GastroRanking-logo
whatsappWhatsapp
phoneCall
desktopWebsite
menuMenu
bookingBooking
4.5

Based on 2.499 opinions finded in 2 websites

site_photo3

Nº 127 in 770 in Wolverhampton

Nº 13 of 57 Indian in Wolverhampton

CUSTOMERS TALK ABOUT DISHES WITH..cookedspicycurrytandoorichilliburntfishchickenprawnricesaladcheeselambgarlicmeatonionbeautiful

comment_iconOpinions

Muy buena comida, gran ambiente y el personal es muy amable también. Precios razonables y un montón de elección para los vegetarianos. Definitivamente volveré.

site_logo

Eloma217 . 2025-02-05

MORE AT TripAdvisor

Buena comida. Los especiales son maravillosos. Personal amable y atento. Fácil de reservar en la aplicación. Traiga su propio alcohol: hay un par de supermercados cerca.

site_logo

Ian B . 2025-01-12

MORE AT TripAdvisor

Pedido en línea para la recogida - dijo 20 - 30 minutos de espera. Llegó al restaurante 45 minutos después, dicho pedido estaba siendo empacado. Sentado en el restaurante durante otros 35 minutos esperando que le dijeran repetidamente que el pedido estaba siendo empacado, mientras que están tomando pedidos diciéndole a los clientes por teléfono que son 20 - 30 minutos

site_logo

leanneware16 . 2024-12-31

MORE AT TripAdvisor

Amazing meal. Staff very attentive. Will be back asap. Best curry we've had in a while. Would highly recommend. 5 stars.

site_logo

Jessica V . 2024-12-29

MORE AT TripAdvisor

Excellent service from start to finish. Welcoming and exceptional food and service. Nothing too much trouble. Will definitely return. 5*

site_logo

jessica B . 2024-12-27

MORE AT TripAdvisor

Visited with another couple. The food was fantastic and staff so friendly. Each of us enjoyed our meal; could not fault at all. It’s bring your own drinks, which meant the night was affordable too.

site_logo

Carol F . 2024-08-31

MORE AT TripAdvisor

Absolutely superb. Wonderful food and welcome, outstanding service. Everything has the personal touch. There is a delightful atmosphere to the place - unhurried yet punctual, with time to talk and relax. The best Asian restaurant in Wolverhampton by far!

site_logo

Damian F . 2024-08-26

MORE AT TripAdvisor

What an excellent evening celebrating a 70th birthday. We pre booked off the menu for 20 people. From the initial communication when we booked it to leaving the restaurant, it all went extremely well. The service from all the staff involved was first class. The food was delivered in the most timely and efficient way. ....and the food was absolutely amazing. All 20 guests were very complimentary about the venue, the service and the food. Special call out to H, who was attentive throughout..but all the staff were fantastic. Thanks for a lovely evening. Would highly recommend 👌 xx

site_logo

Fran . 2024-08-25

MORE AT TripAdvisor

Went here last night and had a lovely time. The owner was amazing and provided such good customer service along with the other staff being extremely friendly. The food was spot on. The whole experience was perfect for me and would definitely go back again. Thank you guys for making it such an enjoyable experience !

site_logo

Tour11755281200 . 2024-08-09

MORE AT TripAdvisor

Ordered the Tandoori King Prawns starter, Scallops Bhuna and Garlic Naan. Absolutely couldn't fault of any of it and huge compliments to the chef for being able to cook the scallops to PERFECTION. Great banter with front of house as well. Really really enjoyable evening and having sampled bits off other people's plates (Chicken breast, Sea bass) I can see that this restaurant knows how to cook a variety of different food extremely well. For me the Bilash still reigns supreme but without question and without hesitation, Kaptin Korma is my second favourite in Wolverhampton!

site_logo

Theo N . 2024-07-22

MORE AT TripAdvisor

Beautiful food. Friendly service. Lucky to have this restaurant on our doorstep. Nothing is too much trouble for staff and they will cook the meals to your preference. Always look forward to going there.

site_logo

DayTrip07072749675 . 2023-11-26

MORE AT TripAdvisor

The best of the best. Waiter was very friendly and personable. Couldn’t do enough to help us. Service punctual and food quality and taste was superb. Price is reasonable. On street parking outside. Couldn’t ask for more.

site_logo

jamesaP6395JF . 2023-10-23

MORE AT TripAdvisor

My mom and I visited tonight (23/09/23) for the first time. The food was absolutely amazing…you could tell everything was freshly made. The service was so good such pleasant lovely staff. The tables, cutlery and general cleanliness was impeccable and a great atmosphere! Really enjoyed it…and would 100% recommend this lovely little piece of Indian heaven x

site_logo

Racheal G . 2023-09-23

MORE AT TripAdvisor

This was an excellent restaurant, very clean, food was amazing and our waiter Raj could not have been more welcoming and helpful

site_logo

PaulyC1966 . 2023-07-17

MORE AT TripAdvisor

Really tasty delicious food and super fast delivery

site_logo

Mr . 2023-07-04

MORE AT Just Eat

Rice tasted like micro wave rice vinegary balti to spicey compared to other balti the other curry buma was very salty will not be ordering from here again

site_logo

Lee . 2023-05-14

MORE AT Just Eat

Great food as always. Never have a bad meal, food is always piping hot and tasty. Always arrives on time!

site_logo

Sophie . 2023-05-11

MORE AT Just Eat

Food was piping hot but chicken chaat puri was slightly salty and needed more flavour and the puri sits on top of the chicken chaat in the box, making this very messy to eat. Other dishes ordered were nice.

site_logo

Perminder . 2023-04-30

MORE AT Just Eat

Food was fantastic, it was lovely and hot, it came within the time stated,and the delivery driver was very polite. Will be ordering from there again.

site_logo

sania . 2023-04-22

MORE AT Just Eat

Gorgeous food, friendly, great service

site_logo

TRACEY . 2023-04-18

MORE AT Just Eat

The food was amazing arrived nice and hot thank you.

site_logo

karen . 2023-04-14

MORE AT Just Eat

Great food and delivery as usual👍

site_logo

Lee . 2023-04-10

MORE AT Just Eat

staff were very friendly food was really nice just a bit pricey

site_logo

Kimberley . 2023-04-10

MORE AT Just Eat

Food was amazing once again, thank you.

site_logo

Wayne . 2023-04-09

MORE AT Just Eat

Always excellent food delivered quickly and piping hot. 5 stars

site_logo

Jane . 2023-04-07

MORE AT Just Eat

Great tasty curries delivered quickly, fresh and hot. Best tasting Indian food around…!

site_logo

Paul . 2023-03-26

MORE AT Just Eat

Ordered from here a few times now. Really good food and nearly all the times they were about 30mins which is really good service. Will order again

site_logo

Thomas . 2023-03-25

MORE AT Just Eat

2nd visit and did not disappoint. Very friendly and helpful staff, food is quick and very good standard Take your own booze

site_logo

MommaH83 . 2023-03-23

MORE AT TripAdvisor

Although the delivery was a bit late, the food was still fantastic. Wouldn’t order from anywhere else

site_logo

Marian . 2023-03-18

MORE AT Just Eat

Excellent food as always, the lamb tikka balti was particularly good. Full of flavour and good portion sizes, too. Fully recommend!

site_logo

Karen . 2023-03-17

MORE AT Just Eat

I was quite surprised on the size of the keema rice portion, it was a like a very small side portion. The rice itself was very colourful and looked fantastic, but it really had no flavour and was pretty bland and slightly chewy. Will try a different option next time.

site_logo

Mr . 2023-03-12

MORE AT Just Eat

Food was absolutely great as always

site_logo

Mr . 2023-03-11

MORE AT Just Eat

Aside from getting a Korma when I ordered a Tikka Food was great!

site_logo

Colin . 2023-03-10

MORE AT Just Eat

Tonight was the first time visiting the restaurant as we usually order in at home and we couldn’t fault it. The food was delicious and full of flavour. The service was exemplary, they really couldn’t do enough for us and to top it off they surprised me by bringing out some chocolate cake with candles, singing happy birthday! We have tried a few curry houses in Wolverhampton and this is by far the best, we’ve never had a bad experience and now we’ve been to the restaurant, we’ll definitely be back!

site_logo

241rebeccak . 2023-03-07

MORE AT TripAdvisor

Excellent birthday meal for my partner and our family. The food was excellent and waiter was really nice man. It was our first time in the restaurant though we always order our takeaways from here and just like always, it didn’t disappoint. We will definitely come again.

site_logo

DanBMids . 2023-03-07

MORE AT TripAdvisor

Really tasty food, amazing value for money. Came with free poppadom, salad and sauce. My only negative is that the food was not as cooked hot as it could be. Would I order again, yes !

site_logo

Mark . 2023-02-28

MORE AT Just Eat

Very welcoming people, food was amazing. Will definitely be going there again.

site_logo

Vikki . 2023-02-25

MORE AT Just Eat

The chicken biryani hot and spicy was absolutely delicious and perfectly cooked. The food was delicious. Top marks from us. Will definitely be ordering it again.

site_logo

Mr . 2023-02-25

MORE AT Just Eat

The food was absolutely delicious, can’t wait to order again.

site_logo

Mr . 2023-02-25

MORE AT Just Eat

The food usually is super good from here but today wasn’t as good. Food was late & then the curries were so salty, me and my friend said the same (2 different curries) we couldn’t eat them. Chips were cold and the only decent thing was the Naan & rice. Wasn’t worth £35… disappointing really.

site_logo

Kirstie . 2023-02-24

MORE AT Just Eat

Chicken tikka was fantastic , always have excellent food ! Wouldn’t go anywhere else.

site_logo

Juls . 2023-02-24

MORE AT Just Eat

Absolutely beautiful food easy 5 ⭐️

site_logo

Paula . 2023-02-17

MORE AT Just Eat

Wouldn’t order from anywhere else

site_logo

Marian . 2023-02-16

MORE AT Just Eat

Excellent food, delivered in good time👍

site_logo

Lee . 2023-02-12

MORE AT Just Eat

Really nice, you need to include a free naan on the tandoori mixed grill at that price

site_logo

Tim . 2023-02-11

MORE AT Just Eat

Amazing hot food served which was impressive, we also had starters mains and desserts. And the mock tails were so refreshing and delicious. Customer service was so welcoming and friendly

site_logo

rumib2021 . 2023-02-11

MORE AT TripAdvisor

The food was amazing so fresh and tasty! Lovely staff welcomed us so nicely and was very friendly. Will definitely visit again

site_logo

myshab2023 . 2023-02-11

MORE AT TripAdvisor

Great food, all tasted freshly prepared

site_logo

Damian . 2023-02-05

MORE AT Just Eat

Fast delivery.great food always hot will buy again

site_logo

kate . 2023-01-31

MORE AT Just Eat

Always high quality, my favourite parathas are from here (thin and flexible enough). I accidentally ordered two shashlicks and they called me to double check that was correct - it wasn’t (my fault) and a refund was swiftly sorted out. Excellent service every time.

site_logo

Rebecca . 2023-01-30

MORE AT Just Eat

Driver, excellent, read instructions to property, got to property fine, then thanked me for instructions which was nice and very rare from drivers at other establishments. Food quality again, faultless. Very enjoyable, thank you very much!

site_logo

Colin . 2023-01-28

MORE AT Just Eat

Amazing food, service and delivery time! Can't ask for more to be honest. Favorite place to order from in Wolves.

site_logo

Joseph . 2023-01-26

MORE AT Just Eat

The lamb tikka masala was disgusting. It tasted as though the masala sauce tasted like pure vinegar with ketchup for colouring . It was very sickly and horrible £22 wasted on a curry rather went into bin after one mouthful.

site_logo

julie . 2023-01-24

MORE AT Just Eat

Found ourselves a new Indian restaurant. Food was so good and the flavours were out this world. Rice and naan were very good too. Thank you guys

site_logo

Paul . 2023-01-21

MORE AT Just Eat

Best indian takeaway we have had for a very long time.

site_logo

Janette . 2023-01-16

MORE AT Just Eat

Best Indian restaurant/takeaway for miles around. The food is always absolutely gorgeous. Fast, friendly delivery too.

site_logo

TRACEY . 2023-01-16

MORE AT Just Eat

Delivery guy, polite and friendly, food piping hot. Good size portion, delicious! Will order again and highly recommended

site_logo

Alison . 2023-01-15

MORE AT Just Eat

lovely delivery woman, solidly great food

site_logo

Peter . 2023-01-11

MORE AT Just Eat

Food was tasty, large portions and good quality ingredients.

site_logo

Victoria . 2023-01-07

MORE AT Just Eat

Lovely food quick delivery definitely be using this restaurant again

site_logo

Allan . 2023-01-06

MORE AT Just Eat

First time we’ve ordered from here and it won’t be the last. Loved everything we ordered! The tikka masala was amazing. Everything arrived piping hot.

site_logo

Beth . 2023-01-02

MORE AT Just Eat

Great food delivered quick and very hot will order again

site_logo

kate . 2023-01-01

MORE AT Just Eat

First takeaway from here after a recommendation, even though they were very busy the meal was excellent and we had few extras thrown in. The staff were very professional and helpful when we changed our order.

site_logo

123beerlover . 2022-12-31

MORE AT TripAdvisor

Biryani ordered was very very dry and the chicken so over cooked that it was hard to chew, chicken tandoori on the other hand was just salty no other flavor at all just salt.

site_logo

Suhas . 2022-12-30

MORE AT Just Eat

Forgot some of my food and asked me to come pick it up when it was delivery

site_logo

Danielle . 2022-12-27

MORE AT Just Eat

Great food, was still hot when it arrived, tasted beautiful and there was plenty if it, will be re-ordering.

site_logo

sania . 2022-12-25

MORE AT Just Eat

Utterly disappointed is an understatement. We had booked & paid a deposit for the advertised 3 course English Christmas Day lunch . On arriving & ordering we were told that 3 of the courses were unavailable . There was no soup, Turkey with the trimmings & Christmas pudding either . We had to accept prawn cocktail , steak & chips & a small standard vanilla ice cream or nothing . I do not normally eat steak . When we complained we were merely told that the ‘ Christmas chef’ wasn’t available that day ! It is without doubt the worst Christmas lunch I’ve ever had . No apology or refund was offered . We will never return to KK .

site_logo

MoiraC972 . 2022-12-25

MORE AT TripAdvisor

Very happy with the food and time taken to arrive!

site_logo

Amy . 2022-12-24

MORE AT Just Eat

absolutely disgusting food and customer service phoned to complain with no joy of refund or food replacement spent over 80 pounds very disappointing. do not eat from this restaurant

site_logo

Shakira . 2022-12-24

MORE AT Just Eat

Best Indian I’ve ever eaten. Absolutely outstanding. Food was 10/10

site_logo

Thomas . 2022-12-24

MORE AT Just Eat

Great service and food a pleasure will be ordering again definitely

site_logo

Michael . 2022-12-18

MORE AT Just Eat

We had our food delivered but I’m sure service in the restaurant is good. Our food was very delicious.

site_logo

Darren . 2022-12-18

MORE AT Just Eat

Nargis kebab mince round egg wasn’t nice and omette very dry. Keema nan was burnt the curry was average.

site_logo

Susan . 2022-12-17

MORE AT Just Eat

Faultless. Delivery 10 minutes early. Friendly driver. Early delivery didn't compromise food quality like it often can do. Lovely! Definitely ordering from here, again!

site_logo

Colin . 2022-12-16

MORE AT Just Eat

Best chicken tikka masala I've tasted. Lots of chicken in the dish and a generous portion. Love the food at this place. If you order a takeaway they always give you a little freebie. Highly recommended.

site_logo

TRACEY . 2022-12-11

MORE AT Just Eat

Great food as always. However did have my chutney missing? Otherwise would have received 5 stars.

site_logo

Carla . 2022-12-11

MORE AT Just Eat

Awful, one of the worst curry’s we’ve ever had, how this place is highly rated I’ll never know, never ordering from this place again

site_logo

Joshua . 2022-12-02

MORE AT Just Eat

Fantastic food and delivery service! Definitely will be ordering from here again!

site_logo

Kornelia . 2022-11-28

MORE AT Just Eat

This was the best Indian food we’ve had in a LONG time. Absolutely loved it. Fresh, not greasy or overly oily. The flavours were beautiful. Big portions and put us in a total food coma after 😂 the most delicious Friday night treat - will definitely be ordering again. A nice gesture of a complimentary extra dish we didn’t order and also lots of the chutney selection for the poppadoms. Heaven!

site_logo

Berenice . 2022-11-26

MORE AT Just Eat

Delicious food, will definitely order again

site_logo

Peter . 2022-11-19

MORE AT Just Eat

How can you send something like this out to your customers the quality is disgusting full of grease and oil! Rang up and you didn’t even seem to care

site_logo

Salvatore S . 2022-11-15

MORE AT TripAdvisor

Disgusting full of oil and grease

site_logo

Salvatore . 2022-11-15

MORE AT Just Eat

Everything was great… nice food… great service….value for money….only very slight downside is that the restaurant isn’t licensed but overall very impressed and will definitely return

site_logo

Manager-CTT . 2022-11-14

MORE AT TripAdvisor

Loved our food tonight as always.

site_logo

Fiona . 2022-11-14

MORE AT Just Eat

Fantastic food, hot, delivery spot on

site_logo

Marian . 2022-11-06

MORE AT Just Eat

Regularly order or eat in at Kaptin Korma and never had bad meal. Always excellent service and excellent food. Coming from Bradford, my expectations are high and Kaptin Korma always meets them.

site_logo

wayne . 2022-11-04

MORE AT Just Eat

Great food but the popadoms were not crisp. However, this was a one-off and I have not had this problem before. Will still order from, Kaptin Korma.

site_logo

Christina . 2022-11-04

MORE AT Just Eat

Tasty and fresh!!! Loved it- will defo order again!!!

site_logo

Maria . 2022-11-02

MORE AT Just Eat

Absolutely delicious food as always. Quick delivery arrived hot and very tasty!

site_logo

Andrew . 2022-10-30

MORE AT Just Eat

Food was amazing sag aloo vegetable curry tikka will be ordering again

site_logo

Manda . 2022-10-30

MORE AT Just Eat

Delicious food at a great price. Fast delivery too.

site_logo

TRACEY . 2022-10-23

MORE AT Just Eat

Great and quick delivery and great quality food

site_logo

Jack . 2022-10-21

MORE AT Just Eat

We visited Kaptin Korma recently, this is my fourth time and it only gets better! Although it was generally quiet as it was early evening and a weekday, the atmosphere was friendly and inviting. We were greeted a few seconds after we entered and shown to a table. The dishes we ordered came in good time AND together, so no one in our party had to wait while others had already been served their meal. The food itself was exquisite, superbly flavoured, the seasonings and spices perfectly balanced to produce a delicious and more than satisfying result. The portions were more than generous, and some diners, including myself, took what we couldnot manage to consume at the table home with us. The service was excellent, polite, friendly, and professional, the staff made us feel welcome and treated their customers with courtesy and respect, which was reciprocated by all the diners present. Nothing else to be said, except, outstanding!

site_logo

JourneymanTripper . 2022-10-20

MORE AT TripAdvisor

Food was great. However, the menu on Just Eat clearly states 10% discount on collection on orders over £15, cash only. The restaurant advised us that this was for orders via the Kaptin Korma website only, and would not provide the offered discount. Just Eat advise to complain via a review. Frustrating.

site_logo

Iain . 2022-10-11

MORE AT Just Eat

Food is normally excellent. But tonight it tasted a bit metaly

site_logo

Ali . 2022-10-09

MORE AT Just Eat

Driver couldn't find my house number but my phone also wouldn't allow me to answer, half and half responsibility on late delivery

site_logo

nic . 2022-10-08

MORE AT Just Eat

Food excellent, the only comment I have I ordered two garlic naan one arrived, the other naan when torn open had a sauce inside it may have been chilli & meat still enjoyed the meal will definitely order again 😀

site_logo

Brian . 2022-10-07

MORE AT Just Eat

Excellent food once again, food was on time, delivery driver was very polite. Great all round service. Always a winner.

site_logo

Wayne . 2022-10-02

MORE AT Just Eat

As always the food was fantastic and of good size. Best in Wolverhampton

site_logo

davinia . 2022-10-01

MORE AT Just Eat

The food is alright but it’s nothing special, especially for the cost, it feels like they just pour some mass produced sauce over your choice of pre-prepared protein instead of letting said protein soak up flavours by being cooked in the sauce. Given how expensive it is, I would say go to Mother India on the Tettenhall Road instead, the prices are similar but the food from them feels like they prepared it by hand in reaction to your order, rather than, as I said, the mass-produced, lower quality of Kaptin Korma.

site_logo

Jack . 2022-09-30

MORE AT Just Eat

Similary restaurants in West Midlands

restaurant_img
4.5

212 Opinions

location-icon316 Dudley Road
Indian
outdoor_seating_327671takeaway_327671delivery_327671

All the dishes we had had an authentic Indian taste. Would definitely go again and try some other delicacies. Many thanks to Chef Rohit for his exceptional behaviour and hospitality!!

restaurant_img
4.5

566 Opinions

location-icon37 Martin Street
Indian
outdoor_seating_229457takeaway_229457delivery_229457

Lovely food, friendly service and good value for money. Decent place to watch the football as well 👍

restaurant_img
4.5

560 Opinions

location-icon252 Bilston Road
Indian
outdoor_seating_227008takeaway_227008delivery_227008

Good food cooked fresh. Worth the wait. Great flavours, well marinated

restaurant_img
4.5

304 Opinions

location-icon122 Highfields Road
Indian
outdoor_seating_227532takeaway_227532delivery_227532

Food was excellent and plenty would recommend eating in or take away

restaurant_img
4.5

2354 Opinions

location-iconClaverly Drive
Indian
outdoor_seating_169995takeaway_169995delivery_169995

It’s an average Indian restaurant, not the worst I’ve had, but definitely not among the best. The place is huge, but the decor feels very outdated. The staff uniforms could use a refresh. That being said, everyone was friendly enough, but overall, I found the experience a pretty boring. The restaurant has a lot of potential, but it really needs a complete revamp.