Delivered on time

site_logo

linda . 2024-11-02

MORE AT Just Eat

Fantastic restaurant. I went here with my friends to celebrate my mates birthday. Amazing food, excellent service and we all had a great time. Highly recommend 😀

site_logo

Steve Rippin . 2024-10-16

MORE AT Google

14 of us visited at 7pm on a Saturday night to celebrate my niece's 18th birthday. I don't think we could have picked a better place. The food, drinks and service were all top notch. The relaxed ambience is also worth a mention.This is a busy restaurant so it might be best to book.

site_logo

Arden24 . 2024-10-06

MORE AT TripAdvisor

Definetely the best restaurant In Market Harborough

site_logo

tasnad tasnad . 2024-09-27

MORE AT Google

Absolutely delicious as always - thank you!

site_logo

Barbara . 2024-08-31

MORE AT Just Eat

Food was fabulous would definitely recommend. Staff were lovely 😘

site_logo

Lindsey Darlow . 2024-08-09

MORE AT Google

Very good food and great service as always

site_logo

Elizabeth Stephens . 2024-07-20

MORE AT Google

Tasty food fast friendly delivery

site_logo

Carolyn . 2024-07-19

MORE AT Just Eat

Gone down hill. Food mediocre. Can tell the ingredients are inferior including the rice, fries, nacho chips. Sour cream tasted more like plain yoghurt. Not impressed.

site_logo

r v . 2024-06-20

MORE AT Google

Incredible hidden gem in the Midlands! Authentic Mexican food with great vibes and an exceptional service! You won't regret coming here!! For me, it became a must every time I'm in MH! Absolutely fantastic! 👏🏽👏🏽👏🏽

site_logo

Gastón Acha . 2024-06-05

MORE AT Google

on time, food was nice but a bit pricey for what you get

site_logo

stuart . 2024-06-03

MORE AT Just Eat

Love this little restaurant, staff always pleasant and food always served quick and delicious, never had a bad experience and have been going for years

site_logo

1963A . 2024-06-02

MORE AT TripAdvisor

Very good quality hot food 5 stars thank you x

site_logo

Colin . 2024-05-09

MORE AT Just Eat

First time here and almost and I loved it. Nice friendly atmosphere with great food. I had the steak 😋

site_logo

Matthew Parkes-Inspired Karate . 2024-04-23

MORE AT Google

Can't beat a good Chicken Fajita! Loads of very tasty food for the price too!

site_logo

Sheldon “EzBloke” Wortley . 2024-04-07

MORE AT Google

Delicious! Every time! But what REALLY keeps us coming back is the service, first rate. Highly recommended 👍🏻👍🏻👍🏻👍🏻👍🏻👍🏻👍🏻👍🏻

site_logo

Dan Thompson . 2024-03-04

MORE AT Google

Me and the Mrs threw up all night and are still ill this morning. Food poisoning I reckon. Wouldn’t recommend. Tried ringing up and just keep getting put to voicemail so o will complain on here

site_logo

Ben Caldwell . 2024-02-25

MORE AT TripAdvisor

Very friendly and welcoming staff :) the food was beautiful and very tasty! Cocktails are nice aswell as strong!

site_logo

CT123 . 2024-02-10

MORE AT Google

The food is exquisite. Prices are very good. Had a really lovely evening. Timing between courses just about right and the staff are very helpful and attentive

site_logo

Paul Wainwright . 2024-01-27

MORE AT Google

Last week, my partner and I visited Rio Bravo for dinner, and we were thoroughly impressed! The ambiance of the restaurant is warm and inviting, with a vibrant Mexican flair that sets the perfect mood for a delightful evening. We started with their Amigo’s Combo Nachos, which were fresh and flavorful. For the main course, we tried the Rio del Mar Steak and the Pollo Ranchero - both dishes were absolutely delicious, bursting with authentic Mexican flavors. The cocktails were a real highlight; the Latino 69 is a must-try! The staff was friendly and attentive, making our dining experience even more enjoyable. Rio Bravo truly offers a little slice of Mexico right in the heart of Market Harborough. We're already planning our next visit!

site_logo

Rachel W . 2024-01-19

MORE AT TripAdvisor

Sharing a friends birthday celebration. Rio bravo was chosen. Really superb service. Lovely welcome and really well timed delivery of starters and the sometimes long wait before the main course arrives didn't happen. Suoerb . We had a fantastic evening... bravo rio 👏

site_logo

Joseph Goodman . 2024-01-14

MORE AT Google

Great welcome, friendly, really tasty food and good atmosphere

site_logo

Amanda Wesley-Smith . 2024-01-11

MORE AT Google

Nice little Mexican, good food and service.

site_logo

Nick Abraham . 2023-12-25

MORE AT Google

Ordered from them a few times and it is always great quality food with generous portions. Plus they always deliver super quick!

site_logo

Tiffany . 2023-12-23

MORE AT Just Eat

Fabulous Mexican food, always delivered on time and always nice and hot!

site_logo

Barbara . 2023-12-17

MORE AT Just Eat

Pitiful portion sizes with fajitas meal. No salad with prawn dish, £10 for big prawns. Not impressed.

site_logo

Tony . 2023-12-16

MORE AT Just Eat

Very Nice place, exceptional food, really good and friendly staff,we will surely go there again

site_logo

Vikram Gajjala . 2023-11-15

MORE AT Google

Top service, brilliant food. Staff are amazimg.

site_logo

dalmabergo . 2023-11-04

MORE AT Google

Delicious food. Fast service and excellent customer service. Had a lovely Margherita.

site_logo

Hanisha Mistry . 2023-11-02

MORE AT Google

Delivered on time and delicious food!

site_logo

Barbara . 2023-10-15

MORE AT Just Eat

Went here for first time not impressed. Very poor , I am a cook so judge presentation and portion size on what I would serve and I thought both were poor

site_logo

free&single1963 . 2023-09-30

MORE AT TripAdvisor

Great place, has the lot. Service is a stand out point

site_logo

Peter Goulborn . 2023-09-23

MORE AT Google

5/5. Chilled venue and atmosphere in the center of this beautiful Leicester town. I’m from San Antonio, Texas where there are hundreds of Mexican restaurants and Taquerias in town. So visited this restaurant to find out if there are really any authentic Mexican restaurants in England and this was the real deal! Chicken enchiladas to die for. Eric, the chef did them better than any restaurant I have had them in in San Antonio. 5 Star

site_logo

Andrew H . 2023-08-24

MORE AT TripAdvisor

We have been visiting this restaurant for many years, and used to eat there every Friday. It is a shame that the quality of the food has gone down. This could be because they are trying to cut back on costs, but I noticed that it is not very busy anymore, so maybe other people are thinking the same. It is a real ashame, as it used to be our favorite restaurant 😔.

site_logo

Yasmin Denison . 2023-08-06

MORE AT Google

Great mocktails (piña colada)! We shared a starter, Nacho's, which were good. The main course was vegetables with cactus & Mexican rice. 5 minutes after ordering we were told that they didn't have any cactus which was a shame as I was looking forward to trying this. The main, without the cactus, was a tad plain, not horrible, but not brilliant. Would go here again if we are in this neck of the woods & hopefully we can try the cactus dish!

site_logo

Scott Shipley . 2023-07-23

MORE AT Google

Food was ok. Nachos to start, was ok. chimichanga for main was ok. Very ok meal.

site_logo

Marco . 2023-07-16

MORE AT Google

Very good food and it took about fifteen minutes, very good

site_logo

Pabloelcapo . 2023-07-13

MORE AT Google

The food was really good, staff really polite and well mannered

site_logo

Santoshan Sangha . 2023-06-12

MORE AT Google

Absolutely delicious as always!

site_logo

Stephanie . 2023-05-31

MORE AT Just Eat

The food was amazing hot yummy fresh definitely try this takeaway again before go home to north east Friday thanks

site_logo

Jamie . 2023-05-30

MORE AT Just Eat

Amazing food as always - thank you!

site_logo

Barbara . 2023-05-28

MORE AT Just Eat

Really tasty food. Fast and friendly service. Will be returning

site_logo

ben lock . 2023-05-18

MORE AT Google

Lovely Mexican in the middle of Market Harbrough. It's accessed via a small door between SuperDrug and Fifty Three public house; the restaurant being located upstairs and nicely overlooks the square in Harbrough. It's not a large restaurant and is quite intimate. There was plenty to eat and the food was of a high quality. I can certainly recommend the Acapulco chicken as it was lovely. The staff were very attentive and service was prompt. Our friends had not been before but really enjoyed it and said that they would also fully recommend it.

site_logo

rsb66 . 2023-04-16

MORE AT TripAdvisor

Menu promises much, food delivers nothing. When we entered & saw the tacky sombreros with price labels on I wish I had turned & left. Despite the impressive menu the food was bland beyond belief, not what one expects in a Mexican. Sloppy cheers tipping, no sign of Monterey Jack here! It’s hard to get Chilli wrong but I wouldn’t be surprised if what was served in my Chimichanga had come out of a tin. My guacamole was missing & had to be asked for (trying to cut costs perhaps?). Couldn’t get out of there quick enough, have had better food/experiences in McDonalds.

site_logo

ADSYK . 2023-04-16

MORE AT TripAdvisor

Great atmosphere, great service and great food. I recommend you try.

site_logo

Daniel Greenough . 2023-04-06

MORE AT Google

Food was bland, not spicy at all as you’d expect Mexican food to be. Disappointing.

site_logo

Sharlene . 2023-03-09

MORE AT Just Eat

Love this place, a little something different to the norm, sombrero's, great food, great cocktails, great staff, great atmosphere a great place for an evening out

site_logo

Cheeseburgers Channel . 2023-03-06

MORE AT Google

Lovely food, excellent surroundings, friendly and welcoming staff. Tex mex wrap with wedges really nice, also had Nachos to start, really good!

site_logo

mat_n038 . 2023-03-04

MORE AT TripAdvisor

Everything was great. They even let me delay my order by 30 minutes after putting it through on the app.

site_logo

James . 2023-02-15

MORE AT Just Eat

Great service and decor, however as a vegetarian it’s very pricy. We had nachos for starters which were £9 and £1.50 to add guacamole. The portion was a small plate of nachos which wasn’t worth £9. I had the vegetable burrito for £15.95 and expected more. It was literally just vegetables and rice in a wrap with cheese sauce and fries. No beans or protein for that price. We asked for chilli sauce and ketchup and at the end found out we were changed £1.50 for the chilli sauce. I found it too pricy with all the add ons and not value for money. Shame as it’s a nice vibe inside. Won’t be returning

site_logo

Nam Jay . 2023-02-12

MORE AT Google

Very good service and friendly staff. Food was delicious. The sombrero's were a bonus. Recommend this restaurant.

site_logo

MARY GARRATT . 2023-02-10

MORE AT Google

Excellent nachos sonora as always, but don't rate the Pollo a Latino very much!

site_logo

Tom . 2023-02-01

MORE AT Just Eat

First time using Just Eat and the food from Rio Bravo was excellent. Will use again.

site_logo

cheryl . 2023-01-20

MORE AT Just Eat

Best mexican round here. The atmosphere was really good and the service excellent. The food was amazing, can't wait to go there again. Thanks.

site_logo

Juanjo Teruel . 2023-01-08

MORE AT Google

Service as in delivery was brilliant. The food itself was not fab, the main course was flavourless, the starter was burnt and the dessert was hard

site_logo

Vanessa . 2022-12-10

MORE AT Just Eat

Unfortunately, there's no 'Bravo' in Rio Bravo. Came to eat here after reading good reviews. I don't know if there is a new chef? Whatever, he's clearly never eaten Mexican food. We had Nachos to start with Chilli beef, there was no chilli flavour to the beef, no guacamole. For mains we had Enchiladas and a Tex Mex burrito, again not what we expected- totally bland. I'm a total fan of Las Iguanas and Chimichanga in UK and have eaten amazing Mexican food in USA. The only reason I'm giving 2 stars is the wait staff were excellent 👌

site_logo

Julia Harlan . 2022-12-10

MORE AT Google

Excellent meal as always. Thank you.

site_logo

Sara . 2022-12-09

MORE AT Just Eat

Long time favourite of mine, fun hosts, great service and very tasty food.. always leave very happy.. 😊

site_logo

Heather S . 2022-12-06

MORE AT TripAdvisor

Had a fantastic meal with family. Good atmosphere and amenable staff. Loved the sombreros.

site_logo

Ian Warner . 2022-11-28

MORE AT Google

First time there lovely food, great service. Will definitely go again

site_logo

Mel Yorke . 2022-11-24

MORE AT Google

Friendly restaurant tucked away up a steep flight of stairs. Food was OK....but I wasn't blown away. The chimichanga was served with a tiny amount of sour cream and a small serving of potato wedges. It tasted ok but would have benefited from a salad and some guacamole. I felt it was expensive for what we had. I don't mind paying a bit more but I left feeling like I had been short changed on the quality of the food.

site_logo

rachelbL2359XC . 2022-10-28

MORE AT TripAdvisor

Prices have been upped dramatically! Not worth it now imo

site_logo

Rebecca C . 2022-10-25

MORE AT Google

Main meals good, drinks overpriced. Service ok. Have to book as it's a small upstairs restaurant. Busy on a Saturday night.

site_logo

Sally Webb . 2022-10-09

MORE AT Google

Great food. Tasted amazing. Still hot and arrived a little earlier. Good quality for price.

site_logo

Hannah . 2022-10-08

MORE AT Just Eat

Brilliant as always - Thank you!

site_logo

Barbara . 2022-09-11

MORE AT Just Eat

Below average food at a high price.

site_logo

Tim Atkinson . 2022-09-09

MORE AT Google

Had a nice meal here with friends and will definitely come back.

site_logo

John Keaney . 2022-08-27

MORE AT Google

Authentic Mexican. Food was amazing and great atmosphere

site_logo

Richard Golding . 2022-08-22

MORE AT Google

Excellent service and prompt delivery of wonderful food

site_logo

D . 2022-08-02

MORE AT Just Eat

Unbelievable! If this is your kind of food I'd 100% recommend it 😋

site_logo

Col . 2022-07-26

MORE AT Just Eat

I visited this restaurant for the first time with my family for my Birthday. I love Mexican food as it is my favourite cusine and have heard a lot of very good reviews about this place from friends and family. I was extremely pleased. The food was top notch and PROPER Authentic Mexican flavours. The service was even better. We were served by the actual owner of the restaurant who was on his own as all his staff were off due to the weather ! He did not go a second without a friendly and welcoming smile on his face and seemed genuinely happy to be serving everyone. The service was also very quick regardless of the situation. I will definitely be visiting again and again! Customer service for me is very important and I must say, this was one of the best I've received. I would recommend all to visit this restaurant.

site_logo

pujaL58 . 2022-07-24

MORE AT TripAdvisor

Absolutely delicious, a bit expensive, but worth it for a Friday treat

site_logo

Charlotte . 2022-07-22

MORE AT Just Eat

I couldn't recommend this place highly enough. From the staff to the food was amazing. Have been 3 times now and I will be back for a 4th very soon. Oh and the cocktails are delicious to!

site_logo

Vanessa de-Vivian . 2022-07-18

MORE AT Google

Nice but a touch to salty would still highly recommend

site_logo

Sean “Basey” . 2022-06-07

MORE AT Google

A real hidden gem. Absolutely amazing food, tasty and excellent value for money. The service was second to none, all staff very attentive making sure the food met our expectations and checking if we needed more drinks. The atmosphere is great, very relaxed but also very fun, the sombreros an added touch! We were very impressed at how quickly the food came.

site_logo

Happytravelblog . 2022-06-04

MORE AT TripAdvisor

Food was absolutely delicious and hot wonderful will definitely recommend it and will definitely be ordering again. I’ve never tried Rio Bravo before but will definitely be using them again yummy

site_logo

D . 2022-05-26

MORE AT Just Eat

Very expensive for what you actually get. Food bland. Not their normal restaurant quality

site_logo

Scott . 2022-05-21

MORE AT Just Eat

Awful drinks and food wasn’t great at all, charged for hot sauce which was crazy?! Just wouldn’t recommend to anyone.

site_logo

Jas . 2022-04-22

MORE AT Google

Easy ordering and quick delivery. Food is always good.

site_logo

Robert . 2022-04-22

MORE AT Just Eat

We arranged a family dinner for four and pre-booked our table. The restaurant is in a good location within the square, but situated on a first floor by ascending a flight of steep stairs which proved slightly awkward with one of our family. The restaurant is cosy and welcoming and the servers are friendly and attentive. We enjoyed drinks whilst we chose our favourite dishes from the menu. Beers are all small bottles as there is no draught beer so this is an expensive way to drink a couple of pints. Our chosen dishes of three Mexican and a steak dish were all freshly prepared and of good quality but I would have preferred slightly larger portions with the Mexican dishes without having to order a side for each dish. Overall it was an enjoyable family evening but far too expensive for a non-city centre Mexican restaurant, coming out at an eye-watering £35 per head for just 4 mains, 3 sides and drinks for the four of us, ouch!

site_logo

Charles S . 2022-04-07

MORE AT TripAdvisor

Brilliant service great friendly staff and the food was on point

site_logo

Sagar Parmar . 2022-03-27

MORE AT Google

We always enjoy visiting Rio Bravo. The staff really make the effort and the food always goes down a storm.

site_logo

Joe Aucott . 2022-03-05

MORE AT Google

Albeit we were soon in the doors straight after opening on a Tuesday evening, everything we had here was tasty and as the only ones in, were very much looked after by the staff. Excellent view over the market square gave some entertainment and the three courses were all fully completed. The cocktails we had were also very good and do recommend.

site_logo

WorldTraveller2plus2 . 2022-03-02

MORE AT TripAdvisor

Similary restaurants in East Midlands

restaurant_img
4.6

1920 Opinions

location-icon24 - 26 St Mary's Road
Other european cuisines
outdoor_seating_131352takeaway_131352delivery_131352

Really excellent food with friendly attentive service. A good selection of wines and cocktails with a truly amazing coffee that is sourced locally from Harborough. The decor is unfortunately a bit tired.

restaurant_img
3.8

1035 Opinions

location-icon31 Kettering Road
Other european cuisines
outdoor_seating_131169takeaway_131169delivery_131169

Serving San Miguel in a Coroner glass , after asking for it in its proper glass, then got told we ain’t got any, so why sell it then, beer was flat too , never going back again place has gone down hill