GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4,1

Based on 1.219 opinions finded in 4 websites

3.5Ambience4.0Cuisine3.6Price4.0Service
site_photo4

Nº 1053 in 2408 in Camden

Nº 6 of 21 Thai in Camden

CUSTOMERS TALK ABOUT DISHES WITH.. vegetablesducksoupprawnsfishchillispicysaladchickenricenoodlesprawnfriedcookedcurry

comment_iconOpinions

Use to be good service and food but not anymore! Try Lucky Cat in Tuffenal park very good !

site_logo

Lewis Kirby . 2024-03-31

MORE AT Google

Easily the best Chicken Sambal in London. Creamy coconut rice. Perfect Pad Thai. Nailed the Laksa and Roti Canai as well. Lovely neighbourhood vibe, good fresh food cooked well, fully recommend.

site_logo

Joe Mahon . 2024-03-27

MORE AT Google

Lovely warm atmosphere with great service including who I think might be the owner really looking after us. The menu has a lot of variety and options. Unfortunately the massuman curry (my favourite dish) was much too salty. It was very difficult to finish. But we still had a nice experience so I will come back and try other dishes.

site_logo

Jaclyn Fulton . 2024-01-30

MORE AT Google

Its got an £8.50 lunch special. But you'd probly pay twice that not to eat it. Just bad.

site_logo

Milo Fentriss . 2024-01-11

MORE AT Google

I went here before a show at the forum. The food was delicious and friendly service. I will be back again.

site_logo

Adria Watson . 2023-12-15

MORE AT Google

We did our headline show at the O2 forum tonight end wanted a quick bite before stage time. This place is small but inviting. The food… truly wow!! I had the BBQ ribs to start followed by the drunk noodles with chicken that had a really nice chilli kick and was cooked to perfection. I was very happy with my good selection. Excellent and reasonably sized portions. VERY tasty!

site_logo

saffylew . 2023-12-14

MORE AT Google

The soup is extremely salty and the pad Thai is far too oily. I used to order frequently from here, going to their restaurant as well, but considering this order, the quality of the food has done down a lot, I'm sorry to say.

site_logo

Karen . 2023-11-08

MORE AT Just Eat

I used to be a loyal patron, but I was quite disappointed when I paid £9 for a rice dish that only had 2 prawns. It felt like I could have easily prepared it at home for much less. I mentioned my concerns when I ordered 3 dishes, specifically asking for a decent amount of prawns, and I was assured they would meet my request. Unfortunately, they didn't follow through on their promise. My daughters and I used to frequent this place, but this experience has led us to reconsider our choice. Please consider improving the quality and quantity of your dishes.Please take this feedback into account for future improvements RESPONSE TO YOUR REPLY!!!!!!!!!!!!! I understand your concern, and I appreciate your apology for not meeting the expected standard in your prawn dishes. It's reassuring to know that your prawn dishes should include 4 king prawns, and it may have been an unintentional mistake. However, I won't email you to resolve this issue. I've experienced this problem multiple times, with the most recent occurrence just a few days ago when my daughter and I ordered the same dish, and the prawns were once again insufficient. While one mistake can be forgiven, a total of 5 incorrect dishes within a week suggests a recurring issue. We value our hard-earned money just as much as you do, and we hope for better experiences in the future. This experience has left us with no choice but to say, "NEVER AGAIN."

site_logo

Farhia Arshe . 2023-11-01

MORE AT Google

I placed an order for Thai cuisine, but what arrived was essentially Chinese dishes disguised as Thai. The Thai stir-fried chili basil chicken, which should be dry and minced, turned out to be a regular Chinese chicken dish drowning in a watery sauce. Similarly, the nasi goreng resembled basic fried rice rather than the authentic Thai version. Even the Thai green curry seemed more like Chinese green gravy. Even as Chinese food, it didn't meet expectations. This is incredibly frustrating; none of the dishes resembled Thai cuisine, which is what I paid for.

site_logo

Parag Sankhe . 2023-09-28

MORE AT Google

Excellent food for a reasonable price. Excellent over the years!

site_logo

Livia Benigni . 2023-09-16

MORE AT Google

Super fast delivery and some delicious food

site_logo

Kalim . 2023-09-13

MORE AT Just Eat

So delicious! I really love coming here.

site_logo

Jena Chen . 2023-09-05

MORE AT Google

Amazing food! Red Thai curry and drunken fried rice particular favourites!

site_logo

lara fraser . 2023-09-03

MORE AT Google

Driver didn’t read the delivery instructions. Had to run around the estate like an idiot trying to intercept him. Food now cold. Furious

site_logo

Chris . 2023-08-31

MORE AT Just Eat

The food was very good but unfortunately, we ordered 2 green curry and only 1 was delivered. We tlcalled tge restaurant, that told us to speak to Just Eat. Let's see.

site_logo

Celine . 2023-08-26

MORE AT Just Eat

Always superb. A takeaway that includes decent amounts of really good veg. Love it.

site_logo

Dave . 2023-08-15

MORE AT Just Eat

Pad see ew had hardly any chicken and tasted more chinese than thai. Chicken starter was good

site_logo

David . 2023-08-12

MORE AT Just Eat

HOME DELIVERY Inconsistency They USED to have free delivery for over £15. Sadly, they've started using companies like DELIVEROO(awful) and Just Eat (quite good). These companies charge "service". Baan Thai app (terrible) makes financial mistakes, omits the house number in email delivery confirmations and ALSO asks if you would like to contribute up to 15% service charge which doesn't include the delivery company over which you have no choice. STAY AWAY FROM APP - use a browser instead. This is a great shame for such a wonderful restaurant. . I have started asking staff for reccomendations. You know - like asking a wine expert on what's best to go with what. They don't just say the special or the most expensive item. You chat with them (they're very friendly people) and you say the sorts of things you like or have had before and they will come up with some suggestions. Today's hot fresh home delivery included; Tom Ka soup. If you like tom yum but find it maybe just a touch too spicy - try Tom Ka. It's sort of milder and got coconut milk. Marvelous. Bangkok chicken. In a sort of batter. But, not the Chinese takeaway or fish n chip shop batter. It's sort of thinner and just seals in the juices and taste of the chicken. In a sauce with veggies and Zing, tang, flavour. But,at the same time not overpowering and leaving you feel well fed but not stuffed. EGG FRIED RICE - no flavour. It's like someone forgot some ingredients. Consistent results are very important. I've been visiting and getting takeaways for more than 2 years. And, if you think about it...... consistently reaching or exceeding your expectations is why you go back again and again. 2 years ago in summer I wrote - Thai salads Perfect for hot summer weather when you just want a light, well priced salad with that wonderful Thai zing. Maybe with a lemon tea. Perhaps share a kampung nasi goreng. I have had nasi goreng many times in Bali and Baan Thai's is equal in flavour. Slightly different in layout (Baan Thai doesn't serve Ayam pieces on the side) but then, Balinese Indonesian is different from Java Indonesian etc. .......prior reviews This is Thai and Malay food. So, all the idiots ordering or asking for HK, Guandong, or Szechuan dishes need to re-read the sign. I started with Tom Ka (Tom Yum with coconut milk). Very flavoursome. Kafir lime as well as lemongrass, very tasty white chicken meat, quartered button mushrooms cooked just long enough to absorb the flavours. Fish sauce (of course). Some people don't like the smell of fish sauce. I agree it can take a little getting used to. But, I promise you - this Tom ka with the fresh basil on top was well worth it. I followed with a green papaya salad:- mmmm that sweet, sour, hot, crunchy combination is just wonderful. Perfect for a warm day. Shredded carrot, Julienne papaya, bean sprouts, halved cherry tomatoes, fresh, crunchy roasted peanuts, green beans, some red chilli lettuce..... And the sauce!! Hot, tangy, juices, palm sugar all twirled together and demanding to be eaten. I paid just over £11 for those two items total. Not too busy at 2pm.... Couriers coming and going and a few seated customers. A really yummy lunch. Subsequent visit(s) I tried the nasi goreng. Strictly speaking this is an Indonesian dish. But, the Malaysian and Indonesian people originate from the same stock so it,a not surprising that some dishes (particularly rice dishes) are identical. Though, for me, the influence in Malaysia of Indian, Chinese and Thai cuisine has produced far more delicious variety. The Thai iced tea (without milk) is very fragrant and not too sweet. I am going to have to return many times, because everything I have tried so far is wonderful and delicious. Charming, courteous, pleasant staff (as one always finds with both Thai and Malay people). Six stars.

site_logo

David Guru . 2023-07-18

MORE AT Google

5 stars all around for Vince - best service and such tasty, authentic, affordable Thai food! Red curry w/ tofu was divine.

site_logo

Gemma Boothroyd . 2023-07-05

MORE AT Google

Masaman Beef curry for the win!!!!! And salmon red and some veggies where all yum! Prompt service with a smile. And maybe I was someone you knew

site_logo

tamzyn b-Melbourne . 2023-05-15

MORE AT Google

Arrived slightly early, food was well packaged, hot and tasty. Bangkok chicken was especially delicious. Would order again.

site_logo

gail . 2023-05-13

MORE AT Just Eat

Very nice! Good price quality dishes flawless service! Would recommend!!

site_logo

Maddy Xu . 2023-05-04

MORE AT Google

incredibly authentic thai food. excellent service. waiter was very kind and helpful. in my opinion, one of the most authentic thai restaurants in london!

site_logo

YaxuFN . 2023-04-30

MORE AT Google

Ottima ospitalità, ottimo cibo e prezzo-qualità bel ambiente consigliamo molto!

site_logo

Toni Cirrincione . 2023-04-30

MORE AT Google

Delicious food. Fresh and hot!

site_logo

Georgina . 2023-04-11

MORE AT Just Eat

Did not update the tracker in the app, did not answer any of three calls, delivered at 8.45 one hour 5 mins after requested delivery time, declined order as this was for breaking fast during Ramadan. Not acceptable not to update the App or answer calls. Have requested a refund.

site_logo

Yasmin . 2023-04-10

MORE AT Just Eat

Food is amazing thank you definitely reordering

site_logo

Steve . 2023-04-09

MORE AT Just Eat

Very Amazing atmosphere with great decorations. The food were tasty for us hungry folks that haven't eaten all day.

site_logo

Risa . 2023-03-28

MORE AT Google

Delicious. Amazing satay sauce, the nasi goreng was the best I've ever had. And lovely staff, a perfect little spot to dine on takeaway.

site_logo

Timo Fermin . 2023-03-09

MORE AT Google

Very tasty food. Busy place. Lovely staff. Good choice menu.

site_logo

Caitriona Dorrian . 2023-02-25

MORE AT Google

The Singapore noodles were truly fantastic! Service was lovely too

site_logo

Elizabeth McCauley . 2023-02-23

MORE AT Google

The crispy duck and pancakes was absolutely dreadful, tiny portion for the price, very little meat and horribly fatty. So disappointing,

site_logo

Gareth . 2023-02-14

MORE AT Just Eat

Without doubt the best Phad Thai I’ve ever had, same goes for the aromatic duck! Food arrived quickly and was steaming hot the portions where generous too. Can’t wait to try the other dishes on their menu! Highly recommend this restaurant

site_logo

emmi . 2023-02-11

MORE AT Just Eat

I order here quite frequently - pro tip: order via Google/foodhub and not deliveroo/ubereats as it is much cheaper. I really like the curries - order keaw wan and panaeng all the time. The pad Thai is Very good too!

site_logo

Lisa A S . 2023-01-30

MORE AT Google

We did not get what we ordered and paid for. We got plain rice instead of the rice dish we ordered and the beef randang was vegetable randang. We also missed a starter - we ordered spare ribs and got dumplings instead.

site_logo

Eleanor . 2023-01-22

MORE AT Just Eat

The roti was good but the curry was incredibly disappointing.

site_logo

Alice . 2023-01-13

MORE AT Just Eat

Got the wrong food very disappointed

site_logo

Fatos . 2022-12-24

MORE AT Just Eat

Tasty Thai food. Big servings and very lovely lady staff. Highly recommended!!

site_logo

AJ Castillo . 2022-12-23

MORE AT Google

Food was dumped in a random public area outside my flat. No-one brought it to my flat. Found it sat in the cold somewhere

site_logo

David . 2022-12-21

MORE AT Just Eat

We ordered a takeaway and it never came

site_logo

Izzy M . 2022-12-12

MORE AT Google

One of my items were missing. Called the restaurant but no one picked up the phone. Food was late for 45 minutes

site_logo

Cara . 2022-12-12

MORE AT Just Eat

We ordered a few things which we managed to eat but the spare ribs? - unbelievably dry

site_logo

Susan . 2022-12-09

MORE AT Just Eat

Found silver foil cooked into food which ended up in my mouth. Big food safety issue will never order from here again.

site_logo

Paul . 2022-11-25

MORE AT Just Eat

Food was delivered late , and order was wrong . I had ordered prawn pad Thai, but that wasn’t delivered . instead some mixed rice was delivered which was very bland . Quite disappointing.

site_logo

Anil . 2022-11-24

MORE AT Just Eat

Always come back for roti canal and Bangkok chicken it’s so good every time!!!

site_logo

Alexander Hug . 2022-11-16

MORE AT Google

Delicious food and arrived early.

site_logo

Sarah . 2022-10-22

MORE AT Just Eat

Food simply wasn't edible. I'm shocked by the good reviews.

site_logo

Amun D . 2022-10-17

MORE AT Google

If you order the Tom yum soup, you will get one singular prawn when you select it. I ate that prawn as slowly as possible so sadly I won’t be ordering again because I didn’t know there was a world shortage with prawns.

site_logo

mahin rahman . 2022-09-25

MORE AT Google

Lovely restaurant - great service, very good dishes.

site_logo

Si-Hing Gabor . 2022-09-22

MORE AT Google

Excellent food, great service if a little slowed down by their takeout orders. Recommended if you have time.

site_logo

Tom Moreton . 2022-09-22

MORE AT Google

A little bland this time. BBQ ribs too sweet and chewy, the squid and vegetables under-seasoned. The Sambal Udang a bit muddy in texture though the prawns were nice. More salt and spice needed throughout.

site_logo

sam . 2022-09-09

MORE AT Just Eat

Superb Thai restaurant! Food cooked with love from a family run business. Loved the curries and i will be back!

site_logo

Alex Celler . 2022-09-01

MORE AT Google

The food received was either too salty or over cooked from the tofu to the noodles. The drunken noodles was so salty I've had to cut it in with rice. The quality of the vegetables were on their way out. Would sadly not order again.

site_logo

Farrah . 2022-08-31

MORE AT Just Eat

There was no sauce and the plastic tin was half full. Really poor I rang up the takeaway and they just told me to write a review

site_logo

John . 2022-08-23

MORE AT Just Eat

Have been looking for a decent Thai food place since I moved here, and I think I finally found one! Truly delicious food. The ribs with chilli salt were tasty and spicy. The beef drunken noodles very tasty and hot! And the beef rendang was really tasty and literally fell apart. The whole meal very pleasant. And their delivery driver found my awkward address! All in all very successful and look forward to ordering from here again.

site_logo

Victoria . 2022-08-17

MORE AT Just Eat

They phoned and asked if we’d like it early.we said yes!! It was delicious. The delivery man was lovely. Who could ask for more?

site_logo

Sue . 2022-08-14

MORE AT Just Eat

We have been ordering from Baan Thai for many years now and it has always been great!

site_logo

Conrad . 2022-08-10

MORE AT Just Eat

Mostly onion diner. Tons of onions here tons of onions there. Onion everywhere. Definitely it is not Thai food. Edible tho. I do eat onion.

site_logo

MARS . 2022-07-23

MORE AT Just Eat

Excellent service , food is superb always . Delicious,

site_logo

Ali . 2022-07-06

MORE AT Just Eat

All three dishes very poor. Phad Thai was horrible too much liquid. Prawns were slimy did not smell very fresh. Threw all three dishes in the bin.

site_logo

claire . 2022-07-01

MORE AT Just Eat

Pad see eiw with Prawn had only 3 prawns. Will not order again.

site_logo

Kate . 2022-06-28

MORE AT Just Eat

Tremendously authentic Thai cuisine, fantastic menu and lovely staff.

site_logo

Matthew Rose . 2022-06-19

MORE AT Google

Friendly staff, great prices, great food. My go to cheap and cheerful restaurant.

site_logo

H . 2022-06-14

MORE AT Google

員工親切。但食物不道地。 菜單上有日式/印尼料理。 印尼炒飯完全不及格。飯體過濕,味道也不像印尼炒飯,比較像是中式的炒飯。其中放了冷凍蔬菜,也有一點酸味,不管是把這道炒飯放在哪個國籍下,都是一個不及格的炒飯。 另外點的泰式炒河粉就還不錯,算是道地。 有點辣,小朋友會不太適合吃。

site_logo

Joanne Liao . 2022-06-14

MORE AT Google

The food is amazing, I find the atmosphere to be very nice and cozy and such a warm and welcoming service as-well, such a gem in Kentish town 😊

site_logo

Ernesta Kairytė . 2022-06-14

MORE AT Google

Stopped here before heading to the O2. Great food, my Nasi Goreng tasted like I was back in Indonesia. Strongly recommend!

site_logo

Andreas Niklas . 2022-06-12

MORE AT Google

Absolutely superb. Loads of veg with lots of variety in both the drunken rice and the curry. Great flavours and it looked fantastic.

site_logo

Dave . 2022-05-31

MORE AT Just Eat

I've ordered on a few different occasion... I've had Priew Chicken, Bangkok Chicken, and also the Meal deal for 2 with Spring Rolls, Pad Thai Chicken & Prawn Crackers. Everything has always come correct. Hot, tasty & on time, I cannot fault it. Arguably the best thai I've ever had. Thanks Baan Thai. I will be forever a returning customer!

site_logo

Bambz Rose . 2022-05-29

MORE AT Google

I appreciate it was really late and they were close to closing but the noodles and the black bean sauce were really poor quality. Both were really lacking in flavour and the black bean sauce was really runny

site_logo

Tom . 2022-05-09

MORE AT Just Eat

Not good at handling people with allergies

site_logo

Tim Woods . 2022-05-08

MORE AT Google

Good size portions and yummy food.

site_logo

Mario D . 2022-04-11

MORE AT Google

Enjoyed pad Thai noodle and Thai salad. Very nice.

site_logo

Bass Fraikin . 2022-04-04

MORE AT Google

Great quality, tasty and authentic thai food. Amazing!

site_logo

Abdul . 2022-03-13

MORE AT Just Eat

Best Thai delivery within a 2 mile radius. Green Curry all the way!

site_logo

stars capital . 2022-03-11

MORE AT Google

Aside from being really late and therefore cold. The tempura were wet and limp with browning salad in the box (why even bother). Beef penang (was not a proper penang) and rice dish were dire. Quality and taste were genuinely so bad I cant understand what the other reviewers are talking about. Poor excuse for Thai.

site_logo

James . 2022-01-30

MORE AT Just Eat

Our new favourite. So pleased it turned up just under an hour after ordering, rather than the predicted 1.10hrs minimum, but it would have been worth the wait. Authentic Thai food, arrived warm and tasty. Will be ordering again.

site_logo

Jane . 2022-01-22

MORE AT Just Eat

We've ordered takeaway before but stopped in to sample the restaurant and so glad we did. Great service, lovely staff really quick and top quality. Anytime it makes sense we'll be visiting rather than ordering out from now on as its perfect and so quick it makes sense prior to say, going to a gig at the forum. Great value and great food.

site_logo

Jamie Mackie . 2021-12-16

MORE AT Google

Highly recommend - delicious food, huge portions, amazing prices for central London, and the friendliest, most helpful service I've had in a long time. A real find.

site_logo

randomdiner . 2021-11-26

MORE AT OpenTable

Not had duck for ages and this was great shame there were a few bones but yummie

site_logo

ambreen . 2021-11-23

MORE AT Just Eat

The food was amazing. Asked for it to be extra hot and it was piping hot! Lovely

site_logo

Aneesah . 2021-11-20

MORE AT Just Eat

Fantastic food, highly recommend

site_logo

Nick . 2021-10-22

MORE AT Just Eat

Local spot with delicious food and friendly service. Love the roti and laksa here.

site_logo

Martin Raag . 2021-10-14

MORE AT Google

First time I have ordered from here. Upon ordering I thought hmm this is a bit pricey. Upon trying the food I can assure you no regrets. Absolutely delicious. Thanks guys and I hope to be ordering again soon :)

site_logo

Mohammed . 2021-10-10

MORE AT Just Eat

Great little find just near the o2 forum. Great vegetarian selections and even though they were very busy they couldn't have been any more helpful. Will certainly return when in the area. The drunken noodles are to die for!

site_logo

Kirstie Gibbons . 2021-10-10

MORE AT Google

Creamy and spicy Duck red curry! Very authentic and fresh

site_logo

Chloe . 2021-10-08

MORE AT Just Eat

Cosy friendly environment. Reasonable priced food.

site_logo

J P . 2021-09-24

MORE AT Google

One of the best Thai/Malaysian restaurant this side of the river. The standard Thai curries are all brilliant and so are the Nasi gorengs. Good choice of starters too, with the salt and pepper chicken and papaya salad being our favourite. Really puzzled with some of the negative reviews... Stop moaning like a Karen/Boomer and support fantastic local business.

site_logo

Max Payne . 2021-09-20

MORE AT Google

Kumpung Nasi Goreng and Vegetable Gyoza were absolutely fantastic. So flavourful and quick service. Would definitely recommend.

site_logo

RK . 2021-09-19

MORE AT Google

Friendly service, adequate but uninspiring food. Ordered a mix of dishes, a chicken green curry, a som tam (papaya salad), some morning glory, and a beef phad krapraw (stir fry with onion, beans, holy basil, and chilli). The som tam was passable - slivers of carrot and what could have been green papaya or something more generic, pops of fiery heat from chilli, and some green beans. The dressing felt a little watery, lacking both vibrancy of fresh lime and saltiness of fish sauce. The peanuts were few, whole, and a tad over-roasted. I would have preferred them to have been crushed, so they incorporated better into the salad, but that's a matter of preference. A better dressing would have fixed this dish. The morning glory was easily the best dish - thin slices of chilli and tonnes of oyster sauce gave a really savoury flavour. The green curry was an adequate attempt, but everything had room for improvement. The sauce was very sweet (which I don't particularly mind), with OK coconut flavour but minimal heat. Big chunks of vegetables were pretty disappointing, but the bamboo shoots were a worthwhile inclusion. The chicken itself had a disappointing texture, soft but with a slight bounce, likely the result of over-aggressive velveting. So much of Thai cooking is about balance, and this was another dish that failed in that regard - more heat and more fragrance along with less sweetness would have made a large improvement. The final dish was the beef phad krapraw and was the biggest let-down of them all. Typically this dish is a relatively dry stir fry with a base of garlic and chillies, small pieces of some protein, and then fistfuls of holy basil. It's also quite customary to serve this with an oil-basted fried egg. First off, no egg. That's fine, it wasn't mentioned on the menu. I think it's a shame not to include it, but so be it. Then for the dish. What I received was a dish of sliced beef (again with a bad texture from over-velveting), large chunks of bell peppers and onions, a few bits of chilli, all served in a pool of a generic, dark brown sauce. Very low heat level, everything looked pale, like their burners aren't powerful enough, again no fragrance from chilli and garlic, and worst of all, no holy basil in sight. That's simply too grave a fault to overlook. The service and price was all plenty good enough to make me consider returning, but the quality of the cooking was just not good enough. If you're unfussy and just want some palatable food, by all means go to Baan Thai, but if what you're really after is big Thai flavours and diligent cookery, maybe give it a miss.

site_logo

Josh Weinstein . 2021-08-26

MORE AT Google

Nice food & I had more seafood than last time. Good

site_logo

Kady . 2021-08-26

MORE AT Just Eat

Very nice food but it would have been nice to have more than 3 prawns in the food

site_logo

Kady . 2021-08-21

MORE AT Just Eat

I ordered chicken and got beef! I don't eat beef, so I could only eat the rice, which was ok but but bland on its own. I wouldn't order from there again

site_logo

Tania . 2021-08-14

MORE AT Just Eat

Outstandingly good vegetarian food which was very reasonably priced in an unsuspecting place. A total hidden gem.

site_logo

JoshuaZ . 2021-08-02

MORE AT OpenTable

Delicious food, friendly staff. A true hidden gem

site_logo

Lewis Nelken . 2021-08-02

MORE AT Google

Bland and 'meh'.... just another of the many restaurants on just eat who doesn't have a passionate chef or anyone with the mindset to at least try to make the best Thai food they can.. just business... (Thai people wouldn't eat this stuff, no way).

site_logo

bilrans . 2021-07-30

MORE AT Just Eat

As good as always, excellent customer service.

site_logo

Wilson Salazar . 2021-07-24

MORE AT Google

Took almost 2h to deliver from deliveroo and people at the restaurant lied about the delivery every time I called!

site_logo

märt-erik mäeots . 2021-05-10

MORE AT Google

The drunken noodles were so hot they were inedible. The beef was dry and tough. There was so much dried chilli the seeds were solid and stuck to the noodles and meat. Every mouthful had solid nasty hard chilli seeds. The green pepper was bitter and barely cooked. Delivery was about 30 mins early with no notification from the restaurant. We will never order from here again. Waste of time and money.

site_logo

Kate . 2021-04-14

MORE AT Just Eat

Delicious food best chicken fried rice with basal and spice

site_logo

Ali . 2021-04-09

MORE AT Just Eat

The food i received was very bad quality, the rice dishes were hard and tasted crunchy and un fresh, also the curry dish was inedable due to the beef consistency being so hard a chewy the two starters were fine. I would like a refund on these three dishes.

site_logo

Menny . 2021-03-31

MORE AT Just Eat

Similary restaurants in London

restaurant_img
4,0

1 Opinions

Thai Smile
location-icon8-10 Southampton Row
Thai

استمتعنا كثيراً بلالكل في هذا المطعم الممتاز، الخدمة ممتازة وطاقم الخدمة ودود ،الاسعار مناسبة ،قائمة الطعام وفيرة، اكلنا النودلز والتاميم سوب وكانت لذيذة المذاق.

vegetablesducksoupprawnsfishchillispicysaladchickenricenoodles