GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.3

Based on 3.401 opinions finded in 2 websites

site_photo4

Nº 403 in 1129 in Fife

Nº 2 of 49 Chinese in Fife

CUSTOMERS TALK ABOUT DISHES WITH..saladmustprawnchickenpizzaoldchocolatefriedcookedmeatcreampaysweetsricecakeducksushi

comment_iconOpinions

Amazing food with plenty space in it

site_logo

Mariya Petrash . 2025-05-17

MORE AT Google

Immaculately clean. Service was very prompt and food was excellent. Can understand why people travel to dine here

site_logo

Pauline McCabe . 2025-05-15

MORE AT Google

Very clean and well presented (especially the toilets), lots of tasty food, staff were helpful and friendly. All in all an enjoyable and very reasonably priced experience.

site_logo

Andrew Hudson . 2025-05-15

MORE AT Google

Some food was good, some food was over heated to the point of being hard and chewing, staff where nice and friendly.

site_logo

Kayleigh Flinter . 2025-05-14

MORE AT Google

My favourite place when in the area!

site_logo

Jane Doe . 2025-05-13

MORE AT Google

Fabulous place always fresh food and so tasty..

site_logo

Helen O'Neill . 2025-05-10

MORE AT Google

my stomach hurts im shitting myself in the toilets rn but very yummy

site_logo

Elyse Syme . 2025-05-03

MORE AT Google

Fresh in at 5pm food amazing good value for money

site_logo

Chris Burton . 2025-05-01

MORE AT Google

Variety of food all tasty, lovely puddings, friendly staff and value for money, highly recommended!!!

site_logo

Lidia Czastka . 2025-04-26

MORE AT Google

Overall the Beijing Banquet was very nicely laid out, well looked after and signed for the different food area's. The food was your standard Chinese all you can eat banquet with maybe a little extra such as Sirloin steak and a small Italian selection which is odd in a Chinese banquet however not enough to justify the £23.60 per person price. The issue and reason I have given such a low rating is purely down to the fact the food seemed to be overly salted obviously this is a tactic to get you to order more drinks which can then cost extra but also serve to fill the stomach before you do so with food.

site_logo

Mark D . 2025-04-20

MORE AT TripAdvisor

Been a few times. Plenty of options. Place is clean. Staff friendly.

site_logo

mike carr . 2025-04-16

MORE AT Google

Went twice while staying at the Travelodge on our 4 day stay ! Excellent 👍

site_logo

Sandy Morris . 2025-04-15

MORE AT Google

Really nice. I love a good buffet. The service was flawless, lovely place too. The food was nice, it just wasn't the best. There were a few bits of meat I had to put aside but other than that, all good. Loads of choice. Will go back

site_logo

fairy opi . 2025-04-12

MORE AT Google

Brilliant place what a nice lunch out somewhere different.

site_logo

Tara Brach . 2025-04-03

MORE AT Google

Had a booking for 5.45 and didn't get entry until 6.35 because they were letting in walk in bookings which meant there were no seats for customers who booked?! Shambolic and no apologies from the staff. For what it's worth the food is good but even then for ice cream there were no bowls available so all that you could use was small plates.

site_logo

Derek Walsh . 2025-03-30

MORE AT Google

Wonderful food, wonderful staff. Loads to choose from and even pizza and pasta for those who don't fancy the usual. plenty of puddings, a chocolate fountain and bottomless fizzy drinks, ideal night out.

site_logo

kade . 2025-03-21

MORE AT Google

Absolutely loved it. So did my daughter. Worth the money. Food is decent quality. Il certainly be back

site_logo

Daniel Knight . 2025-03-17

MORE AT Google

Went with family and got the buffet, plenty of food for everybody to eat

site_logo

Nicola Watson . 2025-03-14

MORE AT Google

Very tasty good selection of dishes

site_logo

Iain Derrett . 2025-03-02

MORE AT Google

Great fresh food, value for money a bit cold inside but overall a good place to go

site_logo

Lori Catlin . 2025-02-27

MORE AT Google

The food was really nice, and the staff were friendly, which made for a generally pleasant experience. The toilets were clean, which is always a plus. However, the tables were a bit sticky, which wasn’t great. The biggest downside was the price—it was really expensive for two adults and children aged 14, 11, 9, 5, and 4. While the food was good, I’m not sure it was worth the cost.

site_logo

Sean P . 2025-02-22

MORE AT TripAdvisor

Very clean food hot and well presented.

site_logo

Liz White . 2025-02-21

MORE AT Google

Food was tasty as usual, friendly helpful staff. My family and friends really enjoyed themselves.

site_logo

Michelle Armour . 2025-02-17

MORE AT Google

Visited here for valentines day which i loved food is amazing the staff are very quick and efficient there very nice and helpful, reasonably priced for what you can eat, great variety of everything you can possibly eat

site_logo

Patricia Mccusker . 2025-02-17

MORE AT Google

Ideal for a good buffet,desserts usually the same options but something for everyone. Chocolate fountain isn't always on so check first if that's a must for your visit. Fresh salad bar, plenty choice for starters and mains. Don't forget there's a pizza area too.

site_logo

Nicola Hincks . 2025-02-15

MORE AT Google

Fantastic Family Dining Experience! Had an amazing time at Beijing Banquet in Glenrothes with my family! The food was delicious, fresh, and had a great variety to choose from. Every dish was well-prepared, and the buffet selection was impressive. The service was excellent, with friendly and attentive staff ensuring we had everything we needed. The atmosphere was warm and welcoming, making it a perfect place for a family meal. Most importantly, it was great value for money – generous portions, high-quality food, and an overall fantastic experience. We will definitely be back soon!

site_logo

Binod Bhusal . 2025-02-11

MORE AT Google

Fantastic Family Dining Experience! Had an amazing time at Beijing Banquet in Glenrothes with my family! The food was delicious, fresh, and had a great variety to choose from. Every dish was well-prepared, and the buffet selection was impressive. The service was excellent, with friendly and attentive staff ensuring we had everything we needed. The atmosphere was warm and welcoming, making it a perfect place for a family meal. Most importantly, it was great value for money – generous portions, high-quality food, and an overall fantastic experience. We will definitely be back soon!

site_logo

Binod . 2025-02-11

MORE AT TripAdvisor

We went at 12 pm when lunch service had just started. The food we had was cold. The pancakes were stuck together, and this made it impossible to use them. The building was so cold we had to keep our jackets on. The restrooms were absolutely freezing. A bad experience overall. We had a small amount of cold food and left.

site_logo

PBG . 2025-02-02

MORE AT TripAdvisor

I would never go back as my disabled son can not eat fast and my mum has swallowing problems but when we went up for a dessert we got told that we couldn't get any dessert as staff need to be feed and we were supposed to have been told that we only had an hour plus I had to pay full bill

site_logo

Vicky M . 2025-01-30

MORE AT TripAdvisor

I have only visited this establishment twice but my most recent visit in November 2024 was with a friend who has never been before. I emailed the company on 22 November 2024 and chased a response on 25 November 2024 but was met with silence. A table was booked for 6:15pm for a part of 2. When we arrived, the employee on the front desk advised us they needed the table for 7:30pm. In hindsight, we should not have accepted this as we only had 75 minutes to try and enjoy a meal at your restaurant, and unfortunately, we just felt very rushed. This was only accepted as we hadn't eaten and travelled 40 minutes to dine here. The booking for 7:30pm must have arrived early as a gentlemen (could have been anyone to be honest since he was dressed so casually whilst everyone else had a uniform on) suddenly came over to our table at 7:23pm without even a greeting, stating "guys we need this table in a couple of minutes". My friend was still sitting with a glass of juice in her hand and it was not yet 7:30pm. Yes, 7 minutes might appear to be nothing but when you were giving such little time to eat anyway, this was just unacceptable. Regardless of the type of dining, it's not the best impression to customers especially when it's their first visit to your establishment. However, as a buffet / banquet type of dining you should never put a time limit like that on customers. We didn't even have time to order any other drinks, never mind enjoy more food if we wanted. This is basically the email sent to the organisation but no response. Although this was in November, it is still relevant and should be addressed!

site_logo

Mary Davidson . 2025-01-28

MORE AT Google

An excellent place to get good quality Chinese food. The banquet was well stocked with a wide range of foods. Due to the busy atmosphere there was a constant turnover of food. The staff were friendly yet professional in their jobs. Very proficient. The only downside is lack of car park spaces and the annoying way people let their children dip their fingers and 1/2 bitten food into the chocolate fountain.

site_logo

donald gillespie . 2025-01-19

MORE AT Google

Good selection of dishes, freshly made, something for everybody!

site_logo

Chris Tunnah . 2025-01-16

MORE AT Google

Oh my God! This is the best restaurant I’ve ever been to. The food! The prices! The staff Oh boy! I totally loved Beijing I highlllyyyyyyy recommend somebody 😍

site_logo

Doris Sarpong . 2025-01-14

MORE AT Google

Been going to the place for years the food is always good lunch or dinner.

site_logo

Louis Ross . 2025-01-14

MORE AT Google

First and last time. Place was freezing cold , had to keep our coats on , food and plates cold not a good experience

site_logo

Ella Mackenzie . 2025-01-12

MORE AT Google

Good food and fast delivery, everything fresh and tasty

site_logo

Kasia A . 2025-01-11

MORE AT Google

We arrived on a Saturday lunchtime (pre-booked) and immediately taken to a table which they let us change so we could be more private. It wasn't too busy so we 4 could chat comfortably. The choice was just superb.. always topped up, fresh and SO many dishes - not just Asian..but pizza's etc too. Plates were taken away promptly. For me.. it was the Belgian chocolate fountain..only went 3 times 😆 Super..we'll go again..and again! Excellent venue and we stayed over 2 hours Thank you

site_logo

Aaaaaddddaaaammmmm . 2025-01-10

MORE AT TripAdvisor

Very busy for a Sunday but delicious food and great service

site_logo

Zoe Keddie . 2025-01-05

MORE AT Google

Absolutely loved this place food is amazing, staff are super nice.

site_logo

Kirsty Taylor . 2025-01-01

MORE AT Google

Great Buffet standard. Prices are not disclosed on the website, on the tables or notable from any posters. Budget around £30 per head. It’s an expensive meal on a small appetite.

site_logo

Sandy Moffat . 2024-12-29

MORE AT Google

Similar experience as previous reviewer. Went on Christmas day, 5.45pm, first time eating out with family. Seating plan felt it was designed to get as many people in with no consideration for dinner's experience or need to safely navigate to server. Not enough staff on and food was average. Very busy and lots of queueing for food, stressful experience. Christmas food although advertised was not readily available. Staff did their best but you could tell it was a struggle to manage tables, drinks and fill up servery. Personally did not feel our experience matched the price. Only one till and this is poorly placed by kitchen and rice servery. No mobile card readers for paying at table.

site_logo

Jackie C . 2024-12-26

MORE AT TripAdvisor

Had the best Christmas Day meal, the food was delicious and there was so many choices. Your traditional turkey, beef, gammon ham, roast carrots and potatoes as well as their Chinese dishes pizza and pasta etc. the selection of fresh fruit and dessert were great too but didn’t have anymore room.

site_logo

Jones S . 2024-12-26

MORE AT TripAdvisor

I don't know what happened this Christmas but what a complete let down from last year. Massive queues waiting for empty dishes to be refilled, waiting 5 minutes as there was no turkey, chicken, Beef or any kind of potatoes. It stated roast potatoes on the menu but there was none. Our table of 8 was constantly pilled with plates that noone lifted. A complete shambles this year we had booked for 5.45 as that was all they had left and it was so busy, they constantly ran out of food and alot of unhappy customers. For the price you pay to have a hassle free Christmas meal, it wasn't worth the money. So let down

site_logo

KelzMc . 2024-12-25

MORE AT TripAdvisor

What you'd want and expect from a Chinese buffet with a reasonable selection of more "Western" food for the pickier eaters.

site_logo

Ryan Foster . 2024-12-23

MORE AT Google

Beijing Banquet in Glenrothes is hands-down one of the best buffet experiences I've ever had! From the moment you walk in, you're greeted with a warm and inviting atmosphere, and the incredible variety of food immediately catches your eye. The selection is truly impressive, featuring a perfect balance of traditional Chinese dishes and international favorites, ensuring there's something for everyone. The quality of the food is outstanding – everything is fresh, flavorful, and beautifully presented. Particular highlights include their perfectly cooked dim sum, crispy duck pancakes, and an array of desserts that are simply irresistible. The service is impeccable, with staff who are attentive, friendly, and quick to clear plates or assist with any requests. The cleanliness and organization of the restaurant are also top-notch, adding to the overall experience. Whether you're visiting with family, friends, or for a special occasion, Beijing Banquet is a fantastic choice. It's a dining experience that leaves you full, happy, and eager to return. I can’t recommend it highly enough – it’s a must-visit if you’re in Glenrothes!

site_logo

Robert Riley . 2024-12-23

MORE AT Google

Friendly staff and lots of food to eat.

site_logo

Scott Thoms . 2024-12-15

MORE AT Google

Great food, lovely place, reasonably priced

site_logo

mark gibb . 2024-12-08

MORE AT Google

Went to this place as, my friend and I fancied a change. We were really looking forward to dining here !!! But sadly, our expectations were not met 😞. Nain reason is that the majority of the food was cold. This wasn't helped with the plates being cold to 😞. Most of the staff looked like they were aimlessly walking around not doing much. Made us feel uncomfortable as they were watching us eat 🤔 I would definitely try out other establishments before returning to Beijing Banquet in the future. On a positive note ,the desserts were.nice !

site_logo

Sarah Richardson . 2024-12-06

MORE AT Google

The very best buffet experience in FIFE. Easy access from the ample parking area. Lots of tables. Amazing variety of food and drinks. You will not be disappointed.

site_logo

Thomas Henderson . 2024-12-03

MORE AT Google

It was a great experience, so many options to choose from...

site_logo

Latifah Adeyemi . 2024-11-21

MORE AT Google

Great buffet. Lovely food, and nice staff. Can be busy on the weekends so watch out.

site_logo

Lia Drummond . 2024-11-20

MORE AT Google

Visited to give 12 and 13 year old experience of eat all you can buffet. Group was 5 adults at £22.99 each total £114.95. What amazed me was the £20.55 for two small bottles of beer. Would reckon 330 ml in each.Didn't see an alcohol price list ready to hand, so ask the price of any alcohol before ordering or you may need another to get over the shock of the price. And, take a receipt to check exactly what you are charge. Won't be back.

site_logo

Mary G . 2024-11-20

MORE AT TripAdvisor

An amazing buffet for the whole family. Definitely making this a regular occurrence for me. Absolutely delicious!!!!

site_logo

Blake M . 2024-11-13

MORE AT TripAdvisor

My family and I had a great lunch here on Saturday. The staff were friendly and helpful and the food tasty. A lovely choice of numerous dishes. We particularly recommend the honey sesame chicken, chicken spring rolls, spring onion dumplings, stir fried prawns, sushi, stir fried mushrooms and stir fried cabbage.

site_logo

Francesca Mccarthy . 2024-10-28

MORE AT Google

Lovely food DONT GO BY WEB PAGE FOR PRICES AS THEY ARE WRONG NOT 18.99 ITS £21 we got hit will bill £42 double checked web when got home they haven't up dated there price list

site_logo

evelyn melville . 2024-10-28

MORE AT Google

It's like going to America! I could not believe this was in the uk!

site_logo

Tom Buchanan . 2024-10-25

MORE AT Google

Spectacular buffet has nothing to do with the typical Chinese buffets that we have in Spain. This one had many options of dishes.

site_logo

Y. G. . 2024-10-21

MORE AT Google

Food was good and portions were ample

site_logo

Drew Mclean . 2024-10-21

MORE AT Google

Food was OK but is so bloody freezing,lovely stuff, wouldn't go back as I hate seating and eating my food when is so cold

site_logo

Megan Smith . 2024-10-12

MORE AT Google

If you go to an all you can eat then expect a belly filler not fine dining. Food was as expected, and a good selection. Would go back again

site_logo

cappuchino9 . 2024-10-08

MORE AT TripAdvisor

I used to frequent this place regularly but cut down as the price raised and the food became less appetising. It’s now too expensive to be considered value for money, unless you are there too pig-out and create yourself health issues. The food is far too sweet -and thats pretty much every dish!- and too salty/MSG loaded. Both my work colleagues and myself agreed that we wouldn’t be back, several times. We definitely won’t now, unless the quality changes considerably. I can buy a full Chinese takeaway for one at almost a third of the price so it’s now a no-brainier.

site_logo

Stephen M . 2024-10-02

MORE AT TripAdvisor

Excellent choice of dishes, you'll not leave here hungry! A no-frills eatery. Can be busy at times, but probably best to go at busier times when the food is refreshed more regularly. Went as a couple & we enjoyed trying a smorgasbord of little portions of different food. Chicken dishes, Rice dishes & pork dishes were our favourites. Fish was a bit overdone & the duck was a bit dry/ tough. Desserts were limited & the banana fritters were cold & inedible. Didn't try the pizza but it looked very good & done in a proper pizza oven on display. This is the sort of place where you'll always find something that you will enjoy eating. Don't expect piping hot food (it's all luke-warm to help keep it from spoiling too quickly & you have to eat fast before it goes cold on the plate). For the overall quality I think it's a bit too expensive for what it is & unless you have a REALLY big appetite to get your moneys-worth, a good Chinese takeaway meal is a better, cheaper, alternative.

site_logo

Nigel Wirdnam . 2024-10-01

MORE AT Google

Lovely meal tonight, Staff was very attentive, many options. But meal was put off by a birthday table with some ladies that had one too many wine. Just hope they weren’t driving home.

site_logo

Andy Birch . 2024-09-28

MORE AT Google

We were there tonight for a friends birthday we had two glasses of wine i think they were £7.50 each and at 9.15pm the manager came over and asked us to leave as he was locking up “right ladies im locking up you need to go” my friend who’s birthday it was didnt have time to finish her £7.50 glass of wine but were happy to let us pay for it 20 mins before? An absolute disgrace !!!! Practically mopping round our table and putting light off etc!! So very RUDE!!

site_logo

Jackie Pritchard . 2024-09-27

MORE AT Google

It was freezing, probably warmer outside. Seemed like the air conditioning was on full. Asked waitress if we could move to a different table, she said she would ask her manager, but it was probably the same on other tables - but she never came back. The food on my plate was cold before I was half finished. Spoke to Supervisor on duty who told me it was the vents - no apology. I said I was extremely disappointed and would not be back and would tell friends and family. His response - why are you telling me that, it's up to you what you do. I said it was a complaint giving feedback from my experience. So, he didn't give a damn. I felt that they just don't care about negative feedback, enough people go there anyway. So why should they bother or even apologise and give hope for a resolution for the future £17 each and £3.90 for a Pepsi Food was OK, nothing special

site_logo

Bill B . 2024-09-26

MORE AT TripAdvisor

Food hasn't changed in 20 years, place looks alot nicer, still doesn't cater with quality food fir vegetarians

site_logo

celia ffrench . 2024-09-22

MORE AT Google

Well that was truly terrible! We've been many times and enjoyed the buffet, not this time! The spare ribs had been sitting so long they were solid, onion rings not edible, the list goes on for the starters. Main courses had sat so long most of the sauces had congealed or were reduced down thick and gloopy. The worst thing however was the salty taste, I couldn't eat anything. The pint of lager was the only enjoyable thing from the meal. Only fresh thing too. We went at 2pm on a Friday. It's usually busy but stone dead today. No wonder. Don't know if the good Chefs have all went to Falkirk.

site_logo

Steven Macfarlane . 2024-09-20

MORE AT Google

Really nice food and great variety. It gets quite busy but it is well organised. It is a wee bit dear, but good for a treat.

site_logo

Clara Fernandez-Luque . 2024-09-19

MORE AT Google

Chicken balls far too tough to get knife through. No sure if just over cooked or left lying too long. Not worth the money.

site_logo

Shirley Grant . 2024-09-16

MORE AT Google

It's buffet they are all the same. Curry was tasteless disappointing

site_logo

Karen Craigens . 2024-09-14

MORE AT Google

Reason for 4 star and not 5 ,we had our granddaughter with us she's 12 and we had to pay full price of £23 for her to have some chips and chicken and 1 small bowl of ice cream ,there's no way a young child is going to eat 23 quid worth of food so there should be a better paying system for younger kids.

site_logo

Andrew Couper . 2024-09-14

MORE AT Google

Good choice & food for all tastes. Some items could have been a little hotter & perhaps topped up with less but more frequently to ensure temperature was more enjoyable.

site_logo

Carol Walker . 2024-09-13

MORE AT Google

Great selection of food,very hot,deserts great choice,staff very friendly, helpful

site_logo

Kirsty Munnoch . 2024-09-10

MORE AT Google

Well what can I really say at £22 a head the food was disappointing at best, not being a fan of Chinese I felt fine that they did pasta steak and pizza till I tried to get pasta, each trip it was empty then finally they put the Mac n cheese out I can honestly say the Lidl or Aldi one is 100x better. Those who like Chinese food which was everyone else found undercooked chicken over poked chicken rock hard chips flat juice the list goes on the steak is only good for resoling shoes. Honestly don't waste the money. I spent £22 and ate nothing

site_logo

arthur s . 2024-09-07

MORE AT TripAdvisor

Good food and plenty to choose from in the buffet.

site_logo

Kristoffer Heia . 2024-09-04

MORE AT Google

Visited numerous times and always great quality food with the exception of desserts, better selection and quality needed

site_logo

Paul Easton . 2024-08-30

MORE AT Google

I like the food here. Most of it is really good. My complaint is the state of their highchairs. They are disgusting and not cleaned properly. They aren't even cleaned to a half decent standard. I went to try and exchange the highchair for a different one, and they were all looking the same. It was disgusting. I ended up not using one. Adults wouldn't be expected to sit at a dirty table, so why are they expecting young children to sit in dirty highchairs.

site_logo

Mercy M . 2024-08-28

MORE AT Google

Great choice of food and a good price

site_logo

Allison Hewitt . 2024-08-27

MORE AT Google

Excellent choice of many different dishes. It's great being able to pick and choose from such a wide choice.

site_logo

James Dingwall . 2024-08-25

MORE AT Google

I have been here a few times over the years. It used to be about £13 to fill your face. I got quite a shock when the bill for 4 adults and 4 drinks came to £110. However the food was excellent and a good variety to choose from. The service and cleanliness great. I will be back.

site_logo

Donald L . 2024-08-25

MORE AT TripAdvisor

Absolutely beautiful food, we go every time we're in Scotland

site_logo

Lauren Day . 2024-08-18

MORE AT Google

Selection is good and place is always busy. But it’s expensive for what it is. Drinks are not included in the price. I reckon you’d need to eat at least 3 plates to make even on the cost vs a Chinese takeout.

site_logo

Daniel Maclean (Daniel) . 2024-08-18

MORE AT Google

I used to frequent this restaurant regularly. It has been a couple of years since last visit however I can say in all certainty I shall never visit again. The staff are rude and disrespectful. They brought us the wrong order when I told the server that it was wrong she asked what have you changed your mind? No it is not what I ordered so you have changed your mind? No that is not what we asked for. So you want to change your mind. I then asked for manager as the server was not listening and inferring I had miss ordered. Now to the food. It used to be top quality now it is bland dried out and not very enjoyable at all. It is such a shame as my wife and I used to love coming here. I guess either new owners or they have lost all interest in customer service and quality

site_logo

gary wilson . 2024-08-17

MORE AT Google

Visited for the first time. The first thing we’re told is that the bill would not be split, it was clear we were business customers who would need to do this. Service was not with a smile. I saw two tables receive birthday cakes with the happy birthday music, the waitress literally walked up to the table and threw the cake down. It didn’t seem very festive. The buffet is ok. Lots and lots of deep fried food and lots in sweet sauces, all very similar in taste. I did enjoy the chicken satay and the salt and pepper prawns. Unfortunately there was little choice in the main dish options. Lots of chicken dishes including sweet and sour, lemon chicken that had no sauce (maybe this is the Scottish was but not how it is down south), Chinese chicken curry, crispy chicken, chicken satay. The beef in black bean was watery. The roast duck was dry but the pork was ok. I would have liked to see more variety like lamb with spring onion and ginger, crispy beef, schezwan dishes, salt pepper squid, yellow bean and tofu dishes. But that is my taste, other dinners seemed to like the selection. There were desserts but I saw kids touching them and gave it a miss. The restaurant was big and very busy and obviously a popular spot. Price wise it was pretty cheap compared to the south of England and we paid £20.99 each. For that price the limited choice is acceptable but I would not go back. I feel like I’ve done this and that’s enough for me.

site_logo

SnowWhite78 . 2024-08-14

MORE AT TripAdvisor

The food is lovely and aways topped up all the time.

site_logo

Danina Barnes . 2024-08-12

MORE AT Google

Food is always good here but on my last recent visit they have put up their prices! A bill for 2 adults and 2 drinks just over £50!! Won't be going here as regular due to their significant price increase.

site_logo

John S . 2024-08-12

MORE AT TripAdvisor

Came here 10/8/24 with my family. The food layout is amazing and it makes it clear where each food is.. ive been to Renfrew and Falkirk and they exceed my expectations.. this one did not. The chicken was feeling bipolar that day, some was undercooked and some was overcooked. My nephew had chicken nuggets and chips but the chicken nuggets were as hard as rocks. How can his gnashers get through that. The drinks dispenser has not been changed in a while as they were extremely flat. At this point i shouldve just went to the McDonald’s across the road and got drinks. I tried salt and pepper chips and they tasted like absolute dogmeat. I thought i was eating cardboard. My mum likes oysters and has them often at the other beijings but was utterly disappointed as they looked like theyve been lying for a few weeks. Again, they were even undercooked. If u gave them CPR theyd come back to live im afraid. The rice didnt taste fresh either and I saw flies around the pizzas. The ribs had hardly any meat on the bone, ive seen more meat on a butchers pencil. At the desserts section, the cakes were missing and there was just crumbs as if the children had just had a cake fight. The bowls still had a residue from whoever ate from them previously. Ill attach some pictures. It was £26 per person including refills.

site_logo

Barry White . 2024-08-11

MORE AT Google

Came here 10/8/24 with my family. The food layout is amazing and it makes it clear where each food is.. ive been to Renfrew and Falkirk and they exceed my expectations.. this one did not. The chicken was feeling bipolar that day, some was undercooked and some was overcooked. My nephew had chicken nuggets and chips but the chicken nuggets were as hard as rocks. How can his gnashers get through that. The drinks dispenser has not been changed in a while as they were extremely flat. At this point i shouldve just went to the McDonald’s across the road and got drinks. I tried salt and pepper chips and they tasted like absolute dogmeat. I thought i was eating cardboard. My mum likes oysters and has them often at the other beijings but was utterly disappointed as they looked like theyve been lying for a few weeks. Again, they were even undercooked. If u gave them CPR theyd come back to live im afraid. The rice didnt taste fresh either and I saw flies around the pizzas. The ribs had hardly any meat on the bone, ive seen more meat on a butchers pencil. At the desserts section, the cakes were missing and there was just crumbs as if the children had just had a cake fight. The bowls still had a residue from whoever ate from them previously. Ill attach some pictures. It was £26 per person including refills.

site_logo

Barry White . 2024-08-11

MORE AT Google

They did not replenish the items during the buffet.. was disappointing as most of the nice dishes were empty with no refill.

site_logo

Doc HD . 2024-08-11

MORE AT Google

Nice and good! Nice staff... Too much fried food, but good

site_logo

Ewry Guinda . 2024-07-31

MORE AT Google

Very disappointed and felt like I was back for school dinners 😣 the food even though the selection was varied the issue was that every dish we tried was literally just a little warm 🤢 the duck was over cooked the sweat and sour was like chewing rubber 🤢and as for the ice cream I don’t think you could be offered a cheaper alternative as it was rank rotten and full of ice particles 🤢very disappointing given the cost and as for the drink refills for a fixed cost please get some staff to clean down the machine as it was manky but the rest of the place was relatively clean 🤢not my best dining experience

site_logo

DAVID MCKAY . 2024-07-22

MORE AT Google

Really enjoyed the food and staff are amazing

site_logo

Marianna Travers . 2024-07-18

MORE AT Google

Was enjoying a family meal. Website states it closes at 9.30. 9pm we were asked if we were finished as they were removing food now. 10 mins later we were handed our bill while still eating! Rushed to finish and leave. Consider the price we paid as a large family we certainly won't be back! Ruined the end of our evening!

site_logo

Nadine Cassidy . 2024-07-17

MORE AT Google

My friend was on his 5th plate! It’s so yummy.

site_logo

Hayden . 2024-07-13

MORE AT Google

Had a lovely day with friends and shall be returning soon

site_logo

Annemarie Mcpherson . 2024-07-10

MORE AT Google

£20 per one person, the price is worth its quality, not very delicious but if you would love to enjoy some western based Asian food. Not authentic at all, but it's ok if I want some hot food and all you can eat

site_logo

Kim Hay Ng (Hayden) . 2024-07-09

MORE AT Google

Stopped by for lunch today and was ready to pig out but was disappointed with the quality of food. Plenty of chicken dishes to choose from but most of them are no good. Very limited selection of other meats and what they do have are terrible, beef like rubber and duck dry and chewy. Also the deserts are like something out of farmfoods but I wasn’t expecting anything special to be honest. Definitely won’t be back.

site_logo

David Fyfe . 2024-07-06

MORE AT Google

Good selection, very busy so at times you were up and down up and down to see if certain dishes had been filled back up, fee things were cold which is a put off for me. No lemon sauce for the lemon chicken either. 5/08/24. Not so good today, lots of food not hot enough

site_logo

Peter Hynd . 2024-07-05

MORE AT Google

Great place with great food! Kitchen looked very clean and the staff were friendly and helpful. Only thing is the price though, it’s a tad expensive but you do get a lot for what you pay for so i’d say it’s worth it. Come here plenty of times and i have to say the food is consistently good tasting and fresh. Place is quite big aswell so perfect for large groups/parties/families etc. Came here for a works night out and it was amazing! Would definitely recommend to everyone!

site_logo

Derek Thompson . 2024-07-04

MORE AT Google

We had a lovely lunch here. We have visited the Edinburgh and the Renfrew restaurants and enjoyed our meals and this one in Glenrothes didn't disappoint. Plenty of parking including some disabled parking. Level access to the restaurant. There are two entrance doors to negotiate but a staff member came and assisted us to get in and again when we left with the wheelchair. A huge selection of food in a buffet style area which we like as we can have a bit of everything. The staff were friendly and attentive. The washrooms clean and modern although the accessible toilet was a bit small and we had difficulty getting the paper towels out of the dispenser with wet hands. Prices very good especially if a weekday lunch time is chosen

site_logo

Iain Macpherson . 2024-07-02

MORE AT Google

Similary restaurants in Central Scotland

restaurant_img
4.3

391 Opinions

location-icon170 Queensferry Road, Rosyth, Dunfermline KY11 2JF Scotland
Chinese
outdoor_seating_249394takeaway_249394delivery_249394

We were very impressed with our meal. We had vegetable samosas and a vegetable chutney curry and it was beautiful - with a range of vegetables. The meal was great.

restaurant_img
4.2

164 Opinions

location-icon12 Aberlour Street
Chinese
outdoor_seating_108513takeaway_108513delivery_108513

Absolute disgusted with the munchie box we were giving everything was lasteless and burnt definitely won’t be back again

restaurant_img
4.1

287 Opinions

location-iconCentral Way
Chinese
outdoor_seating_123486takeaway_123486delivery_123486

Excellent Chinese food with a large menu. Friendly staff in a welcoming venue.

restaurant_img
4.1

170 Opinions

location-icon1 John Street
Chinese
outdoor_seating_196637takeaway_196637delivery_196637

Tried Fortune House Chinese takeaway in Anstruther – portions were generous and everything was hot and freshly made. Quick service and friendly staff too. Great spot if you’re craving a comforting Chinese meal by the coast.

restaurant_img
4.0

191 Opinions

location-icon254 St Clair St
Chinese
outdoor_seating_111306takeaway_111306delivery_111306

Kirkcaldy's long standing great Chinese takeaway.