GastroRanking-logo
whatsappWhatsapp
phoneCall
desktopWebsite
menuMenu
bookingBooking
4.0

Based on 241 opinions finded in 1 websites

site_photo3

Nº 3303 in 7028 in City of London, Westminster

Nº 100 of 248 Asian in City of London, Westminster

CUSTOMERS TALK ABOUT DISHES WITH..garliccookedpeanuteggnoodleschickenfriedmeatspicyprawnsrice
Score
OpinionsNoteTripAdvisor2414.0

comment_iconOpinions

Esta es la comida reconfortante para cualquier indio en una noche fría después de unas cervezas en los pubs cercanos. Elección de diferentes tipos de fideos o arroz, elegir sus verduras o carne y luego elegir su salsa y lo harán frente a usted en este enorme Wok y lo servirán en tubería caliente en una bonita caja de papel. Unas cuantas verduras y huevo viene como parte del plato, solo tienes que elegir los complementos. soberbia comida servida caliente y podrás elegir la salsa que se adapte a tu gusto. Si te gusta picante como a mí, te sugerirá la salsa asiática picante. . . Sabor como en casa en la India de nuestro propio chino indo : - ) Sugeriremos encarecidamente este lugar o cualquier otro punto de venta, pero este permanece abierto hasta tarde. Una pequeña zona de estar donde se puede sentar a comer e incluso añadir más salsas a su gusto, pero se llena los fines de semana. También puedes comerlo mientras estás de viaje... eso es lo que hice cuando estaba lleno.

site_logo

babsNagpur . 2025-02-26

MORE AT TripAdvisor

Muy descontento con mi pedido, tuve que esperar mucho tiempo para quemar comida, no buen servicio y la prueba fue quemar, tuve que hacerlo en la papelera y tenía dolor de estómago.

site_logo

Foysal A . 2024-11-28

MORE AT TripAdvisor

Trabajo por la zona... sin duda recomendaría este lugar es asequible, rápido y agradable entorno Además, puedes personalizar tu comida haciéndola ideal para ti. Me encanta este lugar

site_logo

Ishmael J . 2024-10-15

MORE AT TripAdvisor

CRAP. Could not even eat my food as a pescatarian because it was cooked in the same wok as the meat dishes. Was not alerted of this when ordering so could not eat dish after payed

site_logo

Rebecca J . 2023-12-16

MORE AT TripAdvisor

Entre en este lugar cuando iba paseando por el Soho de Londres. Si te gusta el Wok este es tu sitio. Muy buena calidad en sus productos que vas seleccionando, ya que están en una vitrina y puedes verlos. Por poner una pega el local es muy pequeño y con 5 o 6 personas ya se han llenado todos los sitios para sentarte a comer.

site_logo

Un viajero más . 2023-06-14

MORE AT TripAdvisor

Whenever I visited London my place to eat is wok to walk, not just because of the food but for the taste. However, I feel bad to say that the quality of the food has fallen so low. Food is not cooked properly, the meat tastes raw, if the people are out of spring onions they should be informed during the payment itself but nothing was done properly. I don't know if I will visit wok to walk again I never felt this bad for something.

site_logo

MITHIL S . 2023-05-28

MORE AT TripAdvisor

På vei tilbake til hotellet etter en lang dag i London stoppet vi tilfeldigvis innom her. Deilige nudler wokket mens vi ventet passet perfekt

site_logo

superto . 2023-04-02

MORE AT TripAdvisor

Second time at one of these places and it was just as good as the first. I love. The choices - you can really create something that is aimed at just what you fancy. They cook it so well. I had egg noodles, chicken breast, cashew nuts, baby corn and a peanut sauce. It was so good. Loved every mouthful. Also generous portions. At little over a tenner, I thought the value for money was okay, especially in the heart of Soho.

site_logo

sfuhere . 2022-12-19

MORE AT TripAdvisor

First of all, customer service is awful, couldn't answer my questions. Upon further research I found out that the eggs that Wok to Walk serves come from battery cages, or in other words, they come from hens that live in tiny cages and are covered in their own urine and feces and dead birds. I won't eat food like this! Plus, it's awful treatment of animals.

site_logo

280marlat . 2022-06-28

MORE AT TripAdvisor

I ordered online and the food tasted off, it was probably spoiled, also didnt get any of the hot sauce I ordered

site_logo

svizabella . 2021-12-06

MORE AT TripAdvisor

Love it here but in truth ate here a few times after lots of drink - perfect post drinking food. Quality and portion size is excellent, always super quick and friendly. Love it

site_logo

BettyBram . 2021-10-24

MORE AT TripAdvisor

Love this place, easy distance to walk and sit on Piccadilly Circus and watch people passing or street entertainers.

site_logo

AmandaF971 . 2021-08-16

MORE AT TripAdvisor

First time here and enjoyed it. I found it online and placed my order there and paid for it. Turned up to collect my food and was told that they don't have online ordering. Reordered, repaid and thankfully had a refund from the website within an hour. Food was prepped and good to go within 2 minutes. Really tasty. Cardboard box was full and then some. Loaded with the extras I ordered. Would happily return.

site_logo

Wanderingwonderings . 2021-06-20

MORE AT TripAdvisor

Chicken was halal so got a couple of spicey Asian noodles. Was pretty good, needed more udon noodle though. Would return for a quick hot meal.

site_logo

Aamnaaamna . 2021-05-23

MORE AT TripAdvisor

I had a rice noodle with prawns and mix paper hot spice sauce, I still in love and definitely I will come back, nice portion, good environment and clean shop.

site_logo

Veiga_Palhares . 2020-12-08

MORE AT TripAdvisor

I am very disappointed with the food it was tasteless. I had egg noodles with prawns and chicken Katsu and was looking forward to eating it. Not happy with my takeaway

site_logo

747azrak . 2020-06-14

MORE AT TripAdvisor

Today (21/01/20) I attended this venue for some food. I ordered the Egg noodles with chicken breast and sweet & sour sauce. I had a can of Diet Coke to wash it down. The food was rather tasteless & lukewarm which was disappointing. It wasn’t until long after I arrived back at home, I saw on my online banking that I was charged £8.70 for my meal. That confused me as the noodles was £4.95 plus £1.30 for the drink. I’m not at all happy and won’t visit again.

site_logo

HappyGoLuckyMe123 . 2020-01-21

MORE AT TripAdvisor

Super bon, les sauces nous ont fait voyager ! Petit bémol sur les crevettes qui n’avaient pas de goût...

site_logo

heloiseb526 . 2020-01-14

MORE AT TripAdvisor

Este lugar tiene una excelente relación calidad-precio si buscas algo lleno y lleno de sabor. Usted elige su arroz o fideos, elige sus carnes y / o verduras y lo cocinan a pedido, también tienen un par de asientos y bebidas frías. Sin embargo, el personal debe ser más positivo, sonreír, darle la bienvenida y ser más amable, ¡no parezca que odias tu trabajo y que odias a las personas!

site_logo

Day D . 2020-01-09

MORE AT TripAdvisor

Wok 2 Walk es un popular restaurante de fideos que está disponible en otros países y en el Reino Unido.Hay muchas sucursales en el centro de Londres que atraen a muchos clientes.Me atrajo Wok 2 Walk debido a la flexibilidad y las opciones.Puedes elegir tus fideos, ingredientes y salsa.Fui a la sucursal en Great Windmill Street porque hay unos pocos asientos para sentarse junto a la ventana.La cocina parece un camión de fideos.Lamentablemente, el menú ha cambiado ligeramente y no ofrecen tocino como una de las opciones de ingredientes, pero las otras opciones también fueron buenas.Básicamente, elige una mezcla de fideos, granos o vegetales como base, luego hasta cuatro ingredientes y luego la salsa.Elegí los fideos de huevo con gambas y champiñones en salsa de Szechuan.Los fideos se calentaron en una linda caja de cartón, al igual que las comidas chinas que obtienes en los EE. UU.En general, fue bastante agradable, especialmente las rodajas de champiñones que estaban semi crudas y me recordaron las ensaladas mientras que los langostinos estaban hinchados.El sabor de los fideos realmente depende de la salsa, pero desafortunadamente la salsa Szechuan que elegí era demasiado dulce para mi gusto, así que no me gustó.Probablemente me hubiera gustado si hubiera elegido una salsa que no fuera tan dulce, así que la próxima vez optaré por el SEOUL, que es soja y jengibre.También hay sobres de salsa de soya y chile en la barra de condimentos si encuentra que el condimento no es suficiente.

site_logo

supersupergirl . 2020-01-02

MORE AT TripAdvisor

Primero probé esta franquicia en Lisboa, donde pensamos que era increíble. ¡Vi esto aquí cerca de Leicester Square, tuve que probarlo! En ese momento había una pequeña cola afuera. Brillante, pensé que estaba en orden. Luego esperé el anuncio fortuito de un miembro del personal altamente sobrecargado de trabajo que gritaba el Oder ¡no! Los chefs que se pueden ver grandiosos en los escaparates arrojando sus cucharones, cucharas en el aire, se veían encantadores. Sin embargo, la comida estaba mal cocinada, de sabor suave, aunque lo que habíamos pedido debería haber establecido los gustos en llamas! Esto fue en su mejor promedio. Muy decepcionado. ¿Espero que solo haya sido un mal día?

site_logo

Jaan6482 . 2019-09-22

MORE AT TripAdvisor

He pasado por este lugar un par de veces, siempre está ocupado, y siempre he tenido la intención de aparecer, hoy lo hice, ¡y desearía haber aparecido hace mucho tiempo! ¡Absolutamente delicioso! Fui por los fideos normales, con verduras y cerdo a la barbacoa, con salsa teriyaki, salsa de chile extra y cebollas crujientes. ¡Pedido y listo en menos de 5 minutos!Comí, pero el lugar no tiene asientos, compartí una mesa con otra pareja, pero a nadie le importa: vale la pena visitarlo, elige tus ingredientes y toma asiento donde puedas. ¡No puedo esperar para probar algunos de los otros ingredientes!

site_logo

frankiearnone . 2019-09-16

MORE AT TripAdvisor

La verdad si buscas algo rápido, rico y económico te recomiendo estos restaurantes que soy muy buenos, eliges tus alimentos de acuerdo a tu gusto y presupuesto con un delicioso sabor.

site_logo

H S . 2019-07-31

MORE AT TripAdvisor

¡Venga aquí para un almuerzo rápido mientras hace turismo y si lo que busca es velocidad y buena comida, este es el lugar para usted!El letrero de afuera que te dice que los precios para un inicio de caja a partir de 4 es un poco engañoso, mientras que comienzan a partir de 4, eso te da una caja de fideos y salsa estándar, que obviamente nadie va a obtener! Como resultado, el precio aumenta con las adiciones que agregue. Para los fideos de arroz, el pollo, el brócoli y el maíz tierno, fue alrededor de 10.Para ser justos, la caja está llena hasta el borde con comida y es sabrosa, buena comida, se siente mejor que pagar 5/6 por una comida para llevar más convencional.Hay 4 asientos en la ventana del restaurante donde nos sentamos, ¡pero la mayoría de la gente simplemente lo toma y se va, como su nombre indica!

site_logo

jessmurphy99 . 2019-07-06

MORE AT TripAdvisor

이걸 왜먹는지 모르는맛 딱히 음식 가리지않는내가 배고픈상태에서도 다 못먹은맛새우는 냄새나고 양념은 미원맛에 친절하지도 않고 줄도 김...이걸 먹을바엔 테스코 샌드위치를 먹을맛

site_logo

Sarah14079 . 2019-05-11

MORE AT TripAdvisor

Este sitio es genial, los noodles son riquísimos y además es super baratos. A nuestras hijas les encanta y cumple la regla de las 3 B (bueno, bonito y barato), por 4,95 una cajita de noodles con huevo y salsa. Mmm que rico!!

site_logo

ceciliacP1195MT . 2019-05-05

MORE AT TripAdvisor

Been to a few wok to walk over the years always nice food and cheap a good choice and staff are friendly only a few places to sit but I usually get take out

site_logo

dawnmY6236XA . 2019-03-06

MORE AT TripAdvisor

Very friendly the staff are all very nice and happy wok to go also is very good value for the money, nice and cheap

site_logo

Leigha A . 2019-01-31

MORE AT TripAdvisor

Après avoir bien fêté la nouvelle année on a atterri à Wok to Walk et c’était mon premier repas de 2019! Et j’ai bien commencé l’année. Des nouilles savoureuses, du bon poulet et de la sauce Teriyaki à gogo! Rapide et efficace! Puis franchement ça cale bien!

site_logo

Tlodiie . 2019-01-10

MORE AT TripAdvisor

Con 5 sterline sostanzialmente mangi un piatto abbondante di noodles o riso, con verdure , o carne cotto nel padellone wok davanti ai tuoi occhi. Una salvata sia economica, sia per non mangiare sempre le solite porcherie nei fast food.

site_logo

Fabiov20 . 2019-01-09

MORE AT TripAdvisor

Tuve mis habituales fideos Udon con pato y verduras. En general, era agradable y sabroso, pero bastante caro para agregar algunas verduras. Pagó 11 por una caja de fideos. recomendaría bueno, es realmente bueno cuando estás borracho a las 10 pm, no tan bueno para una buena comida en una cita. Dicho obvio, lo sé.

site_logo

davetrip007 . 2018-12-19

MORE AT TripAdvisor

Ottimo locale in cui gustare un buon pasto a base di noodles, presentato all’interno di un box all’apparenza piccolo, ma molto consistente!

site_logo

fabianstoian . 2018-08-14

MORE AT TripAdvisor

This place is amazing, I love it. Evry Monday I’m your customer for forever👍. The way they do noddles is beautiful, specially the Colombian guy Pablito he is Maestro👍👍👍👍👍

site_logo

GChicho . 2018-08-14

MORE AT TripAdvisor

The food is so bad and quiet expensive and when I returned to the campus far from london I read that add 2£ to the bill it's the action of a thief un voleur.

site_logo

nourbouzlafa45778 . 2018-08-07

MORE AT TripAdvisor

Popped into a wok to walk never been in the uk before however i have been in Amsterdam. The staff memeber was pleasant and helped me create a wonderful box noodles. Quality was good and the turnaround time was very quick. I couldnt ask for much more.

site_logo

Roam793849 . 2018-08-01

MORE AT TripAdvisor

El servicio y la comida era terrible.

site_logo

brittanymar8 . 2018-07-24

MORE AT TripAdvisor

There are only 4 seats so we took our dinner back to the hotel. Everyone got something different. No complaints from anyone. You pick a base - carbohydrate ( rice or noodles). Then pick a protein - one was enough for me, but some chose 2. Lastly, pick a sauce. A few vegetables are included like cabbage. I chose rice noodles, chicken and spicy peanut sauce - delicious. You watch as they cook your meal - it is fast. Meal is served in Chinese take-out container so it is easy to take out and eat out of.

site_logo

VancouverBC10 . 2018-07-16

MORE AT TripAdvisor

I've wanted to try Wok to Walk for months and when I finally came to London I couldn't resist. Assembling your noodles, watching how they prepare them and finally seat in front of the street enjoying your pack of hot flavorful noodles is really a cool and fun experience.

site_logo

ChiLongQua . 2018-06-22

MORE AT TripAdvisor

One of my favourite street food . Good price, good location (next to Oxford Station ) , yummy food by your choice , quick make and hot.

site_logo

Geni4ka . 2018-06-20

MORE AT TripAdvisor

Small stool and bar style eating area. Grabbed a seat to rest a while and eat a fabulous noodle, chicken, veg and sweet and sour quite large portion box prepared while you wait in the flaming wok's.

site_logo

Andrew J . 2018-06-18

MORE AT TripAdvisor

We loved it. So much better than anything I have had in the states. Very quick, small seating area, maybe for 4 people. It was just down the street from the Queen's Theatre.

site_logo

NAVACA . 2018-05-23

MORE AT TripAdvisor

My first time, there was a latin guy worker who recommended me udon noodle + duck + saigon sauce. The food was really good and the attention was excelent. 100% recomendable

site_logo

Adri T . 2018-04-03

MORE AT TripAdvisor

Frash food, great flavour, nice place. You can see them praparing your meal. Great experience. Great to try again.

site_logo

mavjmavj . 2018-02-20

MORE AT TripAdvisor

Great for late night snack chow mien was really good and best of all was the price and the huge portion we got I will be back for more

site_logo

John S . 2018-02-08

MORE AT TripAdvisor

Went there for lunch today and ordered noodles with pineapple and sweet & sour sauce. Unfortunately when I arrived back to my office it turned out that they had added prawns instead of pineapple despite it the order being put in correctly. I didn't have time to go back and ask for a new order and being a vegetarian it was also not a meal I could have so essentially paid over £5 for nothing!

site_logo

Amrkv . 2018-01-19

MORE AT TripAdvisor

Pequeño local a pocos pasos de Picadilly Circus, tiene apenas 4 sitios pero perfecto para llevar y comer en picadilly por ejemplo. Precios baratos, te lo preparan delante tuyo, gran variedad, opciones vegetarianas. Muy práctico cuando estás haciendo turismo.

site_logo

Andrea G . 2017-10-22

MORE AT TripAdvisor

Pretty cheap, tasty chinese food. Watch out for Bangkok sauce it is pretty hot! Prawns and chicken breasts were awesome!

site_logo

Piotr F . 2017-09-23

MORE AT TripAdvisor

Un colega me recomendó este lugar para antes de estar en uno al otro lado de la carretera. Buena - rápido, picantes y unas cuantas opciones para vegetarianos. Tuve huevos, tofu y fideos Salsa de Bangkok.

site_logo

Justin B . 2017-09-15

MORE AT TripAdvisor

Lo normal en este tipo de establecimientos, aunque no es el mejor wok to walk que he probado. Tiene un cristal en el que ves a la persona haciendo tu comida. Todo correcto y económico para salir del paso

site_logo

Evatxu . 2017-09-09

MORE AT TripAdvisor

Vinimos en búsqueda de una cajita de noodles y salimos encantados. El local claramente te marca que la comida es para llevar porque es muy pequeño.

site_logo

Manu P . 2017-08-15

MORE AT TripAdvisor

Fideos de verduras deliciosa y un servicio fantástico y amable. Disfrutamos de nuestra taza de fideos con un ambiente agradable.

site_logo

Chico C . 2017-07-23

MORE AT TripAdvisor

Después de un largo día de turismo y gastar dinero queríamos algo rápido y vegetarianos. Este es ahora el lugar favorito de mi hija.

site_logo

katywanders . 2017-07-03

MORE AT TripAdvisor

Rápido. Barato. Delicioso. La mejor opción para un afterclub ansía con mucho para elegir. La ubicación es ideal, en el centro de la ciudad de Londres, cerca de la estación de metro.

site_logo

Le S . 2017-07-02

MORE AT TripAdvisor

Si alguna vez ves uno. Ir. Es de los más rápido y mejor calidad de comida. No pierda el dinero en basura en el turístico Chinatown o lugares de comida, ir a un Wok para caminar. Es una pena que no tengo estas en Manchester.

site_logo

bmp87 . 2017-06-27

MORE AT TripAdvisor

My sister and I popped in here before an afternoon at the theatre. The staff are friendly and helpful, knowledgeable about their menu, and patient while you decide which of the delicious menu options you want to eat. They advised us on which selections were vegan (my sister is also gluten-free, no problem here!) and our food was freshly prepared for us in minutes. We sat at the little bar in the window to eat and thoroughly enjoyed our meals. There are no tables to eat at, and the bar seats only four people, so that's worth being aware of if you want to eat in. I recommend this place whole-heartedly.

site_logo

vegfoodlover . 2017-06-10

MORE AT TripAdvisor

Me and my wife have been using wok to go every year when in Amsterdam. It's quick, tasty, nutritious and staff always friendly.

site_logo

5Timmyd . 2017-05-24

MORE AT TripAdvisor

We really enjoyed this - loved the variety. Everyone was able to get what they wanted, and it's made quick in front of you. Tight spot to wait as its very crowded inside, but we were only waiting a few minutes. Definitely recommend for a quick bite.

site_logo

4NJTravel . 2017-04-16

MORE AT TripAdvisor

Lovely food and efficient friendly service. The kids enjoyed watching it being cooked. Will definitely visit again

site_logo

Clare M . 2017-04-10

MORE AT TripAdvisor

Por unos 10 euros se comen unos tallarines con verduras, brécol, pollo y champiñones y salsa a elegir, muy rico y se queda totalmente saciado. La atención estupenda. Y lo mejor, te lo puedes llevar y comer en medio de picadilly escuchando la música de los artistas callejeros.

site_logo

Jessi G . 2017-03-30

MORE AT TripAdvisor

muito bem o melhor que já comi sem duvida bem preparado muito rápido e um local bem limpo pequeno e verdade, mas o que verdadeiramente interessa está lá rápida preparação, boa confeccionado, e sem duvida saboroso.

site_logo

Mário L . 2017-03-09

MORE AT TripAdvisor

Very small and busy, but seeing the food cooked fresh right in front of you is a great experience and you feel involved with the process. Food was fresh, tasty and hot.

site_logo

Roland F . 2017-03-08

MORE AT TripAdvisor

I had to try this as I am a big fan of info- Chinese and the preparation completely blew me off! I had the combination of chicken wheat noodles and spicy with cashews and the taste was amazing!You can order it as you like it with various options and yes it's reasonable considering that it's London.Worth the money folks although the place is small to sit down and it but in 0 degrees I stood out sweating due to the spicy sauce and enjoyed every bit of it.

site_logo

mindreadingmystic . 2017-02-12

MORE AT TripAdvisor

locale piccolo ma con tante scelte. i ragazzi sono gentili, disponibili e cordiali. Prezzo ottimo. molto puliti. la classica scatola con cibo cinese ma sembra infinita per quanto colma. volendo si può mangiare anche all'interno del locale.

site_logo

735rol . 2017-01-04

MORE AT TripAdvisor

The food is prepared in front of you and you cannot see everything being put in. It's reasonably priced and the food is amazing.Pop in if you are nearby!

site_logo

Erik I . 2016-12-12

MORE AT TripAdvisor

Miglior posto per prendere noodles da asporto. Noodles con i gamberetti ottimo, personale disponibile e cortese. 2 minuti da poccadilly. Ottimo per una pausa veloce tra uno shopping e L altro.

site_logo

alexdeo7 . 2016-12-05

MORE AT TripAdvisor

consiglio... sono stati molto veloci per la preparazione e la qualità è buona. Il prezzo è ottimo. Ed è possibile mangiare il piatto anche fuori perché il piatto viene messo dentro un contenitore di carta ed è comodissimo. In 5 giorni che siamo stati a Londra , 2 volte abbiamo mangiato li e ci siamo trovati benissimo. Offrivano una vastissima scelta di condimenti per il piatto e moltissime salse.

site_logo

Vitto1995 . 2016-11-19

MORE AT TripAdvisor

Las porciones son abundantes, la comida se sirve en cajitas y se puede optar por comerlo con tenedor o palitos.Se puede comer arroz o variedades de fideos (de huevo, de arroz, etc).El wok básico es económico y abundante, si no se quiere gastar con eso esta bien. Después si quiere, se puede agregar otros complementos a gusto que cada uno tiene un precio diferente, por ejemplo camarones, tofu, pollo, etc.Finalmente se elige un salsa. Cuidado que no sea muy picante.Es una opción sana dentro de lo que es comida rápida, y una excelente variante para no caer en los clásicos hamburguesa y pizza.Hay locales en muchos puntos de la ciudad. Son pequeños y no es fácil conseguir lugar para sentarse.

site_logo

tingarcia10 . 2016-10-30

MORE AT TripAdvisor

Went for a quick lunch and £8 later I was bitterly disappointed.theres was absolutely no taste from any of the ingredient I chose Including the sweet and sour sauce....never again.yet the one that used to be in brewer st was great

site_logo

Colin R . 2016-10-17

MORE AT TripAdvisor

i love this place!for quality and price probably one of the best restaurant/take away in town!recommend

site_logo

A TripAdvisor Member . 2016-09-17

MORE AT TripAdvisor

Restaurant rapide, nourriture très bonne en revanche les portions sont assez petites je ne sais pas si ils proposaient des tailles differentes.

site_logo

Louismichelin . 2016-07-18

MORE AT TripAdvisor

OK, let's start correcting Tripadvisor's scale. This isn't Very Good it's Good (but can't put average either it's way above that).That said, as others have commented, this is true fast food, cooked to order with good ingredients.My problem is with their pricing. Whilst you can have, like I did, the vegetable dish & sauce at £3.95 (which is a pretty good deal and if you pick the correct sauce, entirely Vegan & Gluten Free) it quickly adds up when adding ingredients - suddenly making it less priced like Fast Food and more like Michelin Starred Haute Cuisine.But it's open until past midnight (1am) in the week and closes at 11pm on a Sunday (Unbelievably this is one of the later offerings in Soho on a Sunday) - so there's no excuse to go to McDonalds a few doors around the corner.It's healthy food in a healthy portion. Just watch those add ons, if it breaks a £10 it's just not worth it.

site_logo

AtLondonersLondon . 2016-07-18

MORE AT TripAdvisor

Opção de comida rápida e deliciosa!!! Os atendentes são em rudes e estressados, mas ok, a comida é uma delícia. Melhor fast food que já comi. Esse WTW no Soho é bem apertadinho e tem poucas mesas. Melhor pegar pra levar.

site_logo

Nathalia R . 2016-07-03

MORE AT TripAdvisor

Good selection of Asian dishes which are cooked , with fresh ingredients, to order. Choice of ingredients and sauces that can almost give you a bespoke dish. Reasonable professor for location and quality of ingredients.

site_logo

Paulsmithcasty . 2016-06-11

MORE AT TripAdvisor

Really good and tasty Chinese-style fast food. The food is cooked while you wait in a couple of minutes so it is genuinely fast food and always piping hot and fresh. Obviously it's street food, so don't go there for a gourmet meal. But if you want fast, reasonably priced, tasty, filling food then it's really good.There's a good choice of noodles, rice, brown rice, etc, and then you choose whatever meats, vegetables and toppings you want and a variety of sauces too so you can pick and choose and it's easy for anyone with intolerances, vegetarians, etc.They really need more room - it's a tiny little shop with only three seats. Not quite sure why they always have a security guard standing in the limited space, but it doesn't help.Overall, very good for fast food at a reasonable cost, and it's always fast and fresh and tasty.

site_logo

GF_Gavin . 2016-05-29

MORE AT TripAdvisor

the food was made to order with many different options to choose from. tasted great with lots of flavour. generous portion aswell

site_logo

KAYLONDON88 . 2016-05-23

MORE AT TripAdvisor

Great food, great price, super location at entrance to Carnaby St.!Staff were conscious of vegetarian precautions, service was fast, and the few tables streetside cleared quickly. Meal quantity, quality and temperature perfect. Best street food ever!

site_logo

Frank I . 2016-05-20

MORE AT TripAdvisor

Ottimo fast food!Tanta scelta per dei noodles d'asporto. Fantastiche le salse piccanti!Quando si è di fretta è il migliore.

site_logo

federico_labzona . 2016-05-15

MORE AT TripAdvisor

Egg noodles with chicken and hong kong with fried garlic and fried onions is the best combo i have ever tried. Portions are good aswell.

site_logo

BillyWoods74 . 2016-05-04

MORE AT TripAdvisor

Don't expect gourmet asian food because if you you're a fool. Its essentially fast food. However, it always tastes good but maybe that because I'm often drunk when I eat it, however, I go here sober too. Great selection, good portion sizes and what you would expect to pay in London. Its tasty do it. I like this one because its fun to watch the men across the road debate whether they should or shouldnt go into the strip club!

site_logo

LEONTOKYO . 2016-04-15

MORE AT TripAdvisor

the last time i had woktowalk noodle was in cardiff, where everything is halal in the menu. today i had their noodles for lunch in London (Soho). they told me everything is halal, even showed me the halal certificate. convinced by this, I straightaway ordered chicken noodles without looking at the menu (as i always had them in cardiff branch) when in fact they do serve pork and use the same wok for every menu! (only realized this at home) be careful!!

site_logo

Diyanah H . 2016-04-02

MORE AT TripAdvisor

האוכל טעים, טרי ונקי. ההכנה מהירה ואף פעם לא התאכזבנו מהרשת הזו. ולכן אנחנו תמיד חוזרים אליה, לא משנה אם זה בברלין, אמסטרדם או לונדון. חבל שאין גם בישראל...

site_logo

jmichael2015 . 2016-03-25

MORE AT TripAdvisor

Delicious, made in front of you, great choices, nice and fast. The peanut based satay sauce is delicious.

site_logo

lu1820 . 2016-03-10

MORE AT TripAdvisor

The best noodles i have ever had and it is extremely affordable too, i have had their egg noodles with garlic and pepper sauce and it was fantastic and will surly recommend everyone to try them

site_logo

mukundasher . 2016-03-04

MORE AT TripAdvisor

Siamo passati quì quasi per caso dopo una giornata in giro per Londra cercando un posto in cui mangiare spendendo poco a Soho.Anche solo i noodles basici da 3.95£ saziano alla grande, volendo si possono aggiungere fino a 4 altri ingredienti tra cui pollo, manzo e verdure per soli 2£ circa.Personalmente consigliamo gli udon noodles con salsa teriyaki, davvero eccezionali! Attenti alla hot asia, davvero molto piccante!Insomma, locale carino e, a suo modo, accogliente con la tavolata che da sulla strada, noodles buonissimi e prezzi contenuti

site_logo

Andrea T . 2016-01-25

MORE AT TripAdvisor

Excellent Chinese food. Inexpensive, quick and order taken with a smile. Value for your £. Eat here if you are in a hurry or just simply want to eat something delicious - definite comfort food!

site_logo

A TripAdvisor Member . 2015-12-20

MORE AT TripAdvisor

This small talk away with sitting capacity of just 6 people is steps away from Piccadilly Circus (purple line) tube station exit.If some one in your group does not fancy noodles, Mc Donald is opposite to it.So you walk in and the menu is very self explanatory. You choose your base, rice or noodle, which is 3.95 and then you can add maximum 4 additional toppings to taste it up plus one extra and then sauce. All items cost you separately but if you are hungry and love the taste you will end up paying about eight quid for nice chilli steaming noodles.There is no parking around. Never even think to take car there. The shop is really small so you need to leave your wheel chair or buggy on pavement or opposite to shop there is bit of space.Enjoy the Yummy Noodles.

site_logo

KH4KI . 2015-12-07

MORE AT TripAdvisor

한식이나 면 요리가 땡길때 방문할만합니다. 가격이 저렴해서 부담없이 방문하면 좋습니다. 공간이 조금 좁은게 흠입니다만...

site_logo

winter1003 . 2015-12-02

MORE AT TripAdvisor

I can't go to London without having a wok to walk! If i lived near a wok to walk and have one everyday. You choose a type of noodle, toppings (broccoli, tofu fc) Then a sauce. Costs about 6.50 and taste so good!

site_logo

Jason F . 2015-11-22

MORE AT TripAdvisor

Achei delicioso!! Fresco e saboroso!!!! Melhor comida rápida que comi até hoje!! Recomendo!!! Espaço pequeno, porém vale a peba!!!

site_logo

Daniela B . 2015-10-26

MORE AT TripAdvisor

Io ne sono completamente innamorata! È già accattivante il fatto di poter vedere il piatto scelto come viene cucinato, poi i sapori e le spezie.Grande box quello con il riso, il pollo e i gamberi con medio piccante. È la terza volta che lo provo, nella terza città in cui l'ho trovato. Ma non mi stancherò mai di cercarlo e riprovarlo xD

site_logo

Soniaferdi . 2015-08-25

MORE AT TripAdvisor

AWESOME! super fast and really great food! highly recommend! especially for those who are not a huge fan of the food in England!

site_logo

Lauren P . 2015-08-21

MORE AT TripAdvisor

Had to try after so many people recommend it to me, the service is very good got some help from the cashier what to choose, watched my meal cooking in front of my eyes what else you can ask for?my meal was really good, thick udon noodles with beef, cashew nuts, broccoli and peanut sauce with extra peanut as topping.pure pleasure.

site_logo

elad s . 2015-08-16

MORE AT TripAdvisor

Los woks son excelentes y baratisimos. Lo unico es que en gral tienen muy pocas mesitas y uno tiene que llevarlos y encontrar donde comerlos

site_logo

Catalina R . 2015-08-11

MORE AT TripAdvisor

Tout près de Piccadily, ce restaurant vous servira une boîte en carton bien remplie : riz, pâtes. En accompagnement : boeuf, poulet, porc, légumes.Puis on choisit une sauce.Prix : environ £7 avec une boisson.Rapide et sympa et bon !

site_logo

FREDERIC D . 2015-08-04

MORE AT TripAdvisor

Alapvetően elvitelre specializálódott ázsiai wokos étterem. Az össztevők (risz, tészta, rizstészta alapra különböző húsok - szószok - zöldségek - magok....)összeválogathatók, és londoni mértékkel számolva megfizethető áron lehet gyorsan, finomat enni. Az étterem nagyon kicsi, leülni nem igazán lehet, és ha többen érkeznek egyszerre, akkor akár 5-10 perces várakozásba is be lehet futni. Mi kétszer ettünk itt a londoni tartózkodásunk során, és mindkétszer hozta az elvárt szintet.

site_logo

greatpeti . 2015-07-15

MORE AT TripAdvisor

Mai mi Sarei immaginata di trovare un posto cosi. Piccolo stanzino nel cuore di Londra dove al momento vengono cucinatoi dei buoni noodles! Li fanno al momento solo per te con gli ingredienti che vuoi. é Bellissimo guardare le acrobazie del cuoco finché fa saltare questi spaghetti nella wok. Wow!

site_logo

TheHungryPrincess . 2015-05-24

MORE AT TripAdvisor

Hop in and you can choose different kinds of wok dishes.Easy, fast and good for a quick bite during your in london.Not expensive.

site_logo

Daniel19721972 . 2015-05-07

MORE AT TripAdvisor

Very good, tasty food to grab on the go whip you're running around in the city. Always very packed so space is the only thing that can be a bit of an issue.

site_logo

Elina L . 2015-05-03

MORE AT TripAdvisor

This is a nice restaurant for a lunch break in the lively Soho. A choice between rice and different types of noodles, diffent kind of meat, all flavoured with a selection of tasty and tempting sauces.

site_logo

saradr85 . 2015-04-30

MORE AT TripAdvisor

Ambiente piccolo, pulito e abbastanza ordinato.Fornelli a vista, così si puo' ammirare/controllare l'operato del cuoco.E' possibile "formare" il proprio pasto, si parte dal tipo di spaghetti (udon, noodles...) al condimento!Gli udon al curry sono il top!I prezzi sono contenuti e permettono in base alla scelta un pasto abbastanza economico per gli standard londinesi.

site_logo

Shantykisianu . 2015-04-18

MORE AT TripAdvisor

Similary restaurants in London

restaurant_img
4.0

6 Opinions

location-icon153 Knightsbridge
Asian
outdoor_seating_109737takeaway_109737delivery_109737

El restaurante Pan Asian ya no existe y cuando llamas a este número para hacer una reserva, la señora levanta el teléfono y finge que te reservará. Pero, por desgracia, ella no precisa que este no es el restaurante tailandés que está buscando. Crees que hiciste una reserva en un restaurante tailandés, pero en realidad no hay ninguna reserva.Esto es frustrante y no muy agradable para el nuevo propietario con el que tuvimos la mala suerte de conocernos y que no fue nada agradable. Mala experiencia en la noche del sábado especialmente para el cumpleaños de nuestro hijo de 14 años. Por favor, el equipo de Tripavisor cambia esta página lo antes posible. Gracias.

restaurant_img
4.0

6 Opinions

location-icon13-17 Norfolk Square
Asian
outdoor_seating_74792takeaway_74792delivery_74792

El 20 de julio entramos en el hotel a las 16h, la entrada era a las 14h. Nos dicen que no está preparada, sin ninguna disculpa, nos dicen que dejemos el equipaje y luego lo suben, así lo hicimos y vimos que lo dejaban en el pasillo. Eso nos intranquilizó. Cuando llegamos a la habitación, el cerrojo de la puerta no funcionaba, las ventanas no cerraban bien y se oía todo el ruido de la calle. Menos mal que sólo era una noche, que noche tan horrible.

restaurant_img
4.0

8 Opinions

location-icon104 Shaftesbury Ave, London W1D 5EQ England
Asian
outdoor_seating_247636takeaway_247636delivery_247636

As it says in the title, this is the place to bear when it comes to authentic and deliciously made bubble tea. The service is always fast and I don’t think I can emphasise just how wonderful the drinks are. You get a lot of drink for what you buy plus there is just something special about the presentation of the drink and the way it is made that stays in your mind long after you finish the bubble tea. I particularly recommend the fruit teas, with some drinks it comes with fresh fruit in the drink that you can eat after! Always refreshing and sweet

restaurant_img
4.0

22 Opinions

location-icon58-59 Great Marlborough Street
Asian
outdoor_seating_112463takeaway_112463delivery_112463

una búsqueda de TripAdvisor para las nuevas lleva el nombre de Ran, el anterior restaurante coreano en esta dirección. Espero que esto pronto será corregido, porque Bibigo merece un gran éxito. Comimos esa deliciosa comida en el almuerzo del domingo que volvimos para una cena tarde la misma tarde (no recuerdo haber visto haciendo que antes en Londres). El precio fijo almuerzo con menú @ £9 y la noche uno @ £12 son excelente relación calidad-precio - eso es lo que elegimos - o hay una más amplia y más costoso menú completo. Nos gustó mucho conocer el joven y entusiasta director, Sr. Lee, que es un gran embajador Bibigo y nos alegramos de su asesoramiento sobre qué escoger. A la mayoría de los grupos no contenía al menos uno coreano - un reflejo de la calidad y la autenticidad de la cocina pero probablemente también de el desconocimiento relativo de los platos para los ingleses. Sospecho que esto cambie pronto y esa cocina coreana se convertirá en el siguiente gran historia. era tranquilo durante nuestras visitas domingo pero estoy seguro de que el tradicional coreano cordial que elevará el ambiente en horas punta, especialmente cuando el soju fluye! Muy recomendable.

restaurant_img
4.0

3847 Opinions

location-icon10 Grosvenor Square, London W1K 6JP England
Asian
outdoor_seating_246828takeaway_246828delivery_246828

Delicious breakfast and amazing service from our waitress Mafer. Our English level is very low and she explained the menu for us in spanish. We would definitely go back to the restaurant if we go back to London, so we can start the day with a delicious breakfast at this restaurant