GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.3

Based on 282 opinions finded in 4 websites

site_photo4

Nº 1259 in 2913 in Edinburgh, City of

Nº 246 of 561 Other cuisines in Edinburgh, City of

CUSTOMERS TALK ABOUT DISHES WITH..cookedspicychickenricesaladtapasprawnmangopapayasoupcurryfried

comment_iconOpinions

5 stars for the food quality and quantity both!! Delicious taste and such lovely staff atmosphere, loved everything! ❤️

site_logo

Saloni Raut . 2024-10-20

MORE AT Google

Every dish is delicious and truly uses local Thai ingredients. Recommended snack platter, fish sauce papaya salad and main course fried shrimp with rice. Seasoned well, just the right amount of lightness. The fried food is delicious, but the main dishes are a little on the sweet side. The service staff are friendly and enthusiastic and can speak Cantonese. It's really great. The restaurant environment is clean and tidy, and the location is convenient. Highly recommended! Every dish is delicious and truly uses local Thai ingredients. Recommend the snack platter, papaya salad and the main course of fried shrimp with rice. The service staff are friendly and nice and can speak Cantonese. The restaurant is clean and tidy, and the location is convenient.

site_logo

HC Chuang . 2024-10-20

MORE AT Google

Had lunch: tasty, welcoming staff, nice atmosphere. We’ll be back for more

site_logo

Sergei Plekhanov . 2024-10-06

MORE AT Google

little chicken and aubergine and was cold very poor service crackers poor quality.

site_logo

norman . 2024-09-29

MORE AT Just Eat

All good , great food delivered on time by a polite courier

site_logo

Doug . 2024-09-28

MORE AT Just Eat

Visited for lunch during the week so quiet. Absolutely fantastic food and lots of it! Service was attentive without being overbearing. Warm and welcoming atmosphere from a family run restaurant. Garlic prawns, satay chicken, veg sprig roll. Stir-fry and massaman curry Provence rose wine and Singha. ⭐️⭐️⭐️⭐️⭐️

site_logo

Bathbudgie . 2024-09-27

MORE AT Google

Fabulous evening to celebrate Anniversary with the best food and service . Very reasonably priced too

site_logo

Shona Hunter . 2024-09-23

MORE AT Google

Very disappointed not tai at all portions poor too all bland even asked for very spicy not worth price wasnt worth it been was looking forward to it too

site_logo

266pam . 2024-09-21

MORE AT TripAdvisor

We didn’t book and took the waitress by surprise as we waited 15minutes or so and eventually called to say where is anyone! But it was worth a wait as the food was great. All of enjoyed our dishes very much and fried ice cream was nice too.

site_logo

Chris Pegrum . 2024-09-07

MORE AT Google

I love Thai food. However, we found the found here to lack any flavour or depth. The service was good and they made you feel welcome. I had the papaya salad, which I usually love, but it just tasted like shredded veg. I had to ask for extra chilli. We then both had a stir fry with ginger etc. It just looked and tasted like cooked veg with protein. Very watery too. It was like what I have at home for a healthy midweek meal. I wanted something more tasty. I had to ask for and pay for some red curry sauce to give it flavour. The dessert was good though. I’d go back, but it would have to be for a curry, as what we had was pretty lacking in tastiness.

site_logo

Cat Lover . 2024-09-07

MORE AT Google

Over priced for quality and packaging

site_logo

Bowmeister . 2024-09-03

MORE AT Just Eat

Food was fine however not worth the price. Curry for GBP 16.00, really? It was more like Thai street food and you would expect to pay not more than GBP 10.00. Also, I am pretty sure they are using 2 l Coca Cola bottles, as mine had zero gas. Not impressed, would not go back.

site_logo

Gintare . 2024-08-26

MORE AT Google

Food was delicious. I had Tom Yum and Massaman curry. Both were amazing. Everyone at my table enjoyed their food. Would recommend

site_logo

N M . 2024-08-23

MORE AT Google

First visit to this restaurant yesterday. Everything was absolutely fantastic. Cannot rate our meal and the overall experience highly enough. Best meal I've had for a long time. Highly recommend for anyone who likes Thai food.

site_logo

Jillian Brannan . 2024-08-05

MORE AT Google

Bad experience- in the name of Thai, they spoil the food by changing the way it should be & claiming it will be like that only.. also too late

site_logo

Ganesh Prabu . 2024-08-03

MORE AT Google

Great wee find, don't know why I have not been here before

site_logo

Bryan Sibson . 2024-07-27

MORE AT Google

We only use this place for Thai.. it’s the best, and I’m fussy.. every single time its, tasty, authentic and deliciously more ish….

site_logo

Nicola . 2024-07-17

MORE AT Just Eat

Absolutely delicious! First time ordering from here and we loved it. Highly recommend.

site_logo

Lucy . 2024-06-16

MORE AT Just Eat

Regular customer at arguably one of the best Thai restaurants in Edinburgh, great service, great food and great vibe. Would recommend for anyone nearby and takeaways are also great.

site_logo

Callum Lancasterggmtmr . 2024-06-16

MORE AT Google

Been twice supper and lunch like it good food convenient location no 23 bus takes you to door!

site_logo

Aline Dobbie . 2024-06-14

MORE AT Google

Most delicious Thai food I have had . It's worth every penny

site_logo

Libby . 2024-06-13

MORE AT Google

The food was awesome from the appetizers to main course to beers 🍻 this is definitely something I will recommends visiting 💯

site_logo

Jose Manuel Garnica . 2024-06-13

MORE AT Google

We had a lovely lunch here. The food was great and the waitress very nice. The restaurant is a pleasant space, light and airy with comfortable seating. Good food at a reasonable price. Shame the cocktails weren’t available at our visit for lunch, but we had a decent bottle of white wine.

site_logo

Karen L . 2024-06-07

MORE AT TripAdvisor

Lovely restaurant. Wonderful, friendly staff and the food is always fantastic - tasty, plenty of it and priced well for what you get.

site_logo

Donna M . 2024-05-28

MORE AT TripAdvisor

Wonderful experience all together. Lovely restaurant (peaceful and quiet), friendly staff, delicious food, great prices... Right on the highstreet.

site_logo

Avits McYak . 2024-05-22

MORE AT Google

Lovely Thai Lounge Bar in Edinburgh. Great service, the two girls that served us were lovely. The food was reaaaaally good, fresh and tasty. We will definitely come back. Thank you!

site_logo

Diego . 2024-05-19

MORE AT Google

First time visit and it won’t be our last. wonderfully friendly and efficient service, great choice of menus fully explained to us. Very reasonable prices. Went for my birthday, great decision!

site_logo

Derek B . 2024-05-10

MORE AT Google

Mad delicious, I’m Thai, been in Thailand my whole life.

site_logo

Megan Kitviriya . 2024-04-17

MORE AT Google

Portion size small for price paid, quite disappointing but tastes good.

site_logo

Lois . 2024-04-13

MORE AT Just Eat

Very good food and great service, together with a very well priced menu.

site_logo

Daniell Alessandro . 2024-03-25

MORE AT Google

We pre-ordered a takeaway meal for six people around 4pm with a delivery time of 6.20. However, our food didnt turn up till 7.20. And it was by then lukewarm. Communications were non-existant - we didn’t get any online confirmation of our order and could not call the restaurant as their phones just went straight to voicemail. We also never had the courtesy of any response to our voicemails. So we didn’t know whether we would receive our order, worth over £100, or not. We have had great food here but that was a big let down and I doubt we would order from here again.

site_logo

Colin . 2024-03-10

MORE AT TripAdvisor

Great food. The soup and dipping sauce for the spring rolls were amazing!

site_logo

Volker Seeker . 2024-03-02

MORE AT Google

This was so incredibly disappointing. After starters which were over priced but fine , I ordered one of the chicken stir fry dishes. I have to say it was one of the most tasteless experiences in a restaurant I’d ever had. A few pieces of chicken that looked like it had come out of a packet and a collection of wet steamed / braised vegetables that had absolutely no flavour whatsoever. Nothing Thai about it. I can’t believe I didn’t take it back but we had a film to get to. Really not ok to charge these prices for such inadequate, bland food.

site_logo

Stephanie . 2024-02-10

MORE AT TripAdvisor

Two hours late. Lukewarm food and given a different starter than I ordered.

site_logo

Georgina . 2024-02-04

MORE AT Just Eat

It was ok. Not the best Thai but did the trick, wouldn’t rush back

site_logo

Balal . 2024-01-10

MORE AT Just Eat

My husband and I love this place. We have been a few times and sampled many of the curries, soups, and pad Thai. The soups are fantastic. Really rich and flavoursome. The curries have all been great. The prawns have always been especially large and high-quality. We enjoyed the pad thai too. The wine pairings are also very good. We loved it so much, we went back twice within a couple of weeks. Really friendly staff too, who made us feel very at home.

site_logo

Claire M . 2024-01-03

MORE AT Google

They were perfect with the amount of spice level in the chicken and egg rice.... simply giving me exactly what I wanted... great service, good price, excellent food..

site_logo

Wlliam Heitmann . 2023-12-30

MORE AT Google

We went to Gratitude Thai Lounge for my husband’s 50th birthday. The extensive gluten free options were a huge draw and we weren’t disappointed. The staff were really friendly and attentive and really helpful in making sure that the dishes came out at spice levels everyone was happy with. The food was plentiful and delicious and it was great to try new dishes that we hadn’t had before. We’d thoroughly recommend and will be back as soon as possible!

site_logo

dianejburgess23 . 2023-12-21

MORE AT TripAdvisor

Had my birthday dinner and drinks here, great ambience, tasty Thai dishes, every dish was seasoned just right (we love Thai food) good wine offering! Kate and her mom’s service was outstanding, good attention to us and our guests, good lighting, we took cracking photos. Thank you ka, we will be back again soon.

site_logo

Melusi Ncube . 2023-12-13

MORE AT Google

Tried this place because of the lunch deal (14 for 2 courses) and the outside looked quite appealing. It had a good choice for the lunch menu (sometimes they can be limited) and the food was very flavourful and fresh :) some good citrus and heat flavours as expected from decent Thai food. staff were really nice and they allowed our dog in with no hassle. After trying the lunch menu I will try this place for dinner in the future, would definitely recommend :)

site_logo

Conor Kerr . 2023-12-05

MORE AT Google

Great Thai food and friendly service. Good choice for vegans and vegetarians.

site_logo

Glen . 2023-11-26

MORE AT Google

This is the best Thai food in UK I have ever ate before

site_logo

Jasmine Yuen . 2023-11-20

MORE AT Google

The food was different from my usual choices, but it was very good, just the right amount and the overall ambience was pleasant.

site_logo

Kevin O'Neill . 2023-11-18

MORE AT Google

Great neighbourhood restaurant - have ordered take-away several times here and we’ve been delighted with the food. Good menu, with selection of vegan and vegetarian options. Noticeably very fresh ingredients, expertly prepared Thai meals and excellent, caring service. Manageress Kate went to some trouble recently to successfully resolve an issue with terrible service from a third-party delivery company (Uber-Eats) on our behalf. A great option for takeaway, and we hope to sit in for a meal sometime soon.

site_logo

Dan W . 2023-11-11

MORE AT Google

Have eaten here several times over the last few months and love it. Great food, good service, very pleasant surroundings for a reasonable cost. What’s not to like!!!

site_logo

Angela Murray . 2023-10-28

MORE AT Google

This is one of our favourite local restaurants. Really nice people and great food at a good price . The tapas style dishes make a great dinner choice. The wine list is fine.

site_logo

Cortopasso . 2023-10-16

MORE AT TripAdvisor

Fantastic food and good service. The green and yellow curries and the street rice and sticky rice were all amazing and very tasty and authentic!

site_logo

Hackney Voter . 2023-10-05

MORE AT Google

Had an amazing meal tonight for a 96th birthday. Friendly and welcoming, service excellent and food exceptional. They even brought a doggy treat and water over for our extra addition to our party of 9. We'll be back 🤩👍

site_logo

Lynette Daly . 2023-09-30

MORE AT Google

Fantastic food as always. But was nearly 45mins later than requested.

site_logo

Kylie . 2023-09-19

MORE AT Just Eat

Friendliest people! Food is authentic and delicious.

site_logo

Donal O'Connell . 2023-09-18

MORE AT Google

Amazing food and cocktails ! Waitress is lovely ! Definitely will come back

site_logo

DomI NIka . 2023-09-08

MORE AT Google

Portions really small for price and order incorrect.

site_logo

Aaron Mc Enaney . 2023-08-18

MORE AT Google

Delicious! The red curry is hot but gooooood 🥵

site_logo

Oele Geirnaert . 2023-08-13

MORE AT Google

We spotted this restaurant after the cinema and decided to have dinner. It has a modern vibrant feel about it. The menu offers a great choice. We had the squid and fish cakes to start. I had the green thai curry with aubergine and chicken which was perfectly cooked accompanied with a generous portion of perfectly cooked sticky rice. The service was warm and friendly. So glad we came across this one and will definitely be back.

site_logo

G9342XZjuliek . 2023-07-30

MORE AT TripAdvisor

I think this is some of the best Thai food in Edinburgh, along with great service. The Tapas style starters are very generous, with two to share more than enough. We had the Green Curry and Masaman curry and there were generous portions of both. Extremely nice food.

site_logo

Ken Glendinning . 2023-07-27

MORE AT Google

Amazing food. Will definitely order again. Thanks

site_logo

Luna . 2023-07-25

MORE AT Just Eat

Delicious food with lovely friendly staff.

site_logo

Carolyn Thornton . 2023-07-25

MORE AT Google

I was at Gratitude for the first time today. This place is a hidden gem, the restaurant was well set out and welcoming. The food was delicious, and although the wine list was limited there were some great wines on offer. The lady that served us was friendly, welcoming and knowledgeable. I would highly recommend and I will most definitely be back.

site_logo

Aileen Murray . 2023-07-20

MORE AT Google

I had dinner today (19/07/23) and Kate and the lady with the blonde hair went above and beyond. Very lovely staff! And food very yummy!

site_logo

Luisa Ortega . 2023-07-19

MORE AT Google

We were not sure about going to Gratitude because there used to be a favourite Italian restaurant in these Churchill premises. But we were delighted with our eating experience. Firstly, the waitress was elegant and intelligent. She knew how to deal with 4 old timers with fun and courtesy. Then the food. Everyone had something different. Everyone was pleased. My unadventurously chosen Tom Yum soup was perfect. Then my spicy beef fried rice was just as good. The wine was decent and modestly priced. The restaurant is family run, just like its predecessor. It deserves to be very successful.

site_logo

MacdEdininburgh . 2023-07-07

MORE AT TripAdvisor

Very kind team and very good food

site_logo

Denise Gaillard . 2023-07-01

MORE AT Google

It tasted ok, but we ordered two completely different dishes and what we received was different ingredients in the same sauce, the sauce was watery and thin. Hardly any flavour. A bit disappointed to be honest.

site_logo

Graeme . 2023-06-25

MORE AT Just Eat

Great food and drinks. Really friendly and attentive staff. Would definitely recommend a visit

site_logo

tracey ashmore . 2023-06-23

MORE AT Google

poor service and very average food I would nor recommend this restaurant to any one expensive small portions

site_logo

beefhea . 2023-06-06

MORE AT TripAdvisor

Very inviting welcome by the super friendly and humorous staff. The menu offers a wide choice for vegetarians, drinks are great with many mocktails and Singha beer from the barrel. The food was freshly cooked and very tasty. They know how to use spices to make it perfect and not too hot. Really enjoyed a fantastic dinner here for a very fair price. Definitely worth going to!

site_logo

Anton S. aus H. . 2023-06-02

MORE AT Google

Toller Empfang, sehr spaßige Bedienung mit grossartigem Sinn für Humor. Die Karte hält reichlich vegetarische Optionen bereit und die Mocktails haben uns sehr gut geschmeckt. Das Essen war frisch zubereitet und perfekt gewürzt: Nicht zu scharf aber schon mit Geschmack. Herrlich! Die Preise bleiben dabei im sehr fairen Rahmen, so dass wie hier einen Klasseabend verbracht haben. Wir kommen sicher wieder!

site_logo

Tornado0963 . 2023-06-01

MORE AT TripAdvisor

Terrible food. I threw my dish away after one fork, meal smelt and tasted bad. My partner ate her meal as was starving but again it was not nice, half cooked. Delivery driver also dropped one of the meals over my doorstep due to the bag falling apart. I spent 10 minutes cleaning my doorstep.

site_logo

maria . 2023-05-31

MORE AT Just Eat

推介青咖哩雞丶炸蝦餅丶糯米飯丶薄餅丶泰式凍檸茶和生啤 以上在泰國都未吃過這樣好吃的 服務非常好,親切友善👍👍👍

site_logo

Yan Tse . 2023-05-29

MORE AT Google

Very nice restaurant. I expect the food to be more spicy, but it was very tasty nonetheless. Service rather slow though.

site_logo

Simona Foscarin-Kosmetatou . 2023-05-27

MORE AT Google

Wonderful experience. Fabulous food, great choice, staff that are uber friendly, what's more to ask for? Been back 3 times in the last week and the prices are very reasonable too.

site_logo

Alan Stewart . 2023-05-24

MORE AT Google

The food was very tasty, and the delivery was quick. We will definitely order from Gratitude Thai again

site_logo

Rosie . 2023-05-22

MORE AT Just Eat

Forgettable food, verging on bland, not a hint of spice although asked for spicy. Not at all authentic. Service was friendly and a nice atmosphere. 2.5 stars

site_logo

Kerry Catterson . 2023-05-18

MORE AT Google

Food was excellent, arrived on time and was hot.

site_logo

Nicholas . 2023-05-17

MORE AT Just Eat

Had a lovely experience at Gratitude Thai Lounge Bar. My friends and I had made a large booking of 14 of us and we all thoroughly enjoyed the food, drinks and the friendly and efficient service. Great atmosphere.

site_logo

eirinitamousi . 2023-05-08

MORE AT TripAdvisor

Had a lovely experience at Gratitude Thai Lounge Bar. My friends and I had made a large booking of 14 of us and we all thoroughly enjoyed the food, drinks and the friendly and efficient service. Great atmosphere.

site_logo

Eirini Tamousi . 2023-05-08

MORE AT Google

Got chicken spring rolls instead of vegetarian ones ...

site_logo

James . 2023-05-08

MORE AT Just Eat

Relaxed atmosphere with gorgeous food!! All very reasonably priced for the quality!! Delicious - we will be back!!

site_logo

39Pat39 . 2023-05-05

MORE AT TripAdvisor

We popped in for lunch today. Delicious food and great service. We had Thai fish cakes, chicken satay, Penang curry and a pork curry with delicious authentic sticky rice. We will be back to try some more of the food and the cocktails.

site_logo

WalkinWonderland . 2023-04-30

MORE AT TripAdvisor

First time visiting this local restaurant. Incredibly fast service!

site_logo

Anna Raper . 2023-04-29

MORE AT Google

Amazing authentic Thai culinary experience! Service and food was outstanding and the best we have enjoyed in Edinburgh! Catered for complex dietary needs and everything was available to the whole party. Highly recommend!!

site_logo

CarolineB3592 . 2023-04-25

MORE AT TripAdvisor

Found this gem in Morningside and I am so glad I decided to try somewhere new! I went for the Whisky Duck for my starter and the Pad Me Noodles as my main. It was as exceptional as the customer service. Would highly recommend! Ambiance 10/10 Food 10/10 Service 10/10

site_logo

Nambela C . 2023-04-11

MORE AT Google

Delivery driver was so smiley and friendly, great service

site_logo

Andrew . 2023-04-02

MORE AT Just Eat

Amazing quality of food, and lovely service, thank you for a great night. We like authentic/hot, have a discussion with the staff about your preference - they will tailor to suit. We had: Starters: Prawn cakes Tom Yum soup Main: Steak salad The one on the back page with the egg on it, sorry can’t remember the name Order the above and you have one of the best meals you will ever have, in my unbiased but correct opinion :-)

site_logo

HonestReviewer100 . 2023-04-01

MORE AT TripAdvisor

Been order papaya salad there a lot but this time I don’t like papaya salad Thai time so much carrots there instead of papaya

site_logo

Sunisa . 2023-03-30

MORE AT Just Eat

Over priced poor quality food. The sticky rice was like something you’d stand on in the street , the red thai curry had poor quality chickens and a thin red curry that was not at all spicey. Another dish was a ginger stir fry that was just appalling . Not very Thai at all and not to be recommended. I have lived in SE Asia and while Edinburgh doesn’t have a lot of great Thai restaurants this is by far the worst .

site_logo

Jay G . 2023-03-25

MORE AT TripAdvisor

Amazing food Great atmosphere Lovely staff

site_logo

Nicola Todd . 2023-03-23

MORE AT Google

We ordered a takeaway from Gratitude for the first time recently and it was fantastic! Will definitely visit the restaurant now 😊

site_logo

Ali Murdoch . 2023-03-17

MORE AT Google

Food was lovely, masaman curry was very good. Quality was great but could have been hotter. Ordered early with delivery date 2 hrs later as we were going out and wanted to plan ahead! So it was a bit of a rush being 15 mins late.

site_logo

Diane . 2023-03-16

MORE AT Just Eat

Lovely lunch here today 2 courses £13.95. Great Value Food delicious Service excellent Will definately be returning

site_logo

Carol F . 2023-03-05

MORE AT TripAdvisor

We had the papaya salad and a couple of the curries. All delicious!

site_logo

Alkistis Pourtsidou . 2023-03-05

MORE AT Google

Some of the best Thai Food I have had in the UK. Great lunch special.

site_logo

The Wisdom Of Odin . 2023-03-04

MORE AT Google

Gratitude Thai Lounge bar is such a wonderful restaurant, one of the most delicious restaurants in Edinburgh. I endorse it as a PhD candidate at the University of Edinburgh. I was moved by the cuisines as a Thai food person…chicken satay and prawn cakes are one of the top dishes among all the Edinburgh Thai food restaurants; and, their whisky pork.. I can’t find a word to describe. Pork is soft and tender, the wine sauce is so appetising! Fish cakes are as delicious as prawn cakes. Banana fritters are lovely as well. And, mango sticky rice! Their purple sticky rice is the best in Edinburgh. I will order their mango sticky rice every time i visit them. I ordered six dishes this time but none of them disappointed me! Will order many time in the future and try other dishes; hope to eat in some day.

site_logo

巩奕凡 . 2023-03-01

MORE AT Google

I would HIGHLY RECOMMEND this place. The food was amazing and they make changes according to your requirement or your taste. We ordered the Tomyum and Tomkha soup and in mains we ordered the chicken dunken fried rice and chicken noodle soup. Not to forget the mocktails.. The best I’ve had in a while.. We got the virgin thai monsoon and virgin gratitude punch, each flavour in the mocktails was so well put. Amazing dinner.

site_logo

Arshi Feroz . 2023-02-26

MORE AT Google

We visited on a Saturday afternoon in February and ordered from the very good value lunch menu. The restaurant is bright, clean and modern. Lots of space between the tables and a chilled atmosphere. For starters we had the sweetcorn fritters, prawns and lemon chicken and all were hot, tasty, well made and beautifully presented. For mains we had massaman, yellow and Green curries and a tofu pad Thai. Again we all thoroughly enjoyed our meals which were authentic, tasty and presented beautifully. We enjoyed some prosecco and soft drinks. A lovely touch was that my 3 year old was given a paw patrol plate and some children’s cutlery to eat her food off. A small touch that was appreciated. Great service and we can’t wait to return!

site_logo

Wanderer21432827358 . 2023-02-25

MORE AT TripAdvisor

Tasty and nice presentation of the food. Tapas portions decent , main course portions could be bigger. Not super authentic Thai but it's nice. Mango rice and fried ice cream something I'd recommend for a dessert 😋 Nicely decorated inside, warm and friendly service.

site_logo

Paula Rose . 2023-02-25

MORE AT Google

Very fast delivery. Tasted very fresh. Not blown away, but definitely very satisfied! Thanks guys

site_logo

Christina . 2023-02-23

MORE AT Just Eat

Ordered pad thai tofu. Tofu wasn't good although rest of it was nice

site_logo

k . 2023-02-22

MORE AT Just Eat

Best Thai dinner in Edinburgh... great food taste and very friendly hospitality...very beautiful ambience...must go place and I am sure you will love it..

site_logo

Rudolf Dsouza . 2023-02-19

MORE AT Google

Excellent food, great quality, will definitely be ordering again

site_logo

Nicola . 2023-02-19

MORE AT Just Eat

We loved the food at this small Thai restaurant. They do a small bowl of chopped chillies and nam pla to let you adjust the heat of your dish. Really good idea.

site_logo

David Hay . 2023-02-16

MORE AT Google

Similary restaurants in Edinburgh and Lothian

restaurant_img
4.3

68 Opinions

location-icon154 Dundas Street
Other cuisines
outdoor_seating_204334takeaway_204334delivery_204334

The Sriracha egg roll is the best thing ever!

restaurant_img
4.3

171 Opinions

location-iconEdinburgh 43-45 High Street
Other cuisines
outdoor_seating_212760takeaway_212760delivery_212760

Really enjoyed lunch here, haggis and mash with I think it was red wine sauce. Stag kept up even though it was busy during the Fringe. Only slight minus is I thought it was a little bit expensive for what it was.

restaurant_img
4.3

216 Opinions

location-icon22 Breadstreet
Other cuisines
outdoor_seating_96349takeaway_96349delivery_96349

with a friend we decided to have lunch and Bread st looked best option,modern design and interesting menu ,however one habit of mine is to ask the staff what they would eat or recommend ,we love fish and our server Alessandra recommended Crab on toast and Tuna Tartare which were great choices although I found the Tuna little too spicy , Mr Raboso

restaurant_img
4.3

1004 Opinions

location-iconClydesdale Bank Plaza 50 Lothian Road
Other cuisines
outdoor_seating_205913takeaway_205913delivery_205913

We stopped by Frites for a snack and, based on the waitress’s recommendation, tried the Chicken Tikka Goodness. We went for the large size to share, and the fries were flavorful and satisfying as a meal. However, the place lacked a seating area, even for waiting, so we ended up enjoying our fries on the stairs of Usher Hall nearby.

restaurant_img
4.3

764 Opinions

location-icon104 Buccleuch Street
Other cuisines
outdoor_seating_191778takeaway_191778delivery_191778

Cosy cafe with excellent coffee