GastroRanking-logo
whatsappWhatsapp
phoneCall
desktopWebsite
menuMenu
bookingBooking
3.6

Based on 876 opinions finded in 2 websites

site_photo3

Nº 569 in 813 in Derby

Nº 32 of 45 Indian in Derby

CUSTOMERS TALK ABOUT DISHES WITH..garliccheesepicklebeautifulmustpaymeatpickleschilliprawnprawnscurrycoffeechickencookedlambrice

comment_iconOpinions

Worst meal out. We hadn't been for a number of years, but it was always a good spot for a get together with friends, however, big mistake. First impressions was that it smelt fusty and damp. We were only offered the set menu, which comprised of the usual choices. The poppadoms wete bought to the table with one pickle tray for 6 of us, although we questioned this, they were poor anyway. Bendy old poppadoms that we couldn't eat, thin yogurt and inedible onions. We hoped it would get better for the next course. A few of us ordered the samosas, again another mistake, they were of the tiny frozen variety, obviously from a well known frozen retail shop nearby. The main course arrived minus one rice, we had ordered 3 nans and 3 rice to share, not difficult to add up when 6 diners. The currys did not taste homemade, more like a jar poured over meat, no onions cooked in ghee etc, just plain and tasteless We asked for a jug of water to share,and was served 3 bottles of water that we had to pay extra for. Then it was ice cream or coffee, the ice cream was literally half a hollowed out scoop and a bendy inedible wafer. Such a shame, the restaurant was virtually empty on a Thursday evening, only 2 other couples the whole evening. It used to be buzzing with people and atmosphere, but since the change of ownership it is now completely different story. We won't be returning.

site_logo

Georgina S . 2024-09-27

MORE AT TripAdvisor

The place itself is very small if you don't like been closed in I wouldn't recommend, food was done in good time not to fast but not to long. The staff were helpful and it's nice bringing your own drinks which saves on the pennies I'd return if I was in the area

site_logo

craig h . 2024-05-27

MORE AT TripAdvisor

CREDIT WHERE CREDIT'S DUE.... After leaving an honest but scathing review from the last time I ate at Moza it was pleasing to receive a call from the owner the next day to discuss the reasons for my review. After a good conversation I was invited to have a meal with my family at Moza to experience changes implemented.. So on May 18th I took my family for dinner to celebrate my daughters 21st. This time a completely different customer experience.. from start to end my party of 9 couldn't fault the service, the food or the customer service delivered by all the staff.. Our food was piping hot, very well presented and extremely tasty. Nothing was too much trouble. Even cooking a curry for 3 of my guests that wasn't on the menu ( Butter Chicken). Atmosphere was great and we all shared good laughs with the staff.. My last review was truthful and objective to allow a restaurateur to improve their service. I am delighted to say that everything I previously wrote had been addressed and I've had my trust reinstated to not only eat here again but to also recommend to others.. This was good customer service, lovely food in a great relaxed atmosphere.. and good value for money.. I hope this level is maintained for all future visits..

site_logo

Darren W . 2024-05-19

MORE AT TripAdvisor

The service was slow and food given wrongly, the soft drinks purchased were flat and refused to accept their own gift vouchers which were purchased from the premises at Christmas as gifts!!! rude, unhelpful and a completely unpleasant experience....will NEVER return and I advice others to be aware also!

site_logo

Darran C . 2024-04-20

MORE AT TripAdvisor

Last minute planned to go ear at restaurant so we went this indian restaurant, booked table but when looked reviews, decided to cancel , my mare his family been going there for 10 odd years so we went... they are fine, Low price, service as expected, food was delicious... I asked about reviews , they said look at reviews we only get one odd customer with bad experience , which can happen we are human but its people with bad experiences always rush to put comments to share frustration and feedback but most customers often don't write reviews as they good time ... .. I said I'll put mine very first time,though I don't do it often anyway

site_logo

Departure55611488068 . 2024-04-20

MORE AT TripAdvisor

Absolutely disgusting. Ordered food for takeaway, the chicken was black inside! Awful. Photo says a thousand words. AVOID

site_logo

Louise C . 2024-04-19

MORE AT TripAdvisor

Dear Moza management. I wanted to give you first hand my experience of your customer service. On Sunday 14th April I had reserved a table for 8 guests.. These were all my family. We were greeted by 2 female representatives who seemed to have it all on welcoming us.. we were told to go and sit down over there. ( not shown to our table). There were menus on the table that were tatty, battered and falling apart. As we have previously attended your restaurant many times in the past I was surprised not to be offered poppadoms and pickle trays while we decided our main courses. After 15 mins i ended up calling over one of the females from behind their counter to ask to take our order.. I asked if we could have poppadoms. Then gave our individual orders.. When we received our mains they were handed out like school dinners expecting the recipient to lean across and take it off the waitress.. I felt this was very poor customer service.. After she had handed out all the food she then handed out plates, again each member of my party having to reach over to get a plate. ( in the past the plates were warm and always wiped by the servers ensuring they were clean). As I poured my curry onto the plate and sampled it it was barely warm.. as was my wife's and sons curry's were I had to ask for water.. for a party of 8 I was given one bottle.. which was not chilled.. The 2 females on duty that night just kept returning to their counter to chat.. I had to request where my mushroom rice was and my wife's fries.. One of them would then go to the kitchen and return with them.. no apology.. This level of customer service is very different to what you used to deliver... In the past we received piping hot food, hot plates, food placed in front of us, we were asked if we'd like water for each guest, we were asked how our food was throughout the meal, we would be asked if we required anything further. Etc etc. On this occasion...NOTHING.. VERY POOR... there was no atmosphere, as you suggested in your last email, average to poor quality food and very poor customer service, from start to finish.. I will NOT be returning and will ensure family and friends are aware of the standards you seem to have now adopted.. Surprise, surprise, I left no tip.. I felt at a cost of £130 for our meals that this was not value for money.. I'm sorry to send such an email as I normally put finger to keyboard to praise customer service where its due as so many people these days just give negative feedback, but on this occasion I felt I had to give this feedback. I will also be adding this to your review on your website.. Regards. Monty.

site_logo

Darren W . 2024-04-15

MORE AT TripAdvisor

Ordered veg platter and they served a meat platter. Peshwari Nan had no flavour. Not sweet at all. Very doughy. Could not eat it. Main course disappointing. Again No flavour. Sweetcorn? Looked same sauce as my mums meat dish. Tasted meaty even though I asked for vegetarian. Mums dish very dry, salty and didn’t taste right. Girl waitress did her best with a smile. Need more focus on the food quality and flavour. Will not return.

site_logo

489ScottS489 . 2024-03-09

MORE AT TripAdvisor

We are very disappointed for the food quality we received today. All of the curries taste the same (plain and without any taste) the sauces of the curries are all the same, as ordered curry we have read the ingredients and what to expect of the curries each one of them. We were looking forward for the food as our friends were visiting us and the food usually is really nice and know what to expect. We have paid money for the food and expected the food to be enjoyable and eatable. We are really not happy with the quality of the food and unfortunately everyone has been upset at this unusual standard we have received today and i am upset to have to Contact , As we are all usually Happy with the food 🥲

site_logo

Agita G . 2024-03-02

MORE AT TripAdvisor

What a delight!! My wife were staying overnight in the local Travelodge and were looking for somewhere to get an evening meal. We were both very happy with the food and service at Moza. We recommend it. One thing to remember, they do not serve alcohol, but are more than happy if you bring your own. We didn’t know this, so the Tesco Local across the road came in really handy!

site_logo

Glyn W . 2024-02-20

MORE AT TripAdvisor

Decided to try moza for our Christmas Dinner. Was a little nervous as some reviews were not nice. So glad we did go was a set menu as Christmas day but food service was excellent. We shall be returning and I would recommend this restaurant

site_logo

Sarah G . 2023-12-28

MORE AT TripAdvisor

After reading some bad reviews my friends and I decided to try it for ourselves our opinion was great tasty meal ,very clean and staff were lovely .we will be returning

site_logo

648nicc . 2023-11-16

MORE AT TripAdvisor

Staff fantastic lovely and clean. Food excellent. I would recommend to anyone an enjoyable night great atmosphere.

site_logo

Jeanette L . 2023-10-05

MORE AT TripAdvisor

The restaurant was quite empty which I don’t quite know why , the food was absolutely amazing and the waiting staff were very pleasant and accommodating. We went there as a big group and I cannot fault the service we had nor the food , the toilets could do with a good old fashioned deep clean and a bit of a renovation but other than that it’s a spot on place and the food is amazing for the price 😘

site_logo

Emma H . 2023-09-01

MORE AT TripAdvisor

Met the new owner who came and introduced himself and made us very welcome. Excellent service and lovely food. Put our mind at rest as we have a large family booking coming up.

site_logo

rachelbT3561SB . 2023-07-21

MORE AT TripAdvisor

New management and new chef - never will we go there again. Brought the starters out, cold and not cooked. Asked to speak to management and to cancel the mains as we wasn’t happy, to be given a bill of £26 for starters that were pink and tasted like jelly. Once manager was confronted, he told us to leave and got very agitated. Not the only ones who were leaving either complaining of the same thing 🤮

site_logo

Beth B . 2023-07-06

MORE AT TripAdvisor

We ordered a family takeaway, half portions of curry and a quarter bag of chips, food was just warm.phoned them just to be told its new management and chef.really not good enough

site_logo

Linda H . 2023-06-18

MORE AT TripAdvisor

We regularly visit this restaurant……or did! It has just changed hands and we weren’t aware when we went. The food was quite bland and not to its usual standard. Very disappointed. Also queried the bill as we had the set menu for 4 of us which should have meant our bill was £56. We had asked if we could upgrade two of the main courses and were told we could but we were charged over £20 to do this when the price of the curry from the al la carte menu was £11.99! We had one extra rice and one extra naan and were charged more than the menu price for these. In essence charged £28 extra for this. Tried to explain several times only to be told it’s the fault of the till. We ordered our usual dish which came without a sauce. I asked where the sauce was and they brought out the base of the source which was like tomato soup. We asked for a lime pickle only to be told they had no limes but had lemons and asked if we would like lemon pickle instead. This issue was however resolved. We just found it amusing as never heard of lemon pickle. All in all, won’t be returning which is disappointing. Good luck to the new owners but I think you have a long way to go to match the previous owners and chef.

site_logo

Jane s . 2023-06-18

MORE AT TripAdvisor

Very nice food but it came with 2 nans short

site_logo

Mick . 2023-06-17

MORE AT Just Eat

Food was fresh and tasty, reasonably priced and delivered quite quickly. Would recommend and use again :)

site_logo

Sally . 2023-05-12

MORE AT Just Eat

Really disappointed in first order. The tandoori chicken tikka main consisted of 4 tiny chunks of chicken (smaller than a starter portion). The raita was literally a carton of yoghurt, no sign of mint or cucumber. The tikka masala was a strange brown colour and tasted nothing like masala. The chips were inedible, so hard and obviously reheated a few times, although strangely cold. The naan breads were badly burnt and had bits of charcoal through them. Wont be visiting again.

site_logo

Nicola . 2023-05-12

MORE AT Just Eat

Great food again would recommend 😋

site_logo

Mick . 2023-05-12

MORE AT Just Eat

Another fabulous takeout meal. Food very fresh, tasted amazing, generous portions. It really was as if Moza chefs had prepared meals in our kitchen, straight to table! Highly recommended x

site_logo

Marie . 2023-05-05

MORE AT Just Eat

Poor service over 1hr late. Called the restaurant a couple of times to chase.

site_logo

paul . 2023-04-23

MORE AT Just Eat

Great food, but let down by late delivery and poor customer service. 30 minutes late this time. Over an hour late last time we ordered. Excuse given was that they were busy. No attempt to notify us that they were running late either. Both times I've had to contact them to ask where our food was. If I order again I will collect. Maybe then we'll get the food on time?!?!?

site_logo

Mark . 2023-04-21

MORE AT Just Eat

Outstanding food and service as ever 10/10

site_logo

Paul . 2023-04-09

MORE AT Just Eat

Delivery was so late it was hard to enjoy the food at all. The quality wasn’t good enough. Couple of items incorrect. Food was luke warm at best. Not a good experience.

site_logo

Simon . 2023-03-20

MORE AT Just Eat

Food was cold and greasy . Turned up close to 1 hour late, called twice but only told its busy and food is on its way. Food wasn't good. Saag paneer was nice, rest was poor

site_logo

Adam . 2023-03-18

MORE AT Just Eat

Worth waiting for great food any busy restaurant means great food 😋 recommended 👌

site_logo

Mick . 2023-03-17

MORE AT Just Eat

Well, quite surprised .on the food quality..went quite a few years ago to the restaurant and the smell of spices as we went in and next day was off colour..But credit due this evenings meal was absolutely outstanding. Well done 👏 to your chefs

site_logo

Gail . 2023-02-24

MORE AT Just Eat

Not enough meat. Not the same quality of the food as it used to be. Shame

site_logo

Krystian . 2023-02-21

MORE AT Just Eat

Fantastic freshly cooked food would recommend 😋

site_logo

Mick . 2023-02-18

MORE AT Just Eat

Chips were overcooked. No garlic on naan. Meat really tough on mixed grill. Sauce tasted of nothing.

site_logo

Samantha . 2023-02-17

MORE AT Just Eat

The meal was the best indian food we have had in a long time. Will definitely have food from there again. Very fresh and hot, plentt of flavour and quality food used

site_logo

Wendy . 2023-02-15

MORE AT Just Eat

Absolutely amazing food great freshly cooked currys friendly delivery, 6 adults £70 after 20% off would recommend 😋

site_logo

Mick . 2023-02-10

MORE AT Just Eat

Food was barely warm, had to reheat at home, spoilt the meal, wouldn't order online again but always very nice when go for meal at the restaurant itself

site_logo

Christina . 2023-01-26

MORE AT Just Eat

The meal was really good and I was surprised for quick service. I absolutely love it I will order again

site_logo

Maria . 2023-01-23

MORE AT Just Eat

25 mins late, food were lukewarm but edible. They should’ve let us know they running late.

site_logo

Marie . 2023-01-14

MORE AT Just Eat

Once again awsome food 😋 great value 👌 definitely recommend 👍

site_logo

Mick . 2023-01-13

MORE AT Just Eat

Absolutely amazing food and on time definitely recommended 👌

site_logo

Mick . 2022-12-31

MORE AT Just Eat

Fantastic, fresh, gorgeous food as always. Thank you x

site_logo

Marie . 2022-12-10

MORE AT Just Eat

This is our go to for Indian cuisine. Our takeout meal was sensational. Fresh, tasty beyond words, generous. port

site_logo

Marie . 2022-11-28

MORE AT Just Eat

Foods lovely, just cold having to reheat it and I didn’t get garlic and cheese naan but plain

site_logo

Bethan . 2022-11-26

MORE AT Just Eat

Yet another fantastic take away from Moza. Super fresh food. Tasted out of this world. Generous portions. Excellent value. Many thanks x

site_logo

Marie . 2022-08-26

MORE AT Just Eat

Always loved moza, especially the tikka, but this was awful. Curry was bland and colourless, chicken was chewy and rubbery and the chips weren’t cooked properly. This wasn’t cheap either, £29! Wouldn’t mind if it was enjoyable but none of us ate it, went straight in the bin. Only good bit was the cheese naan. Wont be going/ordering again. Sorry to moan, I never write reviews, but this was our Saturday night treat that was disappointing.

site_logo

Hannah . 2022-06-26

MORE AT Just Eat

Food not tasting right this time weird take to all Curries

site_logo

Vicky . 2022-06-26

MORE AT Just Eat

Everything was amazing except the chips. We're very dry and didn't seem fresh. Curry's and nan bread was great!

site_logo

Scott . 2022-05-14

MORE AT Just Eat

No where near as good as expected Wifes korma had little flavour Chips appeared to be yesterday's reheated as they were dry and rubbery Nan breads were doughy just like they weren't cooked fully

site_logo

Mark . 2022-05-14

MORE AT Just Eat

Best curry we've had for a while

site_logo

Barbara . 2022-05-12

MORE AT Just Eat

The food was delicious, however it was cold when it arrived and it arrived late, hopefully it was just a one off?

site_logo

Janet . 2022-05-07

MORE AT Just Eat

The food arrived cold and tasted like it had been microwaved

site_logo

Chris . 2022-04-22

MORE AT Just Eat

Small portions and ordered cheese and garlic Nan and got plain !!

site_logo

Claire . 2022-04-18

MORE AT Just Eat

Saying we've been and sat in moza and the food was great. There must be a different kitchen cooking this slop. Naans dry, currys all bland. Missing naans. Just all poor food but at full price. Just lost a customer.

site_logo

Keith . 2022-03-25

MORE AT Just Eat

Hot, fresh and delicious as usual.

site_logo

Nicola . 2022-02-20

MORE AT Just Eat

Ordered from Moza quite a few times and often find that the food is late. I tried calling the restaurant several times, I’m unsure if their phones were off as the same message was played each call without it ringing. The food was 2.5 hrs late and when it was arrive, it was hot, but poorly made. The curries were watery and poppadoms soggy. Not what you’d expect after paying £45 for a takeaway meal.

site_logo

Holly . 2022-01-01

MORE AT Just Eat

Food was lively just chips wasn't brilliant but overall curry and everything was bang on

site_logo

Jade . 2021-12-24

MORE AT Just Eat

Food was cold chips were hard & dried up disgusting for saying I pre ordered it complete waste of £16 not happy 1 bit !!!!

site_logo

Jen . 2021-12-20

MORE AT Just Eat

Food is great but I ordered mushroom pakoras and a received mushroom puri. Need to work on getting orders correct as this has happened a few times before with different items.

site_logo

Zara . 2021-12-05

MORE AT Just Eat

The food was freezing. The delivery was late and we got the wrong food.

site_logo

Zakk . 2021-12-05

MORE AT Just Eat

We ordered 4 popadoms for £2.40 and got a small brown paper bag of pieces. Both curries were definitely the worst we have ever had. Absolutely tasteless. I genuinely think that the chef totally forgot to add any spices. They were both entirely without any flavour or salt. Awful I'm afraid.

site_logo

Paul . 2021-11-27

MORE AT Just Eat

Great food with a good amount of spice our No1 Indian restaurant to eat in or take away. 10/10

site_logo

Paul . 2021-10-31

MORE AT Just Eat

Rice was missing Ordered at 18.25 came at 20.10 Had to reheat Sorry won’t order again I’m afraid

site_logo

kelly . 2021-10-15

MORE AT Just Eat

2 and a half hours for 2 curry’s and a portion of chips and 3 popadoms. The korma was more of a soup where you had to hunt for the chicken… we ordered at 7:15 in the evening and we didn’t get to eat until 10pm! There was no apology. I tried to call them 200 times literally left my Phone on redial and the phone was permanently engaged no way was it that engaged for that length of time it had obviously been left Of the hook because so many were chasing orders. When it turned up luke warm late at night the driver just looked at me and said do you even want it he even knew how late it was. Well I had already paid and we were hungry definitely wasn’t worth spending £20 and wasting my Saturday night waiting and trying to chase it.

site_logo

Kim . 2021-10-04

MORE AT Just Eat

Ordered at half 7 on Saturday and took till 11 to be delivered. Rang up 3 times to check on the order and was met with the same answer it’ll be here soon and plenty of apologies, beating in mind it’s only 10 mins away a bit of honesty would’ve gone a long way but I was lied to every time as I rang in 15 minute intervals, when challenged all the man who answered did was apologise more and not give any explanation, food was nice but don’t think any food is worth waiting that long and being lied to, would be willing to give them another chance but not given me good first impressions.

site_logo

Alex . 2021-10-03

MORE AT Just Eat

The food was late, when it arrived it was horrible rice was cold with water coming out of it and the currys had no flavour. The naan breads felt damp and tasted wet.

site_logo

Mark . 2021-10-02

MORE AT Just Eat

1hr 40 min late and cold food, restuarant pretend not to hear you on phone, trying to get a refund but the just eat app keeps cutting off....rubbish all round really. Will not reorder from here or through just eat.

site_logo

Christina . 2021-10-02

MORE AT Just Eat

Seriously delicious, fresh and generous portions of the best Indian take-out. Moza just get better and better! Highly recommended. X

site_logo

Marie . 2021-09-25

MORE AT Just Eat

Lovely food asked to not have fresh coriander which they did great service

site_logo

Stephen . 2021-08-28

MORE AT Just Eat

Another superb meal from Moza. Very fresh. Generous portions. Compliments to the chefs! It was as if they'd cooked the meal in our home and served straight to table. Highly recommend. Thank you x

site_logo

Marie . 2021-08-20

MORE AT Just Eat

Beautiful hot, fresh and tasty food.

site_logo

Nicola . 2021-08-20

MORE AT Just Eat

During lockdown this was a new edition to our takeaway catalogue, great food and really tasty. Sadly now they obviously concentrate on the restaurant. Tonight’s food was nearly an hour late ( meaning 2 hours from order) and was bland and cool. Our pickle tray was a small pot of onion pickle and the food lacked spice. I’d say it was a one off but the previous one we had was the same, late and flavourless (greasy too tbh) we gave them the benefit of the doubt and they failed to convince us. Sadly probably the last takeaway we will have from them. Very expensive for what they produce now and a real shame. We would love to support them but they need to raise their game again

site_logo

4nn13 . 2021-08-12

MORE AT TripAdvisor

There was a strip of plastic in the nann bread there was very little meat in the dish there was only 2 pickles with the pickle tray no mango and no lime the food was very disappointing and we will definitely not order again

site_logo

Samantha . 2021-08-06

MORE AT Just Eat

Food was late and not very warm. When I called the restaurant the attitude was disgraceful. This was my first and last time

site_logo

Tammi . 2021-08-02

MORE AT Just Eat

Simple order and Missing food (naan). Moza off my bucket list 😞

site_logo

Ian . 2021-07-31

MORE AT Just Eat

Wasn’t impressed by Moza at all tonight unfortunately… forgot our chips, pickle tray with no mango chutney and a Jalfrezi with more chillis than chicken of which was tough as old boots.. thought we’d try a different takeaway but it doesn’t come close to our regular in Spondon sadly, perhaps it just wasn’t our night as we’ve heard others give really good reviews.

site_logo

Jonathan . 2021-07-23

MORE AT Just Eat

Moza meals/take out just get better and better. Very fresh. Superb taste. Excellent value. Highly recommend.

site_logo

Marie . 2021-07-17

MORE AT Just Eat

Nice food, delivered on time. Ordered 2 pickle trays and only received 1, I know it's only a pickle tray and it's not like you pay a lot for it but it seems moza always forgets something, chips last time, wrong curry the time before. If they could sort this out they would be number 1 for a curry for me.

site_logo

Nigel . 2021-07-12

MORE AT Just Eat

Soft popadoms , masala curry quite sweet taste. And chips where awful. But fried rice spot on.

site_logo

Julie . 2021-07-09

MORE AT Just Eat

As the restaurant is unlicenced we bought our own alcohol. I asked if I needed get ice, and they said no because they had plenty. The website says they are open from 5.30 - 11.00 monday to sunday At 10.30pm we asked for some ice to have a final drink (by this time the meal had been paid for) they said they had no ice left and that they had closed at 10.00. The staff made it blatantly obvious they wanted us out and waited by the door staring at us, so we got up and left straight away. We didn't get any response of goodbye or thank you or have a good night, just silent staring as we walked out. Very strange!

site_logo

karen q . 2021-07-04

MORE AT TripAdvisor

Fabulous takeout. Very fresh. Just delicious. Thank you x

site_logo

Marie . 2021-07-03

MORE AT Just Eat

Thoroughly enjoyed our dining experience last night, having just moved to the area we were thrilled with our find. And will defiantly be back with friends in the near future! Every member of staff was pleasant and the food was just as good. Thank you.

site_logo

kocallaghan101211 . 2021-06-05

MORE AT TripAdvisor

Food was disappointing. Dry chicken. Black chips. Wouldn't order again.

site_logo

Stacey . 2021-05-05

MORE AT Just Eat

Disappointed with food and service.

site_logo

Pete . 2021-05-01

MORE AT Just Eat

food was 30 mins late, then when we got it it was cold, had to reheat everything in the microwave, they labelled the curry incorrectly, will never order from here again, just try somewhere else

site_logo

millie . 2021-04-28

MORE AT Just Eat

Yes they forgot the chips but the rest of the food we got made up for it :) lamb was delish!

site_logo

robert . 2021-04-09

MORE AT Just Eat

It's always a great experience from moza top grub

site_logo

clinton . 2021-04-02

MORE AT Just Eat

Ordered from Moza for the first time this evening and really impressed. Ordered online to feed a hungry family of four and collected which saved some money. All the curries, rice and Nan bread were excellent and leftovers for another day. Will definitely use again and try out the restaurant when it reopens.

site_logo

426garryk . 2021-04-02

MORE AT TripAdvisor

Stunning food, red hot and arrived early! ate here when it was a restaurant and it was always great but was always disappointed by takeaway until now 10/10 Moza 👌

site_logo

Paul . 2021-03-18

MORE AT Just Eat

Great food once again !! Delivery on time !! All good !!

site_logo

grant . 2021-03-13

MORE AT Just Eat

We paid £11 for a Mix grill that came in a tiny curry container. There was not even £4 worth of meat in it. The cheese on naan bread we ordered was slapped on in one place and the naan just became a ball, If I could show a pic of it you'd be disgusted with the quality.

site_logo

dale . 2021-03-08

MORE AT Just Eat

We just love the food from mosa, eat in or take out the quality is always good

site_logo

Kenneth . 2021-03-07

MORE AT Just Eat

Great customer service and very helpful my son enjoyed his Saturday night treat great tikka masala Thank you guys :)

site_logo

Andrew . 2021-02-27

MORE AT Just Eat

I am a loyal customer of Moza and normally the food is the best in town. Today it was 2 hrs from ordering (45mins late). The food was cold as there were a number of drop offs before coming here. Naan bread was half cooked (normally the best naan in town). I have been really disappointed in this meal/service and would have rather been told that they couldn’t fulfil my order if they couldn’t provide a quality meal/service @£32 for 2 people.

site_logo

Anthony . 2021-02-27

MORE AT Just Eat

Ordered delivery, food arrived cold and also correct food wasn’t given. We rang up to say our food was cold, to then be told it wasn’t cold!!! We said we wanted a refund as the food is not edible enough to eat. They then turned round to say refund could take 14 days as they do not refund if you’ve ordered off THEIR website, they told us many of times that they’d do us a fresh order but told it would be a 25 minute wait or we could collect in 15 minutes? We said it’s too much hassle and the customer service was disgusting speaking disgustingly to us. We then picked up our order for food to be only to be warm, and only 6 pieces in the chicken tikka masala which was a joke. The food wasn’t even nice. WE will NOT be ordering here again. Nann bread was horrible, cold and the smallest Nann bread ever for £2.95 and the chips looked like they’re from Asda the crinkled chips. Not impressed at all. WASTE OF MONEY!!!!!

site_logo

Kirstykirk2020- . 2021-02-25

MORE AT TripAdvisor

Alway great food and top delivery

site_logo

Andy . 2021-02-17

MORE AT Just Eat

Fantastic quality. Great food. Very impressed. Would order again

site_logo

Garreth . 2021-02-14

MORE AT Just Eat

Took 2 hours to arrive, completely wrong order but the food was very nice, the fact that the food is very nice is saving me from giving a terrible review. Take more care with your deliverys!

site_logo

chris . 2021-02-13

MORE AT Just Eat

The food was absolutely beautiful! Very tasty and I would highly recommend. The delivery wasn’t a problem because it did say estimated time and we did order a lot but it did come later than I had hoped. The delivery guy was extremely polite and very friendly and a credit to your restaurant. I will be ordering again in the future:)

site_logo

Katie . 2021-02-12

MORE AT Just Eat

Garlic chicken was that salty it was not edible, the rice was really dry and salty as well the cheese and garlic Naan the cheese was like it was put on top and not melted plus. The chicken shaslik was really dry and bland. I would not be recommended to anyone.

site_logo

Philip . 2021-02-05

MORE AT Just Eat

You could definitely taste that every single item that was ordered was defrosted, even the cheese on the garlic and cheese nan would not melt even after being put in the oven because it was frozen cheese, raita was curdled with clear residue left on top of it, again could tell it was defrosted & was still frozen a little bit in the middle. Salad that came with my meal literally consisted of 3 lettuce leafs and a piece of carrot. Would not even recommend for a dogs dinner.

site_logo

Jorgie . 2021-01-24

MORE AT Just Eat

Similary restaurants in East Midlands

restaurant_img
3.8

597 Opinions

location-icon194 Normanton Road Normaton, Derby DE23 6UX England
Indian
outdoor_seating_268226takeaway_268226delivery_268226

It’s ok for a quick munch nothing special apart from that and price wise ok

restaurant_img
3.9

1338 Opinions

location-icon254A Stenson Road
Indian
outdoor_seating_223241takeaway_223241delivery_223241

Absolutely the best kebabs in the business the tarka is delicious and the chef has it to a t. The staff are very perlite we do not order from anywhere else.

restaurant_img
4.0

78 Opinions

location-icon40 Chapel St
Indian
outdoor_seating_162284takeaway_162284delivery_162284

Great food delivered hot and delicious

restaurant_img
3.3

177 Opinions

location-icon637 Harvey Rd, Alvaston
Indian
outdoor_seating_319227takeaway_319227delivery_319227

always a gd service and excellent food

restaurant_img
3.3

105 Opinions

location-icon275 Blagreaves Lane
Indian
outdoor_seating_199808takeaway_199808delivery_199808

Cheap and cheerful,posted before ?