GastroRanking-logo
whatsappWhatsapp
phoneCall
desktopWebsite
menuMenu
bookingBooking
4.3

Based on 3.173 opinions finded in 4 websites

site_photo4

Nº 290 in 963 in Coventry

Nº 11 of 54 Chinese in Coventry

CUSTOMERS TALK ABOUT DISHES WITH..mangoricechopsmusteggspicycookedprawnsfishpaysaladchickensteakfriednoodles

comment_iconOpinions

Big thanks to Hamza and all the staff for creating an incredible dining experience!

site_logo

Leann Wang . 2024-11-05

MORE AT Google

Good food, the taste of the food was so authentic. I had a Singaporean style Noodle with spicy chicken, and it tasted very tasteful. The service by Hamzah was so accommodating.

site_logo

Romi Hadiyan . 2024-10-19

MORE AT Google

the food is generally tasty & flavored full! hamzah is assisting us during our lunch time & he puts the details service for us. thanks!

site_logo

Hanifika Indriarida . 2024-10-19

MORE AT Google

Nice place good food and service

site_logo

Deba Hussain . 2024-10-07

MORE AT Google

Excellent service and food was amazing

site_logo

Sam Howells . 2024-10-05

MORE AT Google

Great place love the malaisan Magroine noodles 🍝 Became my go to place, the staff is very accommodating, especial thanks to Hamza 👍

site_logo

Khadija Sehar . 2024-09-30

MORE AT Google

Food was not good and very costly.

site_logo

Arjun VS . 2024-09-30

MORE AT Google

Meal ordered as I wanted it ! hamza was great

site_logo

Imran Hussain . 2024-09-27

MORE AT Google

The food was great, they have a variety of options (vegetarian too) to choose from, but nothing too complicated. They also have a good kids' menu. We had a great server named Mehnoor who was helpful and attentive. I'll definitely visit again with family.

site_logo

Pooja Chaware . 2024-09-25

MORE AT Google

The name is a bit misleading as there was quite an extensive menu with a huge variety of options and seemingly cuisines though it was essentially dishes with an asian inspured twist, e.g, spiced fish and chips. The food was better than anticipated, especially the noodles and service was polite and reasonable.

site_logo

Y L . 2024-09-24

MORE AT Google

Good value for the price and super quick service.

site_logo

karl taylor . 2024-09-18

MORE AT Google

We had delicious lunch but rice with prawns are so expensive even you can say , horrible price with single serving :)..

site_logo

Bilal Waheed . 2024-09-17

MORE AT Google

If you’re a fan of noodles then this place is definitely worth a try. It’s got a nice variety of options. I’ve been down here a number of times and the food has always been excellent, apart from a time when I ordered something which wasn’t to my taste but that was my fault for ordering it. The staff changed the order without any additional charge. The service is always excellent and the staff are helpful if you’re not familiar with the menu!!

site_logo

Zaid Khan . 2024-09-17

MORE AT Google

Clean, welcoming and excellent atmosphere. My go to place at least twice a month. Amazing steak, chops, crispy rolls and Malaysian Curry. Decently priced in comparison to others well worth a visit!

site_logo

Mohammed Akhtar . 2024-09-12

MORE AT Google

Lovely place burger was lovely and noodles was very nice

site_logo

Leahanne Leek . 2024-09-07

MORE AT Google

Excellent service especially Hamza, who was very cordial and polite... also gave good recommendations.

site_logo

Leslie Fernandes . 2024-09-02

MORE AT Google

I didn't enjoy the noodles, there is a sweet taste I wasn't expecting. The chicken and prawns was great though

site_logo

Abimbola Lawal . 2024-08-29

MORE AT Google

very nice environment nice and quiet lovely service by Mahnoor very sweet lady

site_logo

Leen . 2024-08-28

MORE AT Google

Had a fantastic meal at Oodles Noodles! The sirloin steak was perfectly cooked, and the salmon was fresh and delicious. Big shoutout to our server, Hamza, for his excellent service!

site_logo

KIRAN KUMAR . 2024-08-26

MORE AT Google

Really, really impressed. Very well looked after by Hamza and the food was hot, tasty and delicious!! The mocktails were also very good. We will definitely be back.

site_logo

Mark . 2024-08-24

MORE AT TripAdvisor

I recently dined at this restaurant for the first time, and I must say, it exceeded my expectations. The food quality was exceptional, with the chicken burger and sirloin steak being particularly outstanding. I would also like to extend my gratitude to Divya, a member of the staff, for her prompt service and warm hospitality. I look forward to returning with family and friends in the near future.

site_logo

Michael G . 2024-08-23

MORE AT TripAdvisor

Read some very mixed reviews, especially about the service. Our waitress Mahnoor was attentive and friendly, the food was great, not too salty, decor was exceptionally clean and well maintained. Our lunch and service was flawless.

site_logo

Adam . 2024-08-23

MORE AT Google

I had the opportunity to dine at Oodles N'oodles 2 weeks ago, and it was a memorable experience from start to finish. Well this review might be a bit lengthy but is worth writing. The Tom Yam Soup was a standout, offering a delightful mix of heat and fresh flavours. The Chicken Shashlik was perfectly grilled, with just the right balance of spices, and the meat chops were succulent and full of rich, savoury taste. The service was equally impressive, with Divya, one of the hosts, going out of her way to ensure everything was perfect. I’ll definitely be returning and highly recommend this restaurant to others.

site_logo

Sarah Wilson . 2024-08-23

MORE AT Google

Mahnoor, lovely young woman, very helpful, we will come again

site_logo

Lynne Lucas . 2024-08-21

MORE AT Google

spring rolls 10/10 fries 10/10 katsu curry, oudon noodles, salt and pepper chicken this will be my new go to order

site_logo

sara pathan . 2024-08-20

MORE AT Google

The food was really tasty, and the Huraira service was wonderful!!

site_logo

Vamsi Yerra . 2024-08-19

MORE AT Google

Fantastic place, awesome food, huraira made us feel welcome, took good care of our table, I would be back again soon

site_logo

mohammad yousaf . 2024-08-19

MORE AT Google

Hamza was a lovely waiter and it made our evening 😄 The mojitos are awesome and the bathroom is very clean!

site_logo

Cool Cat . 2024-08-19

MORE AT Google

Brilliant, food was amazing, as was the service provided. Highly recommended!

site_logo

H Khan . 2024-08-17

MORE AT Google

Worst service ever Two men were useless we paid in cash inside were told all was well they then came out and said it was 10 short which it wasn’t and I could see them counting Too busy chatting rather than helping customers Had to ask for drinks several times before getting them Usually better staff god knows what’s happened now

site_logo

Hanif Uddin . 2024-08-16

MORE AT Google

Great food and brilliant service by Mahnoor. Their noodles burgers and chips are top notch!

site_logo

Hadiyaa Khan . 2024-08-13

MORE AT Google

I had a delightful and memorable evening at this establishment with my family. The culinary offerings were exceptional, and the ambience was captivating. The service provided by the staff was highly commendable.

site_logo

Shakeeb Anwar . 2024-08-07

MORE AT Google

Prices over here are too much. But compared for food is great quality. 👍🏽

site_logo

Salik Shaikh . 2024-08-06

MORE AT Google

Great place to dine. Brilliant food , parking just outside the venue, good service . Will definitely be back!

site_logo

G S (Joka) . 2024-08-02

MORE AT Google

Grilled chicken was excellent.

site_logo

Amjad . 2024-07-29

MORE AT Just Eat

had an amazing meal with my family. Hamza was very friendly and accommodating which made our experience better. Thank you for arranging a birthday surprise Hamza! 🥳

site_logo

Siti Nur Yasmin Muhammad Khadhri . 2024-07-26

MORE AT Google

Great choice of menu food cooked to order, give this place a try you won't be disappointed...fantastic mock- tail drinks....coming back very soon.

site_logo

paul hulett . 2024-07-20

MORE AT Google

Ordered half a chicken, mash & chips. Chicken was juicy and flavoursome! Mash was nice and creamy and chips were also good however it would’ve been even better if they had some seasoning on them or offered different variation of chips instead of just plain/chilli chips. Thats just me being picky! All in all a really good meal 👍🏽

site_logo

Abdul . 2024-07-15

MORE AT Just Eat

Nice and clean restaurant, delicious food.

site_logo

Daniel Wróbel . 2024-07-14

MORE AT Google

The best place to eat in Coventry, every dish I’ve tried is delicious. The service is always fast and servers are always kind. The place is also decorated beautifully so great for photos! Also whenever you get them delivered the food is also amazing and they pay attention to any requests you have! 10/10

site_logo

Sophia Kayani . 2024-07-13

MORE AT Google

Amazing food and ambience! One of my favourite places here! Hamza gave us a great service

site_logo

karishma sheth . 2024-07-12

MORE AT Google

I had Mahnoor as a server. She’s such a sweet and elegant lady. I’d give 5 star for her lovely service. Mahnoor made me feel at home. The menu in O Noodles is perfect, you can get a nice meal for a decent price and eat nicely. The atmosphere is lovely and clean. You’ll definitely have a good time here with a good team, you won’t regret it!

site_logo

Melanie Rego . 2024-07-10

MORE AT Google

Bang average. My second visit to the Coventry branch was not great. The meat chops were overcooked. We asked for chips and they arrived very late. I ordered noodles with beef they gave it to me with chicken. Then they gave me the correct order to my. The total portion side-by-side seemed less. The beef was very overcooked and chewy. On the plus side, the chicken grilled wings and chicken dumplings were very nice. Generally the waiter were very kind, courteous and friendly

site_logo

Anas Patel (Jim) . 2024-07-09

MORE AT Google

Vishnu & Hamza served us they were great and hospitable. Highly recommended, brilliant service and ambiance

site_logo

Saad Sheikh . 2024-07-09

MORE AT Google

I never write review but i have to so people know about how customers are treated at oodles noodles, Coventry located on A45. Food is acceptable and being a regular customer now and then i liked mango papyaa salad and chicken dumplings on online order. When i visited in person i saw hygiene was not good and water bottle was too dirty and i requested to change which was never done. I also found hair in food and when i said there is hair, i was told that it is in salad not in food & manager has no customer relationship attitude and was looking from far away & did not bother to explain situation. I had to pay for a food which i did not eat due to hygiene.

site_logo

Shahida . 2024-07-07

MORE AT Google

It's surprisingly nice ! This was a good surprise , I wasn't too sold at first because of the location and the outside look of it. But the inside was fun and clean. The service was efficient, and the food was not bad at all. Good non alcoholic cocktails options.

site_logo

Camille . 2024-07-04

MORE AT Google

Good food, good service, many tables, easy parking

site_logo

Kwin . 2024-07-03

MORE AT Google

Food is good. Service is good. Our service Hamza was also very accommodating!

site_logo

Natasha Agustin Ikhsan . 2024-06-27

MORE AT Google

hamza gave amazing customer service and made us feel very welcome. he was so nice and always had a smile on his face.he was very polite and respectful the food was amazing.

site_logo

Bob Ahmed . 2024-06-23

MORE AT Google

Coerced in here by my four year old niece who assured me she liked noodles better than nuggets and had been here before and liked it. Her mother confirmed neither of those statements are true. I decided to humour her after double checking that a Happy Meal wouldn’t be preferable and being told ‘I’m trying new things today’. Here are a few excepts from our dining commentary: Smell my (empty) plate it smells like roses. (It did not). It’s nicer here than McDonalds, it eats better, it looks better and they have those twirly lights. This is so yummy Hmm the serving here is good… and I like the decorations. Ignore that noodle I dropped it. This is my favourite place. Those leaves are poisonous it’s ivy (Plastic). A lovely outing very clearly enjoyed by all.

site_logo

Danielle Martine . 2024-06-22

MORE AT Google

Mahnoor n, served well and did an amazing job

site_logo

Simone K . 2024-06-22

MORE AT Google

Not for me look round the back to dirty seen the food going in from the van at the back

site_logo

Bob Ball . 2024-06-18

MORE AT Google

Not the first time ive been here with my wife. Great atmosphere and very polite staff but unfortunately the Noodles dish i had let me down this time. There was too much veg and not enough noodles and the portions seemed a little smaller this time. I did make a comment to the staff and hopefully they would take this onboard but nevertheless had a nice enjoyable meal out. Will definitely be back.

site_logo

SARAJ MURTAZA . 2024-06-16

MORE AT Google

The workers are so quick and efficient especially hamza who remembered what me and my sister ordered before and Charlene she is really nice and we have come here multiple times because of the staff honestly a 10/10 experience and with it being far from us it’s worth the drive the chefs are amazing the restaurant vibe is really really good. When it was Ramadan and we came to get there take out for iftar they were so quick and the food was amazing

site_logo

umehra gulzar . 2024-06-09

MORE AT Google

The food has been exceptional. We love being there and Hamza has been very kind and always attends with patience.

site_logo

sayoni chaudhury . 2024-06-05

MORE AT Google

Polite and helpful waiter. I forgot my glasses, he described the menu patiently, helped to choose. Food is excellent.

site_logo

Róbert Harangi . 2024-06-03

MORE AT Google

It's not somewhere you would think of going again really......

site_logo

Keith Procter . 2024-05-30

MORE AT Google

Very good food and friendly service.

site_logo

David Kay . 2024-05-24

MORE AT Google

Lovely food everytime we come here. Clean and great food. Service was fab from Mahnoor x

site_logo

layla L . 2024-05-16

MORE AT Google

I love this place! Great food great service ESPECIALLY HAMZA, very accommodating everytime!

site_logo

Ayeza Z . 2024-05-16

MORE AT Google

The good was really tasty. I really appreciate Huraira for his excellent service.

site_logo

Job Jose . 2024-05-15

MORE AT Google

This was a great place. Huraira served us. Good food and great service.

site_logo

ELSA MARY . 2024-05-14

MORE AT Google

It is an amazing place with the people who are all nice, especially Hamza he make me go there more and I am ordering there for over a year now and Hamza happiness make me happy and want to got there more I love the drinks and the food - love the steak - so it amazing.

site_logo

Tyrell Brown . 2024-05-13

MORE AT Google

Great place for a meal. Their chicken is on point! Great taste and flavour. Good amount of parking available The decor in the place is nice Staff are accommodating and helpful

site_logo

Nehman Younas . 2024-05-13

MORE AT Google

Lovely night out with the family for my daughter's birthday and amazing service from Mahnoor who also arrange a surprise cake for my daughter too. Thank you Mahnoor.

site_logo

Nafeesa M . 2024-05-09

MORE AT Google

Nice food with excellent hospitality from Hamza 🏅

site_logo

Iman Dayyani . 2024-05-08

MORE AT Google

Excelent service by Hamza👍🏼 Regards from Mexico

site_logo

Aldo Jiménez . 2024-05-08

MORE AT Google

Great food, and service. The staff member Hamzah, had great service and very accommodating.

site_logo

Imaan Khan . 2024-05-02

MORE AT Google

Good foor. Limited options but the spicy chips are delicious!!

site_logo

Anam Momin . 2024-05-01

MORE AT Google

Lovely food and great service from Mahnoor N. We have been here a couple of times and the service remains of a high standard.

site_logo

Thuli Biney . 2024-04-30

MORE AT Google

First time in Coventry and ended up coming here for a late lunch here with my parents. The food we had was very delicious . My top recommendations are the Mango and Papaya Salad, The House Special Soup, The Spicy Chicken Noodles and the Chocolate Lovin’ Spoon Cake. Cutting it short , every dish we ordered was well worth it. The staff, especially Hamza, were incredibly accommodating and the place had gorgeous decor and lighting. Overall, we had a wonderful time and if I lived near by i’d definitely become a regular !!

site_logo

Simone Mathias . 2024-04-22

MORE AT Google

First time in Coventry and the food we had here was very delicious . My top recommendations are the Mango and Papaya Salad, The House Special Soup, The Spicy Chicken Noodles and the Chocolate Lovin’ Spoon Cake. Cutting it short , every dish we ordered was well worth it. The staff, especially Hamza, were incredibly accommodating and the place had gorgeous decor and lighting. Overall, we had a wonderful time and if I lived near by i’d definitely become a regular !!

site_logo

simone m . 2024-04-22

MORE AT TripAdvisor

Nice pleasant place for families. Good quality food and reasonable priced. Friendly staff indeed.

site_logo

Jak carn . 2024-04-20

MORE AT Google

We had a takeaway delivered and it was delicious 👌 delivered on time & piping hot and the whole family thought it was very tasty. Thank you

site_logo

Lynnemiriam . 2024-04-19

MORE AT TripAdvisor

Dine in | Dinner | £100+ Went in there as a family of five , started was 10/10 drinks was fab but when it came to the mains we ordered chicken , no hesitation it came out black and raw ! It look absolutely revolting!!!!! I have pictures to prove and I’m reporting it to special health services!! It’s not fit to feed your kids it’s made my husband sick as soon as we left the door! We sent the chicken back and told the server and asked could we get that meal taken of the menu ( as we didn’t enjoy it ) and pay for the rest what we enjoyed! they started to argue and get offended cause we told them there food was not fit to eat and they started to say racist slang as to calling us travelers/gypsys and referring us as “ those people “ we are in no way gypsys or travelers and honestly I think some of those people are kind and genuine so heads up to all the travelers out there this place is extremely racist!!! Extremely rude and the food is not fit to feed your kids let alone a grown adult shame !!! SHAME !! Shame !!!! Hope you look forward to hearing from food services!!! Learn how to take feedback do better with your cooking ( hats off to one gentleman in the white shirt trying to sort the situation isn’t of arguing and crying like the other !!!) rude beyond measures!!! Do not go !!!!

site_logo

Olivia C . 2024-04-19

MORE AT TripAdvisor

The food was amazing, and the atmosphere was fantastic.

site_logo

Vijay Govindharaju . 2024-04-17

MORE AT Google

One of the best restaurants in Coventry. They should look for options specifically for vegan protein foods. Best wishes 😇

site_logo

Aravind Lochan . 2024-04-16

MORE AT Google

Food was very good, had ckn lollipop, ckn dimsum, mango salad, chilli ginger ckn, spicy chips and egg fried rice. For dessert we had the rasberry cheesecake, overall food was on point! Service by Mahnoor was 10/10! She was very attentive, thank you for a lovely bday meal.

site_logo

SHASTA . 2024-04-14

MORE AT Google

Good service by Mahnoor N and great food.

site_logo

Ravinder Dhillon . 2024-04-14

MORE AT Google

Mahnoor was very helpful, food was very tasty and service was good all round! Will definitely visit again

site_logo

sufyaan sattar . 2024-04-14

MORE AT Google

The food and service was great and the atmosphere of the restaurant was good and Hamza did provide a great service.

site_logo

Ryan Shaikh . 2024-04-13

MORE AT Google

Nice food, great staff but atmosphere was a bit dull. Had a bit of a liminal space vibe, could have done with some music But me and partner very much enjoyed the food, maybe if we go when it’s a bit busier it’ll have a better atmosphere

site_logo

Joshua . 2024-04-13

MORE AT TripAdvisor

We dined here for lunch and had such a lovely experience. Our waiter Hamza was very attentive and professional. The food was great as per usual, with good portion sizes. The kids menu is also great here. All round pleasant dining experience and we will be back!

site_logo

Shareen Khan . 2024-04-13

MORE AT Google

Delicious food. Great service by Hamza.

site_logo

Ramiro Ollervides . 2024-04-12

MORE AT Google

I ordered veg food. And the taste was really good. Got good service from Hamza.

site_logo

Foram Palan . 2024-04-12

MORE AT Google

Delicious food served at perfect temperature. Lovely vibes too. Hamza served us very professionally and in a friendly manner. Definitely recommend it.

site_logo

Aiyshah Hussain . 2024-04-12

MORE AT Google

The food and service was great. Hamza was our server, he was really kind and sweet.

site_logo

Leandra Furtado . 2024-04-12

MORE AT Google

Hamza who served us was amazing, service was incredible and food was outstanding

site_logo

Raihan Khattak . 2024-04-06

MORE AT Google

It has become our regular weekend place. The food is amazing specially chicken dynamite , house special soups and chocolate lovin’ spoon cake -that just melts in the mouth. Extremely welcoming and friendly staff. Special thanks to Hamza. Would highly recommend this place .

site_logo

Ritu Tiwari . 2024-04-05

MORE AT Google

Food wasnt that great. Very bland and tasted frozen.

site_logo

H Singh . 2024-04-05

MORE AT Google

It is always a pleasure to come back to eat here. The food was well cooked and sumptuous. The staff was also courteous.

site_logo

Damilola Folley . 2024-04-01

MORE AT Google

Just had a lovely family lunch at oodles noodles. Kids meal nuggets/chips, bespoke chicken noddles of out boy and full chicken platter for us. Great food, service from "HAMZA" and ambience.. Thanks to all...

site_logo

Suni Ludhera . 2024-03-23

MORE AT Google

Stopped in for a quick bite rather than the McDonalds opposite. Most impressive service from a team of truly polite people who are very attentive and courteous. Food was excellent. Will definitely put this onto our regular visit list!

site_logo

nickg1977 . 2024-03-23

MORE AT TripAdvisor

Food and service were excellent. Hamza was really good in his service

site_logo

Elizabeth Joy . 2024-03-23

MORE AT Google

I just enjoyed the tastiest chicken I can remember; perfectly cooked and the marinade was phenomenal. Why have I not tried this sooner?! A big thank you to Hamza who was the perfect waiter. Highly recommended.

site_logo

Scott Pladdys . 2024-03-19

MORE AT Google

Went to this place as a recommendation from some family friends adequate parking facilities were available and the building itself looks like cafe that was converted into a restaurant anyway we ordered some mixed starter and noodels . Waiters were friendly enough and the place was clean toilets were clean on too (yes it's a major thing for me and says a lot about staff hygiene levels) I'm therefore giving this place 5 stars .

site_logo

usman . 2024-03-17

MORE AT Google

Excellent quality, hot when delivered and well packaged

site_logo

Debbie . 2024-03-16

MORE AT Just Eat

Great ambience and people. Decent food. Hamza did a great service. Thanks

site_logo

Govind Ramesh . 2024-03-15

MORE AT Google

First time in this place and all I can say is wow!! The service was incredible, Mahnoor made us feel so welcome and took the time to explain the dishes to us and gave us the best recommendations! The food was absolutely superb, so tasty and authentic .. I have finally found a good tom yam that I can enjoy. We will be back again next week!

site_logo

Kimberley Kaur . 2024-03-14

MORE AT Google

The food was very good. Had a wonderful dinner time at oodles n oodles. Hamza was very friendly and kind. Would highly recommend.

site_logo

Feba Varghese . 2024-03-12

MORE AT Google

Similary restaurants in West Midlands

restaurant_img
4.3

112 Opinions

location-iconLynchgate Rd
Chinese
outdoor_seating_194123takeaway_194123delivery_194123

I love happy lemon the food and drinks are so amazing. They also have a bakery range which they release too. I find the shop easy to access. The cafe itself is very small so it would be a problem if it gets busy but it is often quiet. The service is good. Only issue I had was when I brought bubble waffle server placed this down by fan whilst making the second one and when paying £5 for this I would have preferred this warm but they handled the complaint well and served me up a new one so I feel their service is really good.

restaurant_img
4.3

1018 Opinions

location-icon2 Forknell Av
Chinese
outdoor_seating_160585takeaway_160585delivery_160585

I came to write a 5* review and was very surprised to read some of the 'recent' ones with low ratings....especially one by "Amar" who describes a restaurant experience which isn't this place!! We have had several takeaways from here and every one has been great. I usually collect on the way back from work so when I ordered our last one on sunday night online I accidentally left "collection" on the online order. When I called after an hour and we still hadn't received it, the girl explained what had happened and it needed collecting, i was gutted driving up there imagining what the food would be like after this time had passed. We had just got back from holiday and were so looking forward to it! When I got to Rice bowl, the lady in the kitchen popped her head out and offered to redo the chips and also the crispy beef because they would be poor quality now. I really appreciated half our takeaway being redone and still offered to do more, apologised that obviously they could not reheat rice for us etc. They completely redid the 2 dishes mentioned for free although it was MY mistake and I thought that was extremely kind and i really appreciate it. Definitely the best Chinese takeaway in Cov! I'm from kent and well traveled, apparently Chinese takeaway really varies across the UK and we have struggled finding a good one now we're settled here. This is IT!! :D

restaurant_img
4.2

245 Opinions

location-icon717 Tile Hill Lane
Chinese
outdoor_seating_232295takeaway_232295delivery_232295

One of the best Chinese takeaways! The food is always super crispy and freshly made. Really friendly service too. Definitely worth trying!! <3

restaurant_img
4.2

103 Opinions

location-icon23 Bennetts Rd S
Chinese
outdoor_seating_160241takeaway_160241delivery_160241

Brilliant customer service, brilliant food and super fast delivery. Totally recommend

restaurant_img
4.5

146 Opinions

location-icon198 Tile Hill Lane
Chinese
outdoor_seating_208113takeaway_208113delivery_208113

I was immediately put off my food when the delivery driver came to my front door with his grotty toes out. His breath absolutely stunk aswell. The food was piss poor aswell pretty sure my “beef” chow mein was some sort of horse meat.