GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.3

Based on 3.327 opinions finded in 2 websites

site_photo4

Nº 452 in 1129 in Fife

Nº 3 of 49 Chinese in Fife

CUSTOMERS TALK ABOUT DISHES WITH..prawnsushiduckoldmustmeatpizzachickenchocolatecookedcakecreampaysaladricefriedsweets

comment_iconOpinions

Friendly staff and lots of food to eat.

site_logo

Scott Thoms . 2024-12-15

MORE AT Google

Great food, lovely place, reasonably priced

site_logo

mark gibb . 2024-12-08

MORE AT Google

Went to this place as, my friend and I fancied a change. We were really looking forward to dining here !!! But sadly, our expectations were not met 😞. Nain reason is that the majority of the food was cold. This wasn't helped with the plates being cold to 😞. Most of the staff looked like they were aimlessly walking around not doing much. Made us feel uncomfortable as they were watching us eat 🤔 I would definitely try out other establishments before returning to Beijing Banquet in the future. On a positive note ,the desserts were.nice !

site_logo

Sarah Richardson . 2024-12-06

MORE AT Google

The very best buffet experience in FIFE. Easy access from the ample parking area. Lots of tables. Amazing variety of food and drinks. You will not be disappointed.

site_logo

Thomas Henderson . 2024-12-03

MORE AT Google

It was a great experience, so many options to choose from...

site_logo

Latifah Adeyemi . 2024-11-21

MORE AT Google

Great buffet. Lovely food, and nice staff. Can be busy on the weekends so watch out.

site_logo

Lia Drummond . 2024-11-20

MORE AT Google

Lovely food DONT GO BY WEB PAGE FOR PRICES AS THEY ARE WRONG NOT 18.99 ITS £21 we got hit will bill £42 double checked web when got home they haven't up dated there price list

site_logo

evelyn melville . 2024-10-28

MORE AT Google

My family and I had a great lunch here on Saturday. The staff were friendly and helpful and the food tasty. A lovely choice of numerous dishes. We particularly recommend the honey sesame chicken, chicken spring rolls, spring onion dumplings, stir fried prawns, sushi, stir fried mushrooms and stir fried cabbage.

site_logo

Francesca Mccarthy . 2024-10-28

MORE AT Google

It's like going to America! I could not believe this was in the uk!

site_logo

Tom Buchanan . 2024-10-25

MORE AT Google

Food was good and portions were ample

site_logo

Drew Mclean . 2024-10-21

MORE AT Google

Spectacular buffet has nothing to do with the typical Chinese buffets that we have in Spain. This one had many options of dishes.

site_logo

Y. G. . 2024-10-21

MORE AT Google

Food was OK but is so bloody freezing,lovely stuff, wouldn't go back as I hate seating and eating my food when is so cold

site_logo

Megan Smith . 2024-10-12

MORE AT Google

If you go to an all you can eat then expect a belly filler not fine dining. Food was as expected, and a good selection. Would go back again

site_logo

cappuchino9 . 2024-10-08

MORE AT TripAdvisor

I used to frequent this place regularly but cut down as the price raised and the food became less appetising. It’s now too expensive to be considered value for money, unless you are there too pig-out and create yourself health issues. The food is far too sweet -and thats pretty much every dish!- and too salty/MSG loaded. Both my work colleagues and myself agreed that we wouldn’t be back, several times. We definitely won’t now, unless the quality changes considerably. I can buy a full Chinese takeaway for one at almost a third of the price so it’s now a no-brainier.

site_logo

Stephen M . 2024-10-02

MORE AT TripAdvisor

Excellent choice of dishes, you'll not leave here hungry! A no-frills eatery. Can be busy at times, but probably best to go at busier times when the food is refreshed more regularly. Went as a couple & we enjoyed trying a smorgasbord of little portions of different food. Chicken dishes, Rice dishes & pork dishes were our favourites. Fish was a bit overdone & the duck was a bit dry/ tough. Desserts were limited & the banana fritters were cold & inedible. Didn't try the pizza but it looked very good & done in a proper pizza oven on display. This is the sort of place where you'll always find something that you will enjoy eating. Don't expect piping hot food (it's all luke-warm to help keep it from spoiling too quickly & you have to eat fast before it goes cold on the plate). For the overall quality I think it's a bit too expensive for what it is & unless you have a REALLY big appetite to get your moneys-worth, a good Chinese takeaway meal is a better, cheaper, alternative.

site_logo

Nigel Wirdnam . 2024-10-01

MORE AT Google

Lovely meal tonight, Staff was very attentive, many options. But meal was put off by a birthday table with some ladies that had one too many wine. Just hope they weren’t driving home.

site_logo

Andy Birch . 2024-09-28

MORE AT Google

We were there tonight for a friends birthday we had two glasses of wine i think they were £7.50 each and at 9.15pm the manager came over and asked us to leave as he was locking up “right ladies im locking up you need to go” my friend who’s birthday it was didnt have time to finish her £7.50 glass of wine but were happy to let us pay for it 20 mins before? An absolute disgrace !!!! Practically mopping round our table and putting light off etc!! So very RUDE!!

site_logo

Jackie Pritchard . 2024-09-27

MORE AT Google

It was freezing, probably warmer outside. Seemed like the air conditioning was on full. Asked waitress if we could move to a different table, she said she would ask her manager, but it was probably the same on other tables - but she never came back. The food on my plate was cold before I was half finished. Spoke to Supervisor on duty who told me it was the vents - no apology. I said I was extremely disappointed and would not be back and would tell friends and family. His response - why are you telling me that, it's up to you what you do. I said it was a complaint giving feedback from my experience. So, he didn't give a damn. I felt that they just don't care about negative feedback, enough people go there anyway. So why should they bother or even apologise and give hope for a resolution for the future £17 each and £3.90 for a Pepsi Food was OK, nothing special

site_logo

Bill B . 2024-09-26

MORE AT TripAdvisor

Food hasn't changed in 20 years, place looks alot nicer, still doesn't cater with quality food fir vegetarians

site_logo

celia ffrench . 2024-09-22

MORE AT Google

Well that was truly terrible! We've been many times and enjoyed the buffet, not this time! The spare ribs had been sitting so long they were solid, onion rings not edible, the list goes on for the starters. Main courses had sat so long most of the sauces had congealed or were reduced down thick and gloopy. The worst thing however was the salty taste, I couldn't eat anything. The pint of lager was the only enjoyable thing from the meal. Only fresh thing too. We went at 2pm on a Friday. It's usually busy but stone dead today. No wonder. Don't know if the good Chefs have all went to Falkirk.

site_logo

Steven Macfarlane . 2024-09-20

MORE AT Google

Really nice food and great variety. It gets quite busy but it is well organised. It is a wee bit dear, but good for a treat.

site_logo

Clara Fernandez-Luque . 2024-09-19

MORE AT Google

Chicken balls far too tough to get knife through. No sure if just over cooked or left lying too long. Not worth the money.

site_logo

Shirley Grant . 2024-09-16

MORE AT Google

Reason for 4 star and not 5 ,we had our granddaughter with us she's 12 and we had to pay full price of £23 for her to have some chips and chicken and 1 small bowl of ice cream ,there's no way a young child is going to eat 23 quid worth of food so there should be a better paying system for younger kids.

site_logo

Andrew Couper . 2024-09-14

MORE AT Google

It's buffet they are all the same. Curry was tasteless disappointing

site_logo

Karen Craigens . 2024-09-14

MORE AT Google

Good choice & food for all tastes. Some items could have been a little hotter & perhaps topped up with less but more frequently to ensure temperature was more enjoyable.

site_logo

Carol Walker . 2024-09-13

MORE AT Google

Great selection of food,very hot,deserts great choice,staff very friendly, helpful

site_logo

Kirsty Munnoch . 2024-09-10

MORE AT Google

Well what can I really say at £22 a head the food was disappointing at best, not being a fan of Chinese I felt fine that they did pasta steak and pizza till I tried to get pasta, each trip it was empty then finally they put the Mac n cheese out I can honestly say the Lidl or Aldi one is 100x better. Those who like Chinese food which was everyone else found undercooked chicken over poked chicken rock hard chips flat juice the list goes on the steak is only good for resoling shoes. Honestly don't waste the money. I spent £22 and ate nothing

site_logo

arthur s . 2024-09-07

MORE AT TripAdvisor

Good food and plenty to choose from in the buffet.

site_logo

Kristoffer Heia . 2024-09-04

MORE AT Google

Visited numerous times and always great quality food with the exception of desserts, better selection and quality needed

site_logo

Paul Easton . 2024-08-30

MORE AT Google

I like the food here. Most of it is really good. My complaint is the state of their highchairs. They are disgusting and not cleaned properly. They aren't even cleaned to a half decent standard. I went to try and exchange the highchair for a different one, and they were all looking the same. It was disgusting. I ended up not using one. Adults wouldn't be expected to sit at a dirty table, so why are they expecting young children to sit in dirty highchairs.

site_logo

Mercy M . 2024-08-28

MORE AT Google

Great choice of food and a good price

site_logo

Allison Hewitt . 2024-08-27

MORE AT Google

I have been here a few times over the years. It used to be about £13 to fill your face. I got quite a shock when the bill for 4 adults and 4 drinks came to £110. However the food was excellent and a good variety to choose from. The service and cleanliness great. I will be back.

site_logo

Donald L . 2024-08-25

MORE AT TripAdvisor

Excellent choice of many different dishes. It's great being able to pick and choose from such a wide choice.

site_logo

James Dingwall . 2024-08-25

MORE AT Google

Absolutely beautiful food, we go every time we're in Scotland

site_logo

Lauren Day . 2024-08-18

MORE AT Google

Selection is good and place is always busy. But it’s expensive for what it is. Drinks are not included in the price. I reckon you’d need to eat at least 3 plates to make even on the cost vs a Chinese takeout.

site_logo

Daniel Maclean (Daniel) . 2024-08-18

MORE AT Google

I used to frequent this restaurant regularly. It has been a couple of years since last visit however I can say in all certainty I shall never visit again. The staff are rude and disrespectful. They brought us the wrong order when I told the server that it was wrong she asked what have you changed your mind? No it is not what I ordered so you have changed your mind? No that is not what we asked for. So you want to change your mind. I then asked for manager as the server was not listening and inferring I had miss ordered. Now to the food. It used to be top quality now it is bland dried out and not very enjoyable at all. It is such a shame as my wife and I used to love coming here. I guess either new owners or they have lost all interest in customer service and quality

site_logo

gary wilson . 2024-08-17

MORE AT Google

Visited for the first time. The first thing we’re told is that the bill would not be split, it was clear we were business customers who would need to do this. Service was not with a smile. I saw two tables receive birthday cakes with the happy birthday music, the waitress literally walked up to the table and threw the cake down. It didn’t seem very festive. The buffet is ok. Lots and lots of deep fried food and lots in sweet sauces, all very similar in taste. I did enjoy the chicken satay and the salt and pepper prawns. Unfortunately there was little choice in the main dish options. Lots of chicken dishes including sweet and sour, lemon chicken that had no sauce (maybe this is the Scottish was but not how it is down south), Chinese chicken curry, crispy chicken, chicken satay. The beef in black bean was watery. The roast duck was dry but the pork was ok. I would have liked to see more variety like lamb with spring onion and ginger, crispy beef, schezwan dishes, salt pepper squid, yellow bean and tofu dishes. But that is my taste, other dinners seemed to like the selection. There were desserts but I saw kids touching them and gave it a miss. The restaurant was big and very busy and obviously a popular spot. Price wise it was pretty cheap compared to the south of England and we paid £20.99 each. For that price the limited choice is acceptable but I would not go back. I feel like I’ve done this and that’s enough for me.

site_logo

SnowWhite78 . 2024-08-14

MORE AT TripAdvisor

Food is always good here but on my last recent visit they have put up their prices! A bill for 2 adults and 2 drinks just over £50!! Won't be going here as regular due to their significant price increase.

site_logo

John S . 2024-08-12

MORE AT TripAdvisor

The food is lovely and aways topped up all the time.

site_logo

Danina Barnes . 2024-08-12

MORE AT Google

They did not replenish the items during the buffet.. was disappointing as most of the nice dishes were empty with no refill.

site_logo

Doc HD . 2024-08-11

MORE AT Google

Came here 10/8/24 with my family. The food layout is amazing and it makes it clear where each food is.. ive been to Renfrew and Falkirk and they exceed my expectations.. this one did not. The chicken was feeling bipolar that day, some was undercooked and some was overcooked. My nephew had chicken nuggets and chips but the chicken nuggets were as hard as rocks. How can his gnashers get through that. The drinks dispenser has not been changed in a while as they were extremely flat. At this point i shouldve just went to the McDonald’s across the road and got drinks. I tried salt and pepper chips and they tasted like absolute dogmeat. I thought i was eating cardboard. My mum likes oysters and has them often at the other beijings but was utterly disappointed as they looked like theyve been lying for a few weeks. Again, they were even undercooked. If u gave them CPR theyd come back to live im afraid. The rice didnt taste fresh either and I saw flies around the pizzas. The ribs had hardly any meat on the bone, ive seen more meat on a butchers pencil. At the desserts section, the cakes were missing and there was just crumbs as if the children had just had a cake fight. The bowls still had a residue from whoever ate from them previously. Ill attach some pictures. It was £26 per person including refills.

site_logo

Barry White . 2024-08-11

MORE AT Google

Came here 10/8/24 with my family. The food layout is amazing and it makes it clear where each food is.. ive been to Renfrew and Falkirk and they exceed my expectations.. this one did not. The chicken was feeling bipolar that day, some was undercooked and some was overcooked. My nephew had chicken nuggets and chips but the chicken nuggets were as hard as rocks. How can his gnashers get through that. The drinks dispenser has not been changed in a while as they were extremely flat. At this point i shouldve just went to the McDonald’s across the road and got drinks. I tried salt and pepper chips and they tasted like absolute dogmeat. I thought i was eating cardboard. My mum likes oysters and has them often at the other beijings but was utterly disappointed as they looked like theyve been lying for a few weeks. Again, they were even undercooked. If u gave them CPR theyd come back to live im afraid. The rice didnt taste fresh either and I saw flies around the pizzas. The ribs had hardly any meat on the bone, ive seen more meat on a butchers pencil. At the desserts section, the cakes were missing and there was just crumbs as if the children had just had a cake fight. The bowls still had a residue from whoever ate from them previously. Ill attach some pictures. It was £26 per person including refills.

site_logo

Barry White . 2024-08-11

MORE AT Google

Nice and good! Nice staff... Too much fried food, but good

site_logo

Ewry Guinda . 2024-07-31

MORE AT Google

Very disappointed and felt like I was back for school dinners 😣 the food even though the selection was varied the issue was that every dish we tried was literally just a little warm 🤢 the duck was over cooked the sweat and sour was like chewing rubber 🤢and as for the ice cream I don’t think you could be offered a cheaper alternative as it was rank rotten and full of ice particles 🤢very disappointing given the cost and as for the drink refills for a fixed cost please get some staff to clean down the machine as it was manky but the rest of the place was relatively clean 🤢not my best dining experience

site_logo

DAVID MCKAY . 2024-07-22

MORE AT Google

Really enjoyed the food and staff are amazing

site_logo

Marianna Travers . 2024-07-18

MORE AT Google

Was enjoying a family meal. Website states it closes at 9.30. 9pm we were asked if we were finished as they were removing food now. 10 mins later we were handed our bill while still eating! Rushed to finish and leave. Consider the price we paid as a large family we certainly won't be back! Ruined the end of our evening!

site_logo

Nadine Cassidy . 2024-07-17

MORE AT Google

My friend was on his 5th plate! It’s so yummy.

site_logo

Hayden . 2024-07-13

MORE AT Google

Had a lovely day with friends and shall be returning soon

site_logo

Annemarie Mcpherson . 2024-07-10

MORE AT Google

£20 per one person, the price is worth its quality, not very delicious but if you would love to enjoy some western based Asian food. Not authentic at all, but it's ok if I want some hot food and all you can eat

site_logo

Kim Hay Ng (Hayden) . 2024-07-09

MORE AT Google

Stopped by for lunch today and was ready to pig out but was disappointed with the quality of food. Plenty of chicken dishes to choose from but most of them are no good. Very limited selection of other meats and what they do have are terrible, beef like rubber and duck dry and chewy. Also the deserts are like something out of farmfoods but I wasn’t expecting anything special to be honest. Definitely won’t be back.

site_logo

David Fyfe . 2024-07-06

MORE AT Google

Good selection, very busy so at times you were up and down up and down to see if certain dishes had been filled back up, fee things were cold which is a put off for me. No lemon sauce for the lemon chicken either. 5/08/24. Not so good today, lots of food not hot enough

site_logo

Peter Hynd . 2024-07-05

MORE AT Google

Great place with great food! Kitchen looked very clean and the staff were friendly and helpful. Only thing is the price though, it’s a tad expensive but you do get a lot for what you pay for so i’d say it’s worth it. Come here plenty of times and i have to say the food is consistently good tasting and fresh. Place is quite big aswell so perfect for large groups/parties/families etc. Came here for a works night out and it was amazing! Would definitely recommend to everyone!

site_logo

Derek Thompson . 2024-07-04

MORE AT Google

We had a lovely lunch here. We have visited the Edinburgh and the Renfrew restaurants and enjoyed our meals and this one in Glenrothes didn't disappoint. Plenty of parking including some disabled parking. Level access to the restaurant. There are two entrance doors to negotiate but a staff member came and assisted us to get in and again when we left with the wheelchair. A huge selection of food in a buffet style area which we like as we can have a bit of everything. The staff were friendly and attentive. The washrooms clean and modern although the accessible toilet was a bit small and we had difficulty getting the paper towels out of the dispenser with wet hands. Prices very good especially if a weekday lunch time is chosen

site_logo

Iain Macpherson . 2024-07-02

MORE AT Google

Very good experience at this Buffet food very good tasty and freshly presented and a very wide selection, special mention for the sweet section whippy and normal ice cream lovely choices of pastry to go. Will we go back most definitely.

site_logo

Graham Foster . 2024-06-30

MORE AT Google

Fantastic place, food is excellent. Prices have gone up but still good as you can eat as much as you want

site_logo

Angie Coyle . 2024-06-25

MORE AT Google

Went for daughters birthday, had a table booked and it was just aswell as it was really busy. Good choice of food options, couple of soups, salad and desserts. Got the free refills of juice. Table cleared quickly when plates empty. Im a small eater so feel its not worth the money but all others in the group filled their boots and we'll worth it for them. If going at weekend night i would book a table, go n enjoy 😉

site_logo

Auds . 2024-06-23

MORE AT Google

We decided to visit after hearing this was good and always busy. On arrival the place was very busy and chaotic with people wandering around everywhere. We were taken to a table in a very big noisy room, our table was next to a staff cleaning area and very noisy. We went to look at the buffet area which was very extensive, starters were mostly a huge selection of deep fried items, some poor quality sushi and soups, all tasting oily, sweet and soggy, main dishes were extensive again, but unfortunately not great, they are just all mass produced with no effort to the presentation., very sweet and full of mono sodium glutamate. We then decided to have some dessert, unfortunately the area was busy with children touching desserts and no supervision by staff. This was a very expensive experience £76 for two adults, one pensioner and 3 soda water with lime drinks.

site_logo

Lindsay . 2024-06-22

MORE AT TripAdvisor

Great buffet was had by all. The staff were really nice and helpful. The venue was nice and clean, bright and lovely atmosphere. The selection of food available was truly amazing and fresh looking. Again, the staff were always checking keepthe food selection up to date and clear of mess. The bottomless drink for sft drinks, again, great selection. Our table was always clear and clean upon returning every time. Many thanks to all staff. We had a great experience and thoroughly enjoyed our food.

site_logo

lan Sturrock . 2024-06-18

MORE AT Google

Great quality food with a large variety to offer. Tables cleaned often and quickly without hassle. Would recommend to anyone!

site_logo

Chloé Cooper . 2024-06-16

MORE AT Google

Beijing Banquet in Glenrothes is a fantastic destination for a family feast! 🥢✨ Our visit to this all-you-can-eat Chinese buffet was a delightful experience, offering a wide variety of delicious dishes that catered to everyone's tastes. The selection at Beijing Banquet is impressive, with an array of appetizers, main courses, and desserts. From crispy spring rolls and savory dumplings to flavorful stir-fries and rich noodle dishes, every bite was a treat. The kids especially loved the sweet and sour chicken and the extensive dessert bar. 🍤🍜🍰 The restaurant has a spacious and vibrant atmosphere, making it a great place for families to enjoy a meal together. The staff were friendly and attentive, ensuring that our dining experience was smooth and enjoyable. 🧒👧 We appreciated the clean and well-organized buffet setup, which made it easy to explore and try different dishes. The price was reasonable, offering excellent value for the quality and variety of food available. Whether you're celebrating a special occasion or simply enjoying a meal out, Beijing Banquet in Glenrothes is the perfect choice for a delicious and satisfying dining experience. Highly recommended! 🌟👨‍👩‍👧‍👦 #BeijingBanquet #GlenrothesEats #ChineseBuffet #FamilyDining

site_logo

Ivan Jovic . 2024-06-16

MORE AT Google

Very good selection of food and different varieties and good quality food as well. Place buzzing and was very nice and clean.

site_logo

jodss10 . 2024-06-14

MORE AT TripAdvisor

Only serving sugar free drinks kind if a bummer ,and the quality is nowhere near as good as our last visit prices up quality down .

site_logo

Forrest robertson Alexander . 2024-06-07

MORE AT Google

Far to expensive, for me and 2 teenagers With me having a can of coke (£2.50)and them having the endless drink it was just a few pence under £80. I had some chicken balls that where so overcooked they where inedible, chilli chicken that was cold and lemon chicken that was like shoe leather. Fortunately for everything bad I was able to go and find something else that was nice. To be honest I would much prefer going to a decent takeaway and paying less than half.

site_logo

Lindsay Kirk . 2024-06-04

MORE AT Google

There's plenty of food choices and can keep even the pickiest of eaters fed. 10/10

site_logo

Louise . 2024-06-01

MORE AT Google

Justifiably a very busy restaurant - food very good for both variety and quality. Value for money in every respect - staff friendly, busy and very efficient.

site_logo

Anthony Gibson . 2024-05-31

MORE AT Google

Absolutely cracking eat as much as you like Chinese , and Italian food .Forget the cholesterol levels and fill your boots up ! Food and service absolutely fine . Rebecca (I think ) server , very helpful and friendly .

site_logo

Lucyrainbow . 2024-05-28

MORE AT TripAdvisor

Good choice of food and good value for money

site_logo

Susan Low . 2024-05-28

MORE AT Google

Always great food always love going here

site_logo

Darren . 2024-05-26

MORE AT Google

If you plan to eat more than one plate it’s definitely worth the £15. You get all sorts of cuisines, there’s just a salad section with all healthy stuff, then there’s all sorts of chicken and beef and seafood such as honey glazed chicken, chicken curry etc. there’s rice, noodles and a lot of desserts as well as pizzas and pastas. Just food for anyone and everyone. It’s a really nice atmosphere.

site_logo

Ioni B. . 2024-05-26

MORE AT Google

Totally average and over priced

site_logo

szkot .77 . 2024-05-24

MORE AT Google

Went for lunch, I haven't been since it became a world buffet style but had plenty of options so was well pleased will defo visit again

site_logo

Jeanette Simpson . 2024-05-18

MORE AT Google

It would be good to have a new collection of meals it's the same meals week after week.

site_logo

IAN ROBINSON . 2024-05-16

MORE AT Google

Fantastic choice of buffet 😋, great value for money and fast friendly service too. Highly recommend 👌

site_logo

Tracy Spowart . 2024-05-10

MORE AT Google

It's a chinese buffet... you know the drill. There is food and lots of it at a reasonable price. However, the food here is just a notch up from any other chinese buffets, you know. It's definitely worth a visit. Bring your appetite.

site_logo

Martin Holde . 2024-04-28

MORE AT Google

Fab food great service, will be back soon 😀

site_logo

Kate Garrigan . 2024-04-22

MORE AT Google

Excellent service, food fresh, hot and plentiful and exceptional value as well.

site_logo

Rob . 2024-04-20

MORE AT Google

really good for the money... plenty to choose... very clean recommend

site_logo

ian corcoran . 2024-04-19

MORE AT Google

absolutely amazing!! me and my boyfriend went for our monthly date night and we will definitely be back. the food was delicious and the staff were super friendly & welcoming towards us. a bit on the pricey side but definitely worth it as u can get as many plates as u like!

site_logo

chloe . 2024-04-17

MORE AT Google

Best all you can eat banquet I’ve ever been to. Food selection is superb. Lots of healthy options. I loved it ⭐️⭐️⭐️⭐️⭐️

site_logo

Sue Hennessey . 2024-04-13

MORE AT Google

An excellent meal 1st class staff were 1st class

site_logo

Ian Campbell . 2024-04-08

MORE AT Google

Was fine plenty range of food, staff friendly

site_logo

Nicola (at warmerlife) . 2024-04-07

MORE AT Google

Friday evening 5.45pm table. 1 adult, 3 kids (17, 14, 11). Three soft drinks. £97 total. £21.49 for a child of 11. Food reasonable but not affordable.

site_logo

Alan D . 2024-03-29

MORE AT TripAdvisor

I’m not usually a fan of these buffet style restaurants however I’ve been twice to the Beijing Banquet in Glenrothes over the last six weeks and it has been excellent. Great choice of food on offer which is replenished frequently. Food was hot and fresh. Staff work hard to clear plates away quickly and tables. Very clean restaurant and toilets - definitely worth a visit in my opinion.

site_logo

CLE68 . 2024-03-27

MORE AT TripAdvisor

Great selection of food for most palates, combined with slick and friendly service: superb!

site_logo

laurie Connal . 2024-03-23

MORE AT Google

Whilst a great selection - food was basic and we were disappointed . Food wasn’t hot and costly at £20 each. Can’t fault the staff who were good but we won’t be back

site_logo

Amanda W . 2024-03-14

MORE AT TripAdvisor

Pathetic buffet dinner for £20/-~. Went in at 8pm although open till 2130, by 2000 most dishes were empty and taken away with empty trays. Asked staff who says “sorry finished”, still had an hour left for the closing time. Couldn’t really say about variety of dishes, as couldn’t get to taste them as dishes were empty. Look like I came out paying the bill by 2050!!! Such a shame . Staff were only keen to close up- one staff (Chinese) was constantly cleaning the food trays insitu at the servery itself… so much for projecting a cleanly outlook, but I would think you don’t ‘clean’ a dish at the buffet servery.

site_logo

Karthik B . 2024-02-29

MORE AT Google

Great food staff are very helpful and friendly, highly recommended the buffet

site_logo

William Pake . 2024-02-27

MORE AT Google

Food is amazing.. Sad that you have to ask for a fortune cookie, then for a party of 4 given just 1 !! We have been twice this month and same thing each time.. that was the only disappointing thing 😪

site_logo

sheilafB6360HT . 2024-02-22

MORE AT TripAdvisor

Great service, food amazing, and a huge selection to choose from. Would go back again as so good. Atmosphere was fine, few screaming kids so not their fault, just something you have to put up with at a buffet.

site_logo

Chas Warrior . 2024-02-12

MORE AT Google

Good food but very very busy, quite a few "buffet slayers" there, but fl didn't have to wait for any of the very tasty food.

site_logo

Brian Cunningham . 2024-02-11

MORE AT Google

My favourite place. 😍 Great service everytime. Food is amazing and always hot.

site_logo

Helen Loizou . 2024-02-10

MORE AT Google

An all you can eat buffet. I got my money's worth. Food was very good and a great selection. Soft drinks came with free refills. I'd happily go back again (and again).

site_logo

Walter Bell . 2024-02-06

MORE AT Google

Great selection of food and very tasty

site_logo

Barbara Bell . 2024-02-02

MORE AT Google

Such a good Chinese buffet, fresh food and brilliant staff. Kit the superstar behind the bar is by far one of the best people I've seen giving customer service and always goes above and beyond always making it a joy to return again and again! Thank you Kit

site_logo

David Meredith . 2024-02-02

MORE AT Google

The food was lovely, a really good selection. Staff were all friendly and helpful.

site_logo

rhona mcintyre . 2024-01-25

MORE AT Google

Is a busy & popular place. Great variety of food. Value for money. And free parking outside restaurant.

site_logo

Kevin Lockley . 2024-01-21

MORE AT Google

Great place to go. Very friendly staff. Food is amazing.

site_logo

Helen Loizou . 2024-01-20

MORE AT Google

Today a group of us had booked for lunch, sadly the food was cold, never have we experienced this before, it was a real let down, now onto the floor staff, everyone of them looked miserable, like they didn't want to be there,which is sad as before when we have been the staff are usually cheery, lastly, why didn't management put sand or salt in the car park, it was like an ice rink, as we are a group of pensioners this is an accident waiting to happen, if you want to keep this place running, then give your paying customers hot food, tell your staff to smile and sort your carpark out before someone gets hurt, remember it's us paying customers that's paying our money to keep your place open, at least treat us with a bit respect

site_logo

Georgeann Crowe . 2024-01-18

MORE AT Google

First time being in not worth the money definitely wasn't worth it

site_logo

sarah watson . 2024-01-18

MORE AT Google

Great spot to visit with a few friends on a Sunday or any other day for that matter.

site_logo

Graeme Smith . 2024-01-16

MORE AT Google

Similary restaurants in Central Scotland

restaurant_img
4.3

158 Opinions

location-icon1 John Street
Chinese
outdoor_seating_196637takeaway_196637delivery_196637

Great food, decent price and staff friendly

restaurant_img
4.3

357 Opinions

location-icon170 Queensferry Road, Rosyth, Dunfermline KY11 2JF Scotland
Chinese
outdoor_seating_249394takeaway_249394delivery_249394

Good experience and suggestion to other once you need to visit Lovely food

restaurant_img
4.2

158 Opinions

location-icon12 Aberlour Street
Chinese
outdoor_seating_108513takeaway_108513delivery_108513

Last minute decision to grab a take away on way home from work didn't disappoint. Good price, generous portion and very decent compared to others locally.

restaurant_img
4.1

184 Opinions

location-icon254 St Clair St
Chinese
outdoor_seating_111306takeaway_111306delivery_111306

What a joke of a Chinese takeaway I should have ordered it from China it would have been quicker three hours to get your order whatever you do don't order from here unless you want your meal three hours later I won't be ordering from this Mickley mouse outfit again hope you find somewhere else to get your Chinese

restaurant_img
4.0

213 Opinions

location-icon52 Hospital Hill
Chinese
outdoor_seating_109117takeaway_109117delivery_109117

Ordered chicken fried rice. Floating in oil, oil collected in bottom of box, disgusting. Can see kitchen, black stuff piled up at edge of cooker, looked like scraped up dirt, put me off. Disappointed, won’t be back