GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.4

Based on 301 opinions finded in 4 websites

site_photo4

Nº 1142 in 2913 in Edinburgh, City of

Nº 218 of 561 Other cuisines in Edinburgh, City of

CUSTOMERS TALK ABOUT DISHES WITH..currychickentapasspicysoupricepapayafriedprawnsaladmangocooked

comment_iconOpinions

We visited on a Saturday night as a last-minute booking. The venue is lovely, fresh and clean, but also cosy and relaxed. The staff are so friendly, lovely and smiley and proactively discussed the menu with us. The food was fabulous. Fresh, colourful and super tasty. The papaya salad in itself is worth a visit!! We had dinner and a couple of bottles of wine, and before we knew it, it was 10 pm. There was never any rush to leave the table, we were made to feel very comfortable. Highly recommend and will definitely be back soon. Well done!!

site_logo

Talitha Jackson . 2025-04-21

MORE AT Google

Still hands down the best Thai restaurant in Edinburgh. Food and service top notch and always prepared to go the extra mile. Me and the old man’s favourite when he’s in the city.

site_logo

Ross Johnston . 2025-04-13

MORE AT Google

Great value set lunch, food was delicious and flavourful, good ambiance and exceptional service.

site_logo

J M . 2025-03-23

MORE AT Google

Went there to celebrate my mum's birthday. Food was delicious, and great service. We mentioned it was my mum's birthday off handedly only as we asked for the bill, and the waitress came out with a candle on a deep fried ice cream dessert (yum) on the house! Lights turned of singing happy birthday and all. Was such a nice surprise!

site_logo

stefan hughes . 2025-03-18

MORE AT Google

My wife and I have eaten here maybe 6 or 7 times over the last year and it is consistently excellent. Friendly, efficient staff serving really tasty food at very reasonable prices. A highly recommended neighborhood restaurant - and you must try the tapas selections.

site_logo

Charles Kelly . 2025-03-13

MORE AT Google

Mi esposa y yo hemos comido aquí tal vez 6 o 7 veces durante el último año y es consistentemente excelente. Personal amable y eficiente que sirve comida muy sabrosa a precios muy razonables. Un restaurante de barrio muy recomendable - y usted debe probar las selecciones de tapas.

site_logo

Charles K . 2025-03-13

MORE AT TripAdvisor

La peor tailandesa que he comido, esta es mi cocina favorita. He estado en Tailandia y cocino comidas tailandesas en casa, ya que soy de una zona rural, esta entrega de comida fue un verdadero placer mientras estaba en la ciudad. Era tan malo que no podía comerlo. La sopa Tom yung parecía agua sucia para platos en lugar de la cremosa naranja que esperaba. Estaba caliente sin sabor complejo. Pedí el salteado de jengibre con cerdo. Parece ser una carga de verduras congeladas con la menor cantidad de carne de cerdo fina de oblea. La salsa era fina y agua como y el mismo plato marrón agua que la sopa. Había pedido dos arroces pegajosos, el primero estaba bien, pero el segundo estaba en el microondas y era un bloque sólido y completamente no comestible. Pagué 38 libras incluyendo la entrega y todo se fue a la papelera excepto el primer arroz.

site_logo

Kay H . 2025-03-12

MORE AT TripAdvisor

The food was tasteless, the roti didn’t have any sauce, the amount of food reduced, the green curry was a watery soup with some pieces of aubergine and tofu floating on it and the tab was broken so all around the bag… wont order again from the restaurant.

site_logo

Macarena . 2025-01-28

MORE AT Just Eat

Wonderfully authentic food and great service. The green papaya salad and larb were amazing.

site_logo

Matt S . 2025-01-26

MORE AT Google

Had a really good lunch with my partner.. great food, great reception.. all round good atmosphere.. definitely going again..

site_logo

Douglas Wilkie . 2025-01-20

MORE AT Google

Best ever!!! Absolute little gem in the heart of the city. Ideal location, easy to reach by public transport. Gorgeous entrance, welcoming atmosphere and lovely decor. The china ware and glasses are very chic. Staff are very friendly and helpful. Menu is varied and everything looks delicious!! It was hard to pick what to have. We had 3 starters and 2 main meals with noodles. Everything was prepared to perfection and the presentation was so inviting!! Every dish was full of flavours, definitely the best Thai l have ever had. Super yummy. For dessert we had affogato. Huge scoop of ice cream, strong espresso and a shot of liquor. Grand finale for a great meal. Congratulations to the chef!! To cap it all, fairly priced, very reasonable. We'll definitely be coming back.

site_logo

Embalmer Trick . 2025-01-19

MORE AT Google

Lovely family run restaurant. The food looks amazing & tastes just as good. Clean & healthy dishes that won't make you feel like a sloth with heavy luggage.

site_logo

Liam Whyte . 2025-01-14

MORE AT Google

We always enjoy the food, and the lunch menu is great value. Friendly service, too.

site_logo

Alexandra Flynn . 2025-01-01

MORE AT Google

Excellent service great food hot and on time

site_logo

scott . 2024-12-24

MORE AT Just Eat

Dinner here was lovely. Friendly staff, good service and delicious food.

site_logo

Rebecca Thompson . 2024-12-03

MORE AT Google

Food was nice but particularly spicy. Expensive, if we hadn't leveraged an itson voucher, we would have not felt it was value for money.

site_logo

David McChang . 2024-11-06

MORE AT Google

Habíamos comprado un vale Itison así que vinimos aquí para almorzar. Comenzó con galletas picantes de langostinos, luego calamares al ajo y pollo satay como entrantes. Para los platos principales teníamos un pollo al curry verde, Pad thai, langostino al curry amarillo y salteado de cerdo con albahaca. Curry no era lo suficientemente picante para mí, pero todo sabía delicioso. Botellas de Prosecco solo £ 22. 80 y botellas de Chang £ 4. 80 . Pequeño restaurante con personal muy amable. Tuvimos una comida encantadora y sin duda volveremos - pero pedir más picante esta vez!

site_logo

Kathryn D . 2024-10-24

MORE AT TripAdvisor

5 stars for the food quality and quantity both!! Delicious taste and such lovely staff atmosphere, loved everything! ❤️

site_logo

Saloni Raut . 2024-10-20

MORE AT Google

Every dish is delicious and truly uses local Thai ingredients. Recommended snack platter, fish sauce papaya salad and main course fried shrimp with rice. Seasoned well, just the right amount of lightness. The fried food is delicious, but the main dishes are a little on the sweet side. The service staff are friendly and enthusiastic and can speak Cantonese. It's really great. The restaurant environment is clean and tidy, and the location is convenient. Highly recommended! Every dish is delicious and truly uses local Thai ingredients. Recommend the snack platter, papaya salad and the main course of fried shrimp with rice. The service staff are friendly and nice and can speak Cantonese. The restaurant is clean and tidy, and the location is convenient.

site_logo

HC Chuang . 2024-10-20

MORE AT Google

Food was tasty enough. Very small portions. Curries were mainly sauce. Bit of a rip off.

site_logo

Jane . 2024-10-13

MORE AT Just Eat

Had lunch: tasty, welcoming staff, nice atmosphere. We’ll be back for more

site_logo

Sergei Plekhanov . 2024-10-06

MORE AT Google

little chicken and aubergine and was cold very poor service crackers poor quality.

site_logo

norman . 2024-09-29

MORE AT Just Eat

All good , great food delivered on time by a polite courier

site_logo

Doug . 2024-09-28

MORE AT Just Eat

Visited for lunch during the week so quiet. Absolutely fantastic food and lots of it! Service was attentive without being overbearing. Warm and welcoming atmosphere from a family run restaurant. Garlic prawns, satay chicken, veg sprig roll. Stir-fry and massaman curry Provence rose wine and Singha. ⭐️⭐️⭐️⭐️⭐️

site_logo

Bathbudgie . 2024-09-27

MORE AT Google

Fabulous evening to celebrate Anniversary with the best food and service . Very reasonably priced too

site_logo

Shona Hunter . 2024-09-23

MORE AT Google

Muy decepcionado no tai en todas las porciones pobre también todo soso incluso pidió muy picante no vale la pena precio no valió la pena estaba deseando que también

site_logo

266pam . 2024-09-21

MORE AT TripAdvisor

We didn’t book and took the waitress by surprise as we waited 15minutes or so and eventually called to say where is anyone! But it was worth a wait as the food was great. All of enjoyed our dishes very much and fried ice cream was nice too.

site_logo

Chris Pegrum . 2024-09-07

MORE AT Google

I love Thai food. However, we found the found here to lack any flavour or depth. The service was good and they made you feel welcome. I had the papaya salad, which I usually love, but it just tasted like shredded veg. I had to ask for extra chilli. We then both had a stir fry with ginger etc. It just looked and tasted like cooked veg with protein. Very watery too. It was like what I have at home for a healthy midweek meal. I wanted something more tasty. I had to ask for and pay for some red curry sauce to give it flavour. The dessert was good though. I’d go back, but it would have to be for a curry, as what we had was pretty lacking in tastiness.

site_logo

Cat Lover . 2024-09-07

MORE AT Google

Over priced for quality and packaging

site_logo

Bowmeister . 2024-09-03

MORE AT Just Eat

Food was fine however not worth the price. Curry for GBP 16.00, really? It was more like Thai street food and you would expect to pay not more than GBP 10.00. Also, I am pretty sure they are using 2 l Coca Cola bottles, as mine had zero gas. Not impressed, would not go back.

site_logo

Gintare . 2024-08-26

MORE AT Google

Food was delicious. I had Tom Yum and Massaman curry. Both were amazing. Everyone at my table enjoyed their food. Would recommend

site_logo

N M . 2024-08-23

MORE AT Google

First visit to this restaurant yesterday. Everything was absolutely fantastic. Cannot rate our meal and the overall experience highly enough. Best meal I've had for a long time. Highly recommend for anyone who likes Thai food.

site_logo

Jillian Brannan . 2024-08-05

MORE AT Google

Bad experience- in the name of Thai, they spoil the food by changing the way it should be & claiming it will be like that only.. also too late

site_logo

Ganesh Prabu . 2024-08-03

MORE AT Google

Great wee find, don't know why I have not been here before

site_logo

Bryan Sibson . 2024-07-27

MORE AT Google

We only use this place for Thai.. it’s the best, and I’m fussy.. every single time its, tasty, authentic and deliciously more ish….

site_logo

Nicola . 2024-07-17

MORE AT Just Eat

Regular customer at arguably one of the best Thai restaurants in Edinburgh, great service, great food and great vibe. Would recommend for anyone nearby and takeaways are also great.

site_logo

Callum Lancasterggmtmr . 2024-06-16

MORE AT Google

Absolutely delicious! First time ordering from here and we loved it. Highly recommend.

site_logo

Lucy . 2024-06-16

MORE AT Just Eat

Been twice supper and lunch like it good food convenient location no 23 bus takes you to door!

site_logo

Aline Dobbie . 2024-06-14

MORE AT Google

The food was awesome from the appetizers to main course to beers 🍻 this is definitely something I will recommends visiting 💯

site_logo

Jose Manuel Garnica . 2024-06-13

MORE AT Google

Most delicious Thai food I have had . It's worth every penny

site_logo

Libby . 2024-06-13

MORE AT Google

Tuvimos un almuerzo encantador aquí. La comida era genial y la camarera muy agradable. El restaurante es un espacio agradable, luminoso y espacioso con cómodos asientos. Buena comida a un precio razonable. Lástima que los cócteles no estaban disponibles en nuestra visita para el almuerzo, pero teníamos una botella decente de vino blanco.

site_logo

Karen L . 2024-06-07

MORE AT TripAdvisor

Precioso restaurante. El personal maravilloso, amable y la comida es siempre fantástico - sabroso, un montón de ella y a un buen precio para lo que obtienes.

site_logo

Donna M . 2024-05-28

MORE AT TripAdvisor

Wonderful experience all together. Lovely restaurant (peaceful and quiet), friendly staff, delicious food, great prices... Right on the highstreet.

site_logo

Avits McYak . 2024-05-22

MORE AT Google

Lovely Thai Lounge Bar in Edinburgh. Great service, the two girls that served us were lovely. The food was reaaaaally good, fresh and tasty. We will definitely come back. Thank you!

site_logo

Diego . 2024-05-19

MORE AT Google

First time visit and it won’t be our last. wonderfully friendly and efficient service, great choice of menus fully explained to us. Very reasonable prices. Went for my birthday, great decision!

site_logo

Derek B . 2024-05-10

MORE AT Google

Mad delicious, I’m Thai, been in Thailand my whole life.

site_logo

Megan Kitviriya . 2024-04-17

MORE AT Google

Portion size small for price paid, quite disappointing but tastes good.

site_logo

Lois . 2024-04-13

MORE AT Just Eat

Very good food and great service, together with a very well priced menu.

site_logo

Daniell Alessandro . 2024-03-25

MORE AT Google

We pre-ordered a takeaway meal for six people around 4pm with a delivery time of 6.20. However, our food didnt turn up till 7.20. And it was by then lukewarm. Communications were non-existant - we didn’t get any online confirmation of our order and could not call the restaurant as their phones just went straight to voicemail. We also never had the courtesy of any response to our voicemails. So we didn’t know whether we would receive our order, worth over £100, or not. We have had great food here but that was a big let down and I doubt we would order from here again.

site_logo

Colin . 2024-03-10

MORE AT TripAdvisor

Great food. The soup and dipping sauce for the spring rolls were amazing!

site_logo

Volker Seeker . 2024-03-02

MORE AT Google

This was so incredibly disappointing. After starters which were over priced but fine , I ordered one of the chicken stir fry dishes. I have to say it was one of the most tasteless experiences in a restaurant I’d ever had. A few pieces of chicken that looked like it had come out of a packet and a collection of wet steamed / braised vegetables that had absolutely no flavour whatsoever. Nothing Thai about it. I can’t believe I didn’t take it back but we had a film to get to. Really not ok to charge these prices for such inadequate, bland food.

site_logo

Stephanie . 2024-02-10

MORE AT TripAdvisor

Two hours late. Lukewarm food and given a different starter than I ordered.

site_logo

Georgina . 2024-02-04

MORE AT Just Eat

It was ok. Not the best Thai but did the trick, wouldn’t rush back

site_logo

Balal . 2024-01-10

MORE AT Just Eat

My husband and I love this place. We have been a few times and sampled many of the curries, soups, and pad Thai. The soups are fantastic. Really rich and flavoursome. The curries have all been great. The prawns have always been especially large and high-quality. We enjoyed the pad thai too. The wine pairings are also very good. We loved it so much, we went back twice within a couple of weeks. Really friendly staff too, who made us feel very at home.

site_logo

Claire M . 2024-01-03

MORE AT Google

They were perfect with the amount of spice level in the chicken and egg rice.... simply giving me exactly what I wanted... great service, good price, excellent food..

site_logo

Wlliam Heitmann . 2023-12-30

MORE AT Google

We went to Gratitude Thai Lounge for my husband’s 50th birthday. The extensive gluten free options were a huge draw and we weren’t disappointed. The staff were really friendly and attentive and really helpful in making sure that the dishes came out at spice levels everyone was happy with. The food was plentiful and delicious and it was great to try new dishes that we hadn’t had before. We’d thoroughly recommend and will be back as soon as possible!

site_logo

dianejburgess23 . 2023-12-21

MORE AT TripAdvisor

Had my birthday dinner and drinks here, great ambience, tasty Thai dishes, every dish was seasoned just right (we love Thai food) good wine offering! Kate and her mom’s service was outstanding, good attention to us and our guests, good lighting, we took cracking photos. Thank you ka, we will be back again soon.

site_logo

Melusi Ncube . 2023-12-13

MORE AT Google

Tried this place because of the lunch deal (14 for 2 courses) and the outside looked quite appealing. It had a good choice for the lunch menu (sometimes they can be limited) and the food was very flavourful and fresh :) some good citrus and heat flavours as expected from decent Thai food. staff were really nice and they allowed our dog in with no hassle. After trying the lunch menu I will try this place for dinner in the future, would definitely recommend :)

site_logo

Conor Kerr . 2023-12-05

MORE AT Google

Great Thai food and friendly service. Good choice for vegans and vegetarians.

site_logo

Glen . 2023-11-26

MORE AT Google

This is the best Thai food in UK I have ever ate before

site_logo

Jasmine Yuen . 2023-11-20

MORE AT Google

The food was different from my usual choices, but it was very good, just the right amount and the overall ambience was pleasant.

site_logo

Kevin O'Neill . 2023-11-18

MORE AT Google

Great neighbourhood restaurant - have ordered take-away several times here and we’ve been delighted with the food. Good menu, with selection of vegan and vegetarian options. Noticeably very fresh ingredients, expertly prepared Thai meals and excellent, caring service. Manageress Kate went to some trouble recently to successfully resolve an issue with terrible service from a third-party delivery company (Uber-Eats) on our behalf. A great option for takeaway, and we hope to sit in for a meal sometime soon.

site_logo

Dan W . 2023-11-11

MORE AT Google

Have eaten here several times over the last few months and love it. Great food, good service, very pleasant surroundings for a reasonable cost. What’s not to like!!!

site_logo

Angela Murray . 2023-10-28

MORE AT Google

This is one of our favourite local restaurants. Really nice people and great food at a good price . The tapas style dishes make a great dinner choice. The wine list is fine.

site_logo

Cortopasso . 2023-10-16

MORE AT TripAdvisor

Fantastic food and good service. The green and yellow curries and the street rice and sticky rice were all amazing and very tasty and authentic!

site_logo

Hackney Voter . 2023-10-05

MORE AT Google

Had an amazing meal tonight for a 96th birthday. Friendly and welcoming, service excellent and food exceptional. They even brought a doggy treat and water over for our extra addition to our party of 9. We'll be back 🤩👍

site_logo

Lynette Daly . 2023-09-30

MORE AT Google

Fantastic food as always. But was nearly 45mins later than requested.

site_logo

Kylie . 2023-09-19

MORE AT Just Eat

Friendliest people! Food is authentic and delicious.

site_logo

Donal O'Connell . 2023-09-18

MORE AT Google

Amazing food and cocktails ! Waitress is lovely ! Definitely will come back

site_logo

DomI NIka . 2023-09-08

MORE AT Google

Portions really small for price and order incorrect.

site_logo

Aaron Mc Enaney . 2023-08-18

MORE AT Google

Delicious! The red curry is hot but gooooood 🥵

site_logo

Oele Geirnaert . 2023-08-13

MORE AT Google

We spotted this restaurant after the cinema and decided to have dinner. It has a modern vibrant feel about it. The menu offers a great choice. We had the squid and fish cakes to start. I had the green thai curry with aubergine and chicken which was perfectly cooked accompanied with a generous portion of perfectly cooked sticky rice. The service was warm and friendly. So glad we came across this one and will definitely be back.

site_logo

G9342XZjuliek . 2023-07-30

MORE AT TripAdvisor

I think this is some of the best Thai food in Edinburgh, along with great service. The Tapas style starters are very generous, with two to share more than enough. We had the Green Curry and Masaman curry and there were generous portions of both. Extremely nice food.

site_logo

Ken Glendinning . 2023-07-27

MORE AT Google

Amazing food. Will definitely order again. Thanks

site_logo

Luna . 2023-07-25

MORE AT Just Eat

Delicious food with lovely friendly staff.

site_logo

Carolyn Thornton . 2023-07-25

MORE AT Google

I was at Gratitude for the first time today. This place is a hidden gem, the restaurant was well set out and welcoming. The food was delicious, and although the wine list was limited there were some great wines on offer. The lady that served us was friendly, welcoming and knowledgeable. I would highly recommend and I will most definitely be back.

site_logo

Aileen Murray . 2023-07-20

MORE AT Google

I had dinner today (19/07/23) and Kate and the lady with the blonde hair went above and beyond. Very lovely staff! And food very yummy!

site_logo

Luisa Ortega . 2023-07-19

MORE AT Google

We were not sure about going to Gratitude because there used to be a favourite Italian restaurant in these Churchill premises. But we were delighted with our eating experience. Firstly, the waitress was elegant and intelligent. She knew how to deal with 4 old timers with fun and courtesy. Then the food. Everyone had something different. Everyone was pleased. My unadventurously chosen Tom Yum soup was perfect. Then my spicy beef fried rice was just as good. The wine was decent and modestly priced. The restaurant is family run, just like its predecessor. It deserves to be very successful.

site_logo

MacdEdininburgh . 2023-07-07

MORE AT TripAdvisor

Very kind team and very good food

site_logo

Denise Gaillard . 2023-07-01

MORE AT Google

It tasted ok, but we ordered two completely different dishes and what we received was different ingredients in the same sauce, the sauce was watery and thin. Hardly any flavour. A bit disappointed to be honest.

site_logo

Graeme . 2023-06-25

MORE AT Just Eat

Great food and drinks. Really friendly and attentive staff. Would definitely recommend a visit

site_logo

tracey ashmore . 2023-06-23

MORE AT Google

poor service and very average food I would nor recommend this restaurant to any one expensive small portions

site_logo

beefhea . 2023-06-06

MORE AT TripAdvisor

Very inviting welcome by the super friendly and humorous staff. The menu offers a wide choice for vegetarians, drinks are great with many mocktails and Singha beer from the barrel. The food was freshly cooked and very tasty. They know how to use spices to make it perfect and not too hot. Really enjoyed a fantastic dinner here for a very fair price. Definitely worth going to!

site_logo

Anton S. aus H. . 2023-06-02

MORE AT Google

Toller Empfang, sehr spaßige Bedienung mit grossartigem Sinn für Humor. Die Karte hält reichlich vegetarische Optionen bereit und die Mocktails haben uns sehr gut geschmeckt. Das Essen war frisch zubereitet und perfekt gewürzt: Nicht zu scharf aber schon mit Geschmack. Herrlich! Die Preise bleiben dabei im sehr fairen Rahmen, so dass wie hier einen Klasseabend verbracht haben. Wir kommen sicher wieder!

site_logo

Tornado0963 . 2023-06-01

MORE AT TripAdvisor

Terrible food. I threw my dish away after one fork, meal smelt and tasted bad. My partner ate her meal as was starving but again it was not nice, half cooked. Delivery driver also dropped one of the meals over my doorstep due to the bag falling apart. I spent 10 minutes cleaning my doorstep.

site_logo

maria . 2023-05-31

MORE AT Just Eat

推介青咖哩雞丶炸蝦餅丶糯米飯丶薄餅丶泰式凍檸茶和生啤 以上在泰國都未吃過這樣好吃的 服務非常好,親切友善👍👍👍

site_logo

Yan Tse . 2023-05-29

MORE AT Google

Very nice restaurant. I expect the food to be more spicy, but it was very tasty nonetheless. Service rather slow though.

site_logo

Simona Foscarin-Kosmetatou . 2023-05-27

MORE AT Google

Wonderful experience. Fabulous food, great choice, staff that are uber friendly, what's more to ask for? Been back 3 times in the last week and the prices are very reasonable too.

site_logo

Alan Stewart . 2023-05-24

MORE AT Google

The food was very tasty, and the delivery was quick. We will definitely order from Gratitude Thai again

site_logo

Rosie . 2023-05-22

MORE AT Just Eat

Forgettable food, verging on bland, not a hint of spice although asked for spicy. Not at all authentic. Service was friendly and a nice atmosphere. 2.5 stars

site_logo

Kerry Catterson . 2023-05-18

MORE AT Google

Food was excellent, arrived on time and was hot.

site_logo

Nicholas . 2023-05-17

MORE AT Just Eat

Had a lovely experience at Gratitude Thai Lounge Bar. My friends and I had made a large booking of 14 of us and we all thoroughly enjoyed the food, drinks and the friendly and efficient service. Great atmosphere.

site_logo

Eirini Tamousi . 2023-05-08

MORE AT Google

Got chicken spring rolls instead of vegetarian ones ...

site_logo

James . 2023-05-08

MORE AT Just Eat

Had a lovely experience at Gratitude Thai Lounge Bar. My friends and I had made a large booking of 14 of us and we all thoroughly enjoyed the food, drinks and the friendly and efficient service. Great atmosphere.

site_logo

eirinitamousi . 2023-05-08

MORE AT TripAdvisor

Relaxed atmosphere with gorgeous food!! All very reasonably priced for the quality!! Delicious - we will be back!!

site_logo

39Pat39 . 2023-05-05

MORE AT TripAdvisor

We popped in for lunch today. Delicious food and great service. We had Thai fish cakes, chicken satay, Penang curry and a pork curry with delicious authentic sticky rice. We will be back to try some more of the food and the cocktails.

site_logo

WalkinWonderland . 2023-04-30

MORE AT TripAdvisor

First time visiting this local restaurant. Incredibly fast service!

site_logo

Anna Raper . 2023-04-29

MORE AT Google

Amazing authentic Thai culinary experience! Service and food was outstanding and the best we have enjoyed in Edinburgh! Catered for complex dietary needs and everything was available to the whole party. Highly recommend!!

site_logo

CarolineB3592 . 2023-04-25

MORE AT TripAdvisor

Found this gem in Morningside and I am so glad I decided to try somewhere new! I went for the Whisky Duck for my starter and the Pad Me Noodles as my main. It was as exceptional as the customer service. Would highly recommend! Ambiance 10/10 Food 10/10 Service 10/10

site_logo

Nambela C . 2023-04-11

MORE AT Google

Delivery driver was so smiley and friendly, great service

site_logo

Andrew . 2023-04-02

MORE AT Just Eat

Similary restaurants in Edinburgh and Lothian

restaurant_img
4.4

378 Opinions

location-icon73 Saughton Road North
Other cuisines
outdoor_seating_212232takeaway_212232delivery_212232

Great venue with great staff and an incredible atmosphere. The Friday and Saturday nights in particular with the live DJ are next level, if you fancy a wee pint and a boogie jus out of town I would definitely advise this place. Full on 10/10, I'd happily be there any day of the week. Mon The Terrace

restaurant_img
4.4

2673 Opinions

location-icon32 Castle Street
Other cuisines
outdoor_seating_207800takeaway_207800delivery_207800

My husband and I were traveling in the UK. Everyone had said we would love Edinburgh and they were right! A highlight was when we chose to eat at The Badger for dinner. The food was awesome and so was the service. The bread was so fresh and homemade that I would consider going back just for bread, but better than that was their famous Meat Pie. I had chicken and hubby had the beef pie. Both were scrumptious! The bill was not too bad, either, especially considering we both had a large glass of wine. If you want to go, call ahead or schedule online (which we did, no hitches!). We did not get to taste dessert because we were both so full but next time!

restaurant_img
4.4

33 Opinions

location-icon24 Royal Terrace, Edinburgh EH7 5AH Scotland
Other cuisines
outdoor_seating_268365takeaway_268365delivery_268365

Great staff, Tony amazing host. Everything in this hotel is great. The bar looks amazing and all the knowledge of whiskey Tony has. Has a great collection it he will find you the one suits the most to your likings. Didn’t have food only breakfast so cant have an opinion on that. But probably really good as well.

restaurant_img
4.4

72 Opinions

location-icon154 Dundas Street
Other cuisines
outdoor_seating_204334takeaway_204334delivery_204334

Great cafe and staff ,they also have a great specials board ,with something unusual and tasty!

restaurant_img
4.4

45 Opinions

location-icon75 Clerk Street
Other cuisines
outdoor_seating_205759takeaway_205759delivery_205759

I'm not sure. My mocha tastes like a hot chocolate, maybe I received a hot chocolate, it's a bit overpowering.... And overpriced for my taste. Probably won't go back ☹️ However, lovely staff!