GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.3

Based on 1.216 opinions finded in 5 websites

site_photo4

Nº 288 in 773 in Haringey

Nº 26 of 46 Italian in Haringey

CUSTOMERS TALK ABOUT DISHES WITH..mozzarellaparmesantiramisucoffeesandwichsaladpaypastasteakcookedcheesecarbonaramushroomspizzapotatotomatogarlicchickenravioli

comment_iconOpinions

A couple of fabulous vegan options on the relatively healthy side and decent portions. Great option if dining with kids. It's definitely not a couples sort of vibe unless you're in a hurry for something decent and are not bothered about it being full of kids.

site_logo

Siobhan Renshaw . 2024-10-01

MORE AT Google

Super place , lovely staff, nice atmosphere

site_logo

Kasia . 2024-09-27

MORE AT Google

We absolutely love, love, love this place! Yummy, fresh food with so many delicious options that everyone in the family always happy when coming to eat here! Fab, authentic sabich, ideally served with a Noam beer - great! The Pesto Crema pasta also a favorite! All the pasta is fresh with a variety of sauces. Delicious! Staff ALWAYS super friendly! I cannot understand past reviews about the prices and wonder how people expect to pay any less??Very reasonably priced for London!

site_logo

Cherie Morgan . 2024-09-14

MORE AT Google

We absolutely love, love, love this place! Yummy, fresh food with so many delicious options that everyone in the family always happy when coming to eat here! Fab, authentic sabich, ideally served with a Noam beer - great! The Pesto Crema pasta also a favorite! All the pasta is fresh with a variety of sauces. Delicious! Staff ALWAYS super friendly! I cannot understand past reviews about the prices and wonder how people expect to pay any less??Very reasonably priced for London!

site_logo

Cherie Morgan . 2024-09-14

MORE AT Google

We absolutely love, love, love this place! Yummy, fresh food with so many delicious options that everyone in the family always happy when coming to eat here! Fab, authentic sabich and the Noam beer is great! All the pasta is fresh with a variety of sauces. Delicious! Staff ALWAYS super friendly!

site_logo

Cherie Morgan . 2024-09-14

MORE AT Google

Decent food but occasionally missing a topping.

site_logo

Tom Smith . 2024-09-03

MORE AT Google

Lovely little restaurant 😍 would deffo go back. Pasta is made daily and cooked to order 😋

site_logo

Gemma Capper . 2024-08-30

MORE AT Google

This was my first time there. I've tried the Spicy red hot Shakshuka 🌶️ and it was great! I love it! The service was also great, the staff are very friendly and welcoming. Will definitely go back to try something else!

site_logo

Achraf Feydi . 2024-08-23

MORE AT Google

I am giving it 5 starts because we had the best service I have had in years. The very young team of girls was extremely accommodating, welcoming and attentive. The food is good, if you love pasta, you will be happy here. The chicken schnitzel was very nicely cooked and the salad was great. However the hummus and the bread weren’t great.

site_logo

Patricia Canedo Rivas . 2024-07-13

MORE AT Google

incredible, food, staff everything 5/5 every time

site_logo

Freyja Emms . 2024-07-05

MORE AT Google

I absolutely love this restaurant - the food never disappoints and the staff are always so lovely and friendly. The atmosphere is amazing and always filled with such an energetic vibe, FASTA is for everyone - from teenagers to more older people, everyone here loves it. The food is so delicious and this is probably my go-to restaurant!

site_logo

Olivia Nathan . 2024-07-05

MORE AT Google

Ordered the Mac & Cheese, was nothing like Mac & Cheese. It was bland drypasta with cream and zero flavour and zero cheese. Come on guys this simply not good enough

site_logo

Haider . 2024-06-16

MORE AT Just Eat

The food was good, service was attentive and the staff was understanding

site_logo

A C . 2024-06-05

MORE AT Google

I had an amazing experience at this restaurant with the customer service and interactions. I was treated with the utmost care and the food was mouth-watering.

site_logo

Mohamed Said . 2024-05-27

MORE AT Google

Not tasty. Don’t waste your money here a lot better options in Muswell hill. Not authentic.

site_logo

Susan . 2024-05-25

MORE AT Google

service and food was amazing. we passed by venue and decided to stop. i will be going back here again, food was great and value for money. this is my new to go spot. 5 Star

site_logo

gavin charters . 2024-05-18

MORE AT Google

Terrible tasting food and was cold when arrived. Staff are very rude.

site_logo

Kier Louis . 2024-05-16

MORE AT Google

I will start with it - overall it is a cute pasta place🍝. Our family decided to check out this pasta spot ( they have more options rather then pasta but we went for the pasta and hey,their name is Fasta Fresh Paste Bar😉) and it had a pretty cute vibe. We ordered a variety of pasta, the ravioli was actually pretty good, they have few fillings like ricotta and mushrooms or 4 cheese and you could tell they used fresh pasta, which we appreciated. The cool thing was you could pick your pasta type and sauce. The cream sauce was tasty, but the tomato sauce was kinda of plain, more like something you'd whip up at home. Disappointingly, the supposed chili sauce lacked any discernible heat, so we asket for more chilli,the dried chili spice the gave, failed to salvage the dish. It's clear they missed the mark on their chili spice selection. Dessert was nice though, especially the pistachio ice cream. Our waitress was super friendly and positive, which was a plus. This Pasta place had a good variety of starters, and the halloumi bite and cheese bite with their special sauce was seriously amazing. Overall, it had its ups and downs. Not cheap for what you gets. The fresh pasta and friendly service were great, but the plain sauces and high prices were a bit of a letdown.

site_logo

Tehila . 2024-05-05

MORE AT Google

Food took 50 min to arrive - driver could not find the house - was rude when he called accusing us of not having a number he could see - I called the restaurant to complain and the person answering argued and said he saw no problem - very unpleasant experience

site_logo

Charles Irvine . 2024-04-24

MORE AT Google

Came during 3pm on a Thursday, restaurant was nice and quiet with very quick service. The prices were really good and the food was excellent - we got the tagliatelle arrabbiata and the schnitzel box. Highly recommend.

site_logo

Jonathan Ho . 2024-03-28

MORE AT Google

We have been to this restaurant few times and have ordered online too. We love their felafel and we use to love steak sandwiches. However on our last visit the steak sandwiches were overcooked, the caramelised onions were so dark in Colour and bitter in taste. The sandwich was filled more with onions than steak. In each visit the service was so slow. Have to ask a couple of time for everything. I think the team is young which can be great and positive but they need to be trained to deliver a better customer service or be supervised at all time. For all the above reasons I don’t think I will return, however I will be ordering online their felafel wraps.

site_logo

SOHEILA TAKLIMI . 2024-03-16

MORE AT Google

The best falafel place in all the UK! I'm a big fan of falafel and tried so many of them in the UK but this one is something exceptional with outstanding food quality and service. Although I live in the other side of London I will go there again for sure!!

site_logo

joachim gartner . 2024-03-01

MORE AT Google

This place should set the standards for all London restaurants, service (amazing, friendly, happy, super fast) atmosphere and decor, food freshness and quality, and overall experience, clearly the owner loves and appreciates good food and dining experience, highly recommend

site_logo

Jony Geron . 2024-02-17

MORE AT Google

Small portion and the dessert wasn’t fresh. Pasta tasted good dessert very poor taste.

site_logo

Eirini . 2024-02-10

MORE AT Just Eat

The soup had too much cheese on it. In fact I didn't want cheese. The menu didn't say cheese. Yet it was slathered in it. Prices were quite high for what you get. Noone there, feels like a ghost restaurant

site_logo

Tati Lee . 2024-01-31

MORE AT Google

Very good food and best service! Gabriel and Victoria offer a nice experience! I will come back soon!!

site_logo

Conchita Hilders . 2024-01-28

MORE AT Google

I went to this restaurant with my family including two young children aged 10 and 7. The meal was absolutely fantastic and there was a great selection of food and drinks for everyone. We loved the delicious food and the wonderful atmosphere. We are looking forward to our next visit!

site_logo

Marc Cohen . 2024-01-16

MORE AT Google

Amazing tagliatelle creama pesto,very friendly staff, Yummi delicious restaurant

site_logo

Oded Naftali . 2024-01-07

MORE AT Google

Guys PLEASE PORTABELLO mushrooms. It have been several times that it was small shrooms. Thank you <3

site_logo

Henrijeta . 2024-01-06

MORE AT Just Eat

Service is slow, food is not great, ordered pasta with chilli, the tagliatelle was overcooked, chilli was nonexistent. For a party of 4, pasta arrived at different times and parmesan was an afterthought. Tried to order a coffee which took over 20 minutes to order and another 20 to come. Staff were untrained, senior staff member was sarcastic and unbelievably rude. Impossible to get the staff's attention without having to shout "Excuse me" loudly. All busy on their phones. Paid over £75 for a pretty poor all around experience including added on service charge! Won't be going there again!

site_logo

AMINA YAQIN . 2024-01-06

MORE AT Google

We have been coming to Fasta for years! Great food and great service keep us coming back. Gabriel is one of the managers and an absolute gem - great with the kids and so welcoming - we often have birthday celebrations here and the staff always go out of their way to make things special. I couldn't recommend this place more!

site_logo

Jess M . 2024-01-06

MORE AT Google

Pleased all round. Good delivery guy.

site_logo

James . 2024-01-03

MORE AT Just Eat

Just had the best pasta in North London !!! The staff are so lovely, the food comes quick and is so delicious. Would recommend to everyone i know. Definitely coming back here again :)

site_logo

Ashani Stevens . 2024-01-02

MORE AT Google

5/5 food, service and experience. Staff are very friendly and flexible. So lucky to find a restaurant I can be a regular at near where I work.

site_logo

Noam . 2023-12-29

MORE AT Google

Very delicious pasta and surprisingly has a great humus option too. Nice to be able to pick from a range of pastas and sauces and toppings

site_logo

Sherwin Sacki . 2023-12-29

MORE AT Google

This place is an absolute gem! You will not be disappointed. Also the staff are ever so lovely and attentive.

site_logo

Isabella . 2023-12-22

MORE AT Google

Very friendly staff and the food was lovely!

site_logo

Bob Toovey . 2023-12-15

MORE AT Google

Absolutely unreal shakshuka. One of my favourite place for lunch in the area. Strongly recommend.

site_logo

Gary Fire . 2023-12-14

MORE AT Google

Brilliant food, brilliant customer service, brilliant business I will definitely be a returning customer

site_logo

Rogot . 2023-12-05

MORE AT Just Eat

Food is tasty, however I thought on the expensive side. Service is exellent, staff is very friendly.

site_logo

Johana Mejia . 2023-11-28

MORE AT Google

Slightly annoyed, after calling the restaurant to ask for some wooden cutlery to be sent, the order arrived without any. Wouldn’t normally be an issue but when working on a site where this is none, made eating my grub a little awkward.

site_logo

Stev . 2023-11-27

MORE AT Just Eat

13 of us for dinner but still the service was good (despite a full restaurant), food was quick but tasted great. I haven’t been to Fasta for a few years but really glad to see it’s still a favourite with the locals.

site_logo

Rachel Spalding . 2023-11-26

MORE AT Google

I liked the falafel box, but pasta was typical

site_logo

mohsen barzegar . 2023-11-14

MORE AT Google

All so good as always. Tiramisu was spectacular!

site_logo

Cristina . 2023-11-11

MORE AT Just Eat

I had a delicious meal, fresh pasta and sauce, good portions, tasty beer. Highly recommend the pistachio dessert😍. My server Brenda was extremely attentive and helpful. She gave us both recommendations which we loved. She ensured we were well looked after. Would highly recommend this place.

site_logo

Lola Sutherland . 2023-11-08

MORE AT Google

Interesting combo of Falafel and Hummus bar with pasta restaurant. The service is friendly and the place is spacious and comfortable. So, the food: the falafel and hummus are pretty decent for this part of the world, always fresh and hot. The pasta is like comfort food, it need A LOT of seasoning, which is fine, and eventually it's tasty enough, I wouldn't compare it to Italian pasta though. I will say, kids love it!

site_logo

naomidara . 2023-11-02

MORE AT Google

The food is superb, and the staff is even better! We were served by Brenda, who was exceptionally welcoming from the moment we walked in the door. I would definitely recommend this place to anyone in the Muswell Hill area. 10/10!

site_logo

daniel fernandez . 2023-10-30

MORE AT Google

Really tasty pasta! Speedy delivery. Have had a few dishes from Fasta and they are always good. Would recommend!

site_logo

Linda . 2023-10-29

MORE AT Just Eat

This place still my favourite 7 years and counting!! And now my toddler is hooked too! Thankuuuuuu

site_logo

ferduche miah . 2023-10-25

MORE AT Google

One of my go to places in Muswell hill. Staff are very friendly, portions are good, food is tasty, I like their chicken schnitzel particularly. There could be some more options in the menu but overall a good experience.

site_logo

shilpa gopal . 2023-10-21

MORE AT Google

Always good pasta and fast service!

site_logo

Irakli Sh . 2023-10-09

MORE AT Google

I really enjoyed the food and it was a good portion but I do think it was too expensive for what it was. The staff were very friendly and helpful. I was given a dirty glass but it was replaced very quickly

site_logo

Hannah B . 2023-09-25

MORE AT TripAdvisor

I cannot tell you how much I love the food at this place. I've had it for takeaway many times but recently went for a big meal with friends and the staff were great and the food was as amazing as ever. Veggie / vegan and gluten free options too

site_logo

Becki . 2023-09-05

MORE AT Google

Waitress didn't seem as if she wanted to be there. Not attentive. Food was OK. Took quite x long time to come out One person had starter but halfway through their start the mains all came out! Had to ask if our drinks were coming. Didn't get asked what dessert we wanted, we couldn't get anyone's attention, do we decided to oayzand leave

site_logo

Mysquishy . 2023-09-03

MORE AT Google

Great pasta, tastes amazing staff! staff were nice too

site_logo

Mary Moris . 2023-08-25

MORE AT Google

Fantastic food for the price- good portion sizes and very tasty. Décor isn't anything to write home about but service is good and staff are friendly.

site_logo

Justacookie . 2023-08-04

MORE AT Google

I just had 2 pita sandwiches sabich pitta and schnitzel pita i can say it was the best so delicious, we will definitely be back👍🏽 highly recommended

site_logo

Saliha.00 Guloglul . 2023-07-31

MORE AT Google

My daughter's favourite place for a brunch. The gluten-free pasta, the garlic bread, basically the food is fantastic. The location and atmosphere are great, prices are reasonable, and the place is ultra clean; to summarise, it's a place we will surely be visiting again.

site_logo

Raviv Haddi . 2023-07-29

MORE AT Google

Ok place for lunch. Chicken salad for £14... Plenty of salad and plenty of chicken.

site_logo

Robin Rottier . 2023-07-28

MORE AT Google

Best pasta in all of north london!

site_logo

Nikesh Gudka . 2023-05-24

MORE AT Google

lovely place w great service v nice waiters and food was delicious! consistently very good experience

site_logo

Flyer35750108854 . 2023-05-08

MORE AT TripAdvisor

Bit like a cafe. Pasta was edible but that is about all you could say for this place

site_logo

Ian Barlow . 2023-05-03

MORE AT Google

Food was okay. A bit bland. Needs more seasoning, salad dressing, chili sauce, something, anything. Staff were lovely though. All credit to them for a pleasant visit.

site_logo

Liam (3Ghz) . 2023-04-25

MORE AT Google

Absolutely delicious especially creamy mushroom pasta. Lovely and friendly staff. A real go to place for a treat with the family

site_logo

Selen Cavcav . 2023-04-12

MORE AT Google

It is a lovely restaurant. Food was amazing. It is a 4 instead of 5 mainly as the falafels were saltier than what I expected.. But rest of the meal was so good... Eaten with salad wasnt too bad. Only other issue is limited desserts... Worth a visit as a mid priced food joint.

site_logo

Thendral Mangala . 2023-04-05

MORE AT Google

Great option in Muswell Hill for lunch or dinner. Friendly service and a nice atmosphere. As for the flavour and quality of the food, the presentation was beautiful and portions really generous. The falafel platter- loved the gherkins, hummus, friend aubergine and bread particularly. I think there could have been more zing and punch in the food, but I haven’t tried the pasta or much else from the menu so I would return.

site_logo

Arden . 2023-04-01

MORE AT Google

It was a lovely experience . Food was good but what made the experience even better was how great the customer service was . Gabriel was very helpful and funny

site_logo

Klesi Tsakalli . 2023-03-28

MORE AT Google

Absolutely lovely food. Great sized portion and I highly recommend

site_logo

Nicola . 2023-03-03

MORE AT Just Eat

amazing! Owner and manager Oded and Gabriel are super lovely. We go very often. Amazing pasta, great staff. Fast service

site_logo

Asher Piggycow12 . 2023-02-17

MORE AT Google

Felafel was decent. Service was a but slow.

site_logo

James Chesnut . 2023-02-16

MORE AT Google

Very bland food, lack seasoning, pasta is very claggy by the time it gets here

site_logo

justin . 2023-01-28

MORE AT Just Eat

Great food and always fantastic service, especially from Gabriel. Especially good for kids.

site_logo

Guy Fridja . 2023-01-27

MORE AT Google

So good! Best restaurant in north london

site_logo

7cem . 2023-01-19

MORE AT Google

The place itself is lovely however the waitress was not. The meatballs I ordered was such a small portion. I was in shock. I dish a bigger portion for my grandaughter who's 6. The food was bland no flavour. The pesto cheese garlic bread was amazing as we're the chips. When I questioned the waitress about the portion size she laughed. When she asked how the food was I said I'm not going to comment she laughed. Before my friend had finished his last piece of garlic bread she came over whipping away his plate. Then was told were closing now at 9:30pm. No time to finish my tea, let my food relax. My personal experience and my friends was not good and for the price, well totally not worth it in my opinion. Sorry to say this but am definitely not a happy customer.

site_logo

Claire Harvey . 2022-12-23

MORE AT Google

Delicious food and absolutely amazing staff

site_logo

Hrayr Diloyan . 2022-12-20

MORE AT Google

Had great lunch with my wife. Nice food. Sweet waitress and lovely time. Price accordingly, but happy to pay for a good meal

site_logo

Ofir Lahav . 2022-12-12

MORE AT Google

Tonight I had dinner at Fasta Fresh Pasta for the first time, and would absolutely recommend it to anyone! Everything was great and I was particularly impressed as to quick the food arrived. The restaurant is very modern and has such a calming/relaxing atmosphere in comparison to other restaurants I have been to. I look forward to coming back soon and hopefully will try the Shakshouka next time!

site_logo

Dan Bonham . 2022-11-20

MORE AT Google

Excellent pre-cinema meal here. We very much enjoyed our 'create your own' pastas plus some very tasty halloumi bites. Everything tasted so fresh. Service was pleasant and very quick. A little pricey I suppose though hardly excessive for this part of London. The menu expands well beyond just pasta so we'll have to come back.

site_logo

Travelfromessex . 2022-11-19

MORE AT TripAdvisor

Carbonara so creamy and full of flavour! Made it how I like it with extras!

site_logo

Kevin . 2022-11-14

MORE AT Just Eat

Great little lunch place. Good kids' options of fresh pasta options which got a double thumbs up from the little ones. The menu is a mix of Israeli falafel/fluffy pita/shakshuka and then a fresh pasta menu with a selection of sauces. Everything coming out looked great. Food lacked a little seasoning but was fresh and nicely presented. Service was good too. We'll come back!

site_logo

J B . 2022-11-13

MORE AT TripAdvisor

Late food, little help from the restaurant then when the food finally arrived it was all cold or lukewarm. Very disappointing considering the short distance the food had to travel and the increased cost of everything on the menu.

site_logo

James . 2022-11-06

MORE AT Just Eat

Great pasta. Nice flavours and made it how I want it with additional ingredients! Wish there was an option for bigger portion sizes. Other than that would definitely recommend and will be ordering again!

site_logo

Kevin . 2022-11-03

MORE AT Just Eat

My go to for healthy fresh food!

site_logo

dee . 2022-09-26

MORE AT Just Eat

I'll keep it short and sweet. 1 day me and the partner went to get falafel. The guy at the till said its the best in London. I thought he was lying. He wasn't. We went almost every week untill my partner told me I need to be more open minded and try new things. It was nice while it lasted... 🥲 The end.

site_logo

Michael Olowo . 2022-09-21

MORE AT Google

Pasta dishes here are great. We had the schnitzel curry pasta and arrabiata with prawns and both were delicious. Also tried the mozzarella bread and that was Super tasty. Expect to spend around £15 per person.

site_logo

T JO . 2022-09-21

MORE AT Google

Dry pasta. I asked for bacon, there was only 4 little pieces.

site_logo

Noemi . 2022-09-19

MORE AT Just Eat

Pasta was cold so was stuck together the mozzarella was dried and inedible. The worst meal I’ve ever had. The soup was horrid. The only nice thing was the garlic bread.

site_logo

Bianca . 2022-09-19

MORE AT Just Eat

Sadly, this was the second time it was late and it was only when we made contact did we find out it was going to be delayed. It’s a shame because the food is good.

site_logo

andie . 2022-09-18

MORE AT Just Eat

I can still remember the first time we came here, just under ten years ago. First of uncountable times! Food is consistently delicious - not only pasta but salad, sandwiches, they never disappoint.

site_logo

olivia . 2022-09-08

MORE AT Google

We love Fasta! It's the only takeaway that the whole family agrees on and eating in is always a joy. Very friendly, good value and delicious flavours. The homemade pesto and houmous are particular favourites in our house.

site_logo

Alice Broomhall . 2022-09-08

MORE AT Google

Fasta is our go to family dinner option and we LOVE it!!! Everything we’ve tried (which is the entire menu by now!) has been so delicious and always has such an authentic beautiful home made taste, we are so grateful to have somewhere like this on our doorstep! Never disappoints, cannot recommend enough for family meals and couples wanting a yummy meal! Also run by a lovely family making it all the more special!

site_logo

Victoria Poon . 2022-09-05

MORE AT Google

I am totally confused how anyone can enjoy the bog standard overpriced food. The future is very predictable establishment. How many times can you get away with ripping people off? When I informed the waitress about the cheese ravioli being served cold, she just shrugged it off, why was the ravioli served cold? because the chef had cooked the ravioli first but forgot to cook the chicken schnitzel so the waitress took the ravioli away from our table so she could add the chicken schnitzel to the ravioli, well 10 minutes had gone by & we are still waiting, in the mean time, our food is getting cold because we are waiting for my sister's ravioli to arrive so we can all eat together, as we did all arrive together, I thought it would be a good idea if we all ate together. They had the cheek to charge me £11.00 service charge. If any of my customers have genuine complaints, I always give them 50% off the food so to make happy & make sure that give us another go, its very hard to keep a customer but very easy to lose. Live & learn, another good lesson in life.

site_logo

Gabriel Gabriel . 2022-09-04

MORE AT Google

Great, tasty menu, I love the carbonara pasta

site_logo

William Reyes . 2022-08-16

MORE AT Google

Great place to feed our grandchildren just what they want to eat. Lovely mushroom hummous too!

site_logo

Amanda Hood . 2022-08-16

MORE AT Google

Their was not cutlery included which was very inconvenient and the cheese was barely melted on the pasta

site_logo

Abdullahi . 2022-08-10

MORE AT Just Eat

Delicious falafel and tasty salads and hummus! Yum.

site_logo

Wendy . 2022-08-08

MORE AT Just Eat

Lovely local restaurant - Fab service and staff and lovely ambience.

site_logo

T C . 2022-07-29

MORE AT Google

Great pasta, very generous Mediterranean plates and very friendly service. It's not surprising it's the most popular place in Muswell hill..

site_logo

Hayal Fefer . 2022-07-26

MORE AT Google

Israeli and Italian hybrid restaurant, wide variety of options to choose from.

site_logo

Louis Smardina . 2022-07-23

MORE AT Google

We love in Muswell Hill and it is one of the places we go constantly. The service is always friendly and the pasta is always fresh. We've tried also the falafels and they were also very good. Oh! And how could I forget to mention their tiramisu 🤤

site_logo

S C A . 2022-07-07

MORE AT Google

Similary restaurants in London

restaurant_img
4.3

3186 Opinions

location-icon185 High Road Wood Green Alexandra Palace, Wood Green, London N22 6BA England
Italian
outdoor_seating_269405takeaway_269405delivery_269405

Food is awesome, but 2 and a half hours to prepare and deliver? Hopefully next time it will be quicker

restaurant_img
4.5

204 Opinions

location-icon509 Seven Sisters Road, London N15 6EP England
Italian
outdoor_seating_250424takeaway_250424delivery_250424

My order was hot vegi but I got just veggie and was cold

restaurant_img
4.5

35 Opinions

location-icon10 Broadway Parade Crouch End, London N8 9DE England
Italian
outdoor_seating_245339takeaway_245339delivery_245339

He estado aquí dos veces y aunque solo fuimos a tomar algo, debo decir que la comida que vimos venir de la cocina se veía y olía increíble. El camarero era muy amable, servicial y, lo más importante, ¡sabía exactamente cómo hacer una vieja moda! Eso es muy importante para mi. Excelente servicio y ambiente. Hacía demasiado frío para tomar bebidas en el jardín, pero puedes apostar que lo disfrutaremos en primavera o verano.

restaurant_img
4.5

11 Opinions

location-icon176 Fortis Green Road Next To The Off Licence, London N10 3DU England
Italian
outdoor_seating_258343takeaway_258343delivery_258343

What a fantastic meal we had - it was empty when we went in at 3pm but there was a nice ambience and the waitress was very welcoming. Well she was not just the waitress she made our food - three delicious pizzas and an artichoke salad and mozzarella bruschetta. The chef was on holiday and she did a fantastic job and the food was fresh and beautifully presented . We will be back - thank you

restaurant_img
4.5

19 Opinions

location-icon470 West Green Road Wood Green, London N15 3PT England
Italian
outdoor_seating_258111takeaway_258111delivery_258111

It was great pizza what else can I say? We ordered 10 boxes, nothing was left over that's good pizza