GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
3.5

Based on 2.824 opinions finded in 4 websites

site_photo4

Nº 592 in 792 in Bournemouth

Nº 12 of 13 Japanese in Bournemouth

CUSTOMERS TALK ABOUT DISHES WITH..noodlessquidricecookedpayprawnsramenoldchillicurryduckprawnchickengingersteakspicyfried

comment_iconOpinions

Un gran lugar situado en Bournemouth y un buen ambiente. La comida es genial y bien cocinado con una alta calidad, sin embargo, este restaurante una vez a un precio razonable se ha vuelto poco a poco bastante caro con los años si se agregan lados. Merece la pena una visita y siempre fiable

site_logo

RealityCheck2013 . 2025-04-20

MORE AT TripAdvisor

We were the only people in,and suddenly, the place was buzzing. The service was excellent. The food was really tasty. It was good to see people enjoying themselves here.

site_logo

Eileen Collier . 2025-03-12

MORE AT Google

Food was excellent, service was fantastic.

site_logo

Chris Greenhough . 2025-03-11

MORE AT Google

One main and one starter came, then half way through the other starter and main arrived. Food was not very warm or nice.

site_logo

Donna Roberts . 2025-03-08

MORE AT Google

Arrived at roughly 8.30pm, was sat down staffed cleaned around us, starters and my boyfriend’s main arrived before our drinks. My food then arrived and was wrong, without the waitress talking to me she took the food away without asking me. They then continued to clean around us whilst I sat and watched my boyfriend eat his food, he had finished his food and then my food arrived. Baring in mind it was late and the restaurant was very quiet for this level or service.My boyfriend then asked to pay, the waitress then walked away mid transaction. This was an awful experience and I would not be recommending this to anyone!!

site_logo

Jade Luke-Eardley . 2025-02-24

MORE AT Google

Excellent meal. Lots to choose from. Not cheap but well worth it

site_logo

Ellard Roberts . 2025-02-18

MORE AT Google

Estoy libre de gluten y el gerente (hombre) vino a tomar nuestro pedido, él era absolutamente brillante y también hizo mi plato a medida, ya que tenía otro requisito. Él me hizo sentir cómodo y era tan amable! Todo el mundo realmente disfrutó de su comida y la comida era deliciosa! Muchas gracias, sin duda volveremos!

site_logo

Superboo698 . 2025-02-17

MORE AT TripAdvisor

Me gustaría dar las gracias a todo el equipo. Mi pareja y yo fuimos a comer para San Valentín y nos recibieron con una cálida bienvenida. El restaurante estaba lleno, así que tuvimos que esperar unos minutos para sentarnos, pero el personal era muy atento y rápido para despejar las mesas. A pesar del hecho de que estaba tan ocupado constantemente, se tomaron el tiempo para registrarse y asegurarse de que todo estaba bien. La comida estaba en el lugar y debo decir que estoy muy impresionado con los chefs teniendo en cuenta la presión que estaban bajo. Muchas gracias a todos por una noche encantadora x

site_logo

AnniceCallaghan . 2025-02-14

MORE AT TripAdvisor

¡La comida en Wagamama siempre es tan buena! Los servidores estaban atentos. Útil que ahora puede pagar usando la aplicación en lugar de esperar a una máquina de tarjetas.

site_logo

Shimmer26 . 2025-02-12

MORE AT TripAdvisor

Queued to get in and when we did get a table we found the fixed tables and benches hard to get on. The food when it arrived was tasty but the three items we ordered all came at different times and had to wait longest for the simplest dish. They expect you to pay at the table but due to the design of the building there isn't a phone signal at the back of the restaurant.

site_logo

Red Vee . 2025-02-09

MORE AT Google

Afternoon lunch with friends, really good food and lovely service from Rebecca.

site_logo

Craig Waters . 2025-02-08

MORE AT Google

It was really busy and had to queue to be sit down as we didn’t book but it was worth it and the food was great. Had a problem with a payment on their machine and the staff were lovely and helpful.

site_logo

Grace Chappell . 2025-02-08

MORE AT Google

Honestly the most amazing staff, I dropped £20 and they kept safe and gave it back to me when I came back, such lovely staff!!

site_logo

Lois McGuire . 2025-02-05

MORE AT Google

Really lovely food and service… everyone was so nice!

site_logo

Amit Sharma . 2025-02-03

MORE AT Google

Great food and lovely service. Our server Adam was really friendly and helpful with our orders

site_logo

Caitlin Firth . 2025-01-26

MORE AT Google

Great food, great service, thanks Adam for looking after us so well

site_logo

Christopher Guillebaud . 2025-01-26

MORE AT Google

Reece era nuestro servidor y era tan atento y divertido, gracias. Vinimos el miércoles 22 a la hora del almuerzo y el chef también fue súper servicial a las modificaciones que pedí en mi plato e hizo una de las mejores sobas de bistec teriyaki que he probado en un Wagamama’s! Voy a Wagamamas MUCHO, y estos dos trabajadores son F A be! Gracias : )

site_logo

Anna . 2025-01-26

MORE AT TripAdvisor

Adam was amazing ! Very kind !

site_logo

Kyloren09 . 2025-01-26

MORE AT Google

Absolutely brilliant, great atmosphere and amazing food and staff. Served by Adam and he was absolutely amazing!

site_logo

Josh Adams . 2025-01-26

MORE AT Google

Adam was the best server i have had a wagamamas. He was so charismatic and funny. This guy makes me want to come back every time.

site_logo

Katie Parker . 2025-01-26

MORE AT Google

Adam. Handsome and charming. Great service

site_logo

Lee Williams . 2025-01-26

MORE AT Google

Adam was amazing !! very kind!!

site_logo

Shaddow . 2025-01-26

MORE AT Google

Food was amazing. Atmosphere was relaxing and welcoming and adam our server was the best part

site_logo

Ted Dawson . 2025-01-26

MORE AT Google

We had ramen and noodles, and both were delicious. Also, the service was excellent. The only drawback is the queue to get in. People queueing outside is a common occurrence.

site_logo

Krzysztof Mroczkowski . 2025-01-24

MORE AT Google

Friendly, knowledgeable and helpful staff. Extremely tasty food. Great location.

site_logo

Olga Olga . 2025-01-23

MORE AT Google

Experiencia extremadamente decepcionante: mala gestión y servicio Estoy profundamente decepcionado de escribir esta opinión, especialmente porque he tenido muchas experiencias maravillosas con Wagamama en el pasado. Sin embargo, mi reciente visita a su sucursal de Bournemouth fue totalmente inaceptable, y me siento obligado a destacar varios problemas flagrantes que necesitan atención inmediata del equipo directivo. Visitamos durante la promoción Ramen Rush, llegando unos 30 minutos antes. En lugar de permitirnos sentarnos y pedir bebidas o entrantes mientras esperábamos, el personal insistió en que nos paráramos durante 20 minutos. Cuando pregunté por qué no podíamos sentarnos, la excusa dada fue que el equipo estaba demasiado “abrumado”. Esto era descaradamente falso, ya que el restaurante estaba medio vacío y varios miembros del personal estaban visiblemente de pie charlando. La falta de profesionalidad y cortesía en este caso fue extremadamente frustrante y marcó el tono para el resto de nuestra visita. Cuando finalmente nos sentamos, mi compañero pidió un jugo tropical grande, que fue un completo desastre. Lo que llegó fue un líquido marrón separado, poco apetitoso, con un lodo espeso en el fondo, claramente dejado sentado en la barra demasiado tiempo. Para empeorar las cosas, el servidor erróneamente puso a través de dos jugos en lugar de uno, un error que capturé solo revisando la aplicación. Los entrantes que pedimos fueron el único aspecto positivo de la comida — servido con prontitud y delicioso. Sin embargo, el resto del servicio fue terrible. Un miembro del personal, un hombre alto con un moño desafortunado, merece mención específica. Su actitud desdeñosa y grosera nos hacía sentir como una carga cada vez que planteábamos preocupaciones. Después de esperar 50 minutos inaceptables para nuestros ramenes, cortésmente señalé el retraso a su atención. Su respuesta brusca —achacando el problema a tener solo dos chefs en la cocina— fue poco útil y poco profesional. Si la gerencia sabía que esta promoción aumentaría la demanda, ¿por qué demonios no rotarían chefs adicionales durante las horas pico? Esto apesta a mala planificación e incompetencia en el nivel directivo. Para añadir insulto a la lesión, 20 minutos después de comer nuestros entrantes, el servidor volvió a preguntar si habíamos pedido ramenes y de qué tipo, revelando que se había olvidado de hacerlos pasar en primer lugar. Una vez más, esto refleja la terrible gestión y la falta de capacitación adecuada del personal. Cuando nuestros ramenes de pollo finalmente llegaron, eran terribles. El pollo estaba seco y empapado al mismo tiempo, completamente sin condimentar y nadando en fideos suaves y acuosos. Dado que estos platos formaban parte de una promoción, nos abstuvimos de devolverlos, pero la calidad era inexcusable sin importar el costo. Además, el mismo funcionario grosero me hizo sentir tan incómodo durante la interacción anterior que me mostré reacio a plantear mis preocupaciones nuevamente. En general, esta experiencia fue un fracaso absoluto en todos los niveles: un servicio deficiente, una gestión incompetente y una alimentación deficiente. El hombre con el desafortunado peinado, en particular, demostró una grave falta de habilidades de servicio al cliente, lo que hace que lo que debería haber sido una visita agradable sea innecesariamente estresante. Si bien he tenido experiencias positivas en la sucursal del Southampton, no regresaré a Bournemouth pronto. La administración debe asumir la responsabilidad por estos problemas y proporcionar la capacitación adecuada a su personal, o corren el riesgo de alejar a los clientes leales. Espero una pronta respuesta del equipo directivo que aborde estas preocupaciones. La falta de respuesta adecuada no me dejará más remedio que intensificar mi queja.

site_logo

Yasmine W . 2025-01-20

MORE AT TripAdvisor

It's really great for eating with my toddler, as food comes out quickly.

site_logo

Carley Sen . 2025-01-19

MORE AT Google

Me and my friends came for a meal here and we were greeted and seated quickly, our food was impeccable as always and I wanted to say how lovely the service was from Nidia, we absolutely loved her and want her to know how amazing she is! Thank you Nidia & everyone at Wagamama Bournemouth for a wonderful experience 🫶🏼

site_logo

Hermione Ekkes . 2025-01-12

MORE AT Google

Love this place. Came in yesterday with my partner and we had a lovely server called Rhiannon? Superb service with constant checkups and super helpful when the app got confusing. The atmosphere is amazing everytime we go and the food has never once been bad, sides coming out 3-5 minutes in, and the mains coming out in 10. Overall costed around 50 for me and her, but honestly always worth it nevertheless. Thank you!

site_logo

Lukas Barr . 2025-01-03

MORE AT Google

To start we had duck bao buns which were dry and we had to wash down with a drink. For main I had katsu curry and the chicken was overdone and was like crispy cardboard. My partner had the steak teryaki noodles. They were flavourless, the beef was dry and chewy but unfortunately we'd already used our drink to wash down the bao buns. During our meal we were not checked on once. I don't expect to be waited hand and foot at a wagas but at least check on our meal once? If they had asked i would've shared my thoughts on the food and hoped they could rectify. I wish I could just complain about the food but the service wasn't great either. Once we had finished our meal we sat there with our plates to the side (quite obviously that we had finished) and no one came to ask if we wanted deserts or the bill. Instead we had to get the attention of someone else who wasn't even our waitress. Finally, she came over with the bill and while we were paying, a waiter interrupted us and got in the way of us paying as he cleared our plates. Why didn't he just wait till we had gone? The final straw was when we left and weren't even acknowledged as we left. As soon as I left i stopped at the mini mart to buy a chocolate bar to get the taste of disappointment out my mouth. Thanks Wagas can't wait till tell my nan the gift card she bought me was wasted. 0/10 will never come back.

site_logo

Peter . 2024-12-31

MORE AT Google

Always enjoy a Wagamama but that doesn’t always mean they are the same,fortunately Bournemouth restaurant is up there with the best.

site_logo

George Boothroyd . 2024-12-31

MORE AT Google

First visit for me and my partner and sadly came out feeling we just experienced an Asian style fast food restaurant, that comes with a high bill. I have eaten better ready meals from some supermarkets to be honest. Be warned, the font of parts of the menu is tiny and with the dimmed lighting I needed help from my daughter to read it for me (I'm in my late forties occasionally needing glasses for reading). Service was minimal, order was taken, follow up with a standard 'is everything ok?' and that's it! Nobody asked if we wanted more drinks, the glasses were swiftly taken away once they got empty. Some of us were still eating and my partner would have another pint of lager for sure, we were not offered to order desserts either. Food started arriving within minutes, sadly at different times. I was the last one to be served. At some point I was offered dishes from other tables, even the staff looked confused. I had Yasai katsu curry with brown rice. There was way too much rice and not enough sauce (that looked like it came from a carton or was instant) for my liking. 4 slices of veg in breadcrumbs and some salad on the side, missing pickles or dressing. My partner had a duck donburi bowl. He really enjoyed it, especially the meat, again lots of rice in the bowl. My daughter had grilled chicken ramen, the broth was very rich and salty. She enjoyed the meat and managed some noodles as there was way too much for her. On reflection we might go back, but with the experience, we will definitely customise our dishes (lighter broth, more protein, less rice/noodles). It would be nice if the waitress made us aware of such a possibility. Once again... the menu is not easy to read

site_logo

Patricia S . 2024-12-30

MORE AT Google

First thing's first- MASSIVE shout-out to Alexandra who provided flawless service throughout the meal. Did a great job making us feel comfortable and was extremely attentive, especially to our 19 month old who could not consume the rice fast enough. She even gave her a free kids meal as part of the Xmas giveaway they are doing, so our bubba tried some pickles and some carrots, all of which went down a treat. It was a quiet time and the atmosphere was great, super chill - but having a server that goes the extra mile really makes the experience 5 stars all around.

site_logo

Bex Grant . 2024-12-13

MORE AT Google

Faultless Wagamama’s 🍜 The best Wagamama’s in the South! Was well and truly wowed by Wagamama’s Bournemouth! It has all the standard bells and whistles of a usual Wagamama’s however the service at this particular franchise was faultless! Partner this with hot fresh food (despite a particularly busy service) and an atmosphere unlike any other Wagamamas with its neon red indoor lighting! Would absolutely recommend this restaurant and I cannot wait to return! 🌟 Recommendations: Ginger chicken Udon noodles, chilli and garlic edamame beans 🫛 Prawn crackers ( a surprise star 🌟 ) ⛔️ Drawbacks: busy! Cannot pre book📖 🦑 Squid Rating: 8 🌅 Instagram - The Calamari Game 🌟🌟🌟🌟🌟 / 5 Stars

site_logo

Daniel Wood . 2024-12-07

MORE AT Google

Eat in or take out, absolutely fantastic!!

site_logo

Matt Ballard . 2024-12-04

MORE AT Google

The food was sooo good I completely forgot to take photos! Tiana was looking after me during my visit and she was incredible! She recommended a couple of dishes to me which I politely declined and order the Katsu chicken curry dish and it was DIVINE! Atmosphere was perfect due to the time of day around 4pm so wasn’t too busy! Props again to Tiana and I hope management sees this and lets her know how awesome she was! Will be stopping again soon!

site_logo

Robert Lea . 2024-12-03

MORE AT Google

It's not the sort of place I would normally go and I'm not used to the food. It's good, but not for me.

site_logo

Lynette “Netty” Crellin . 2024-11-28

MORE AT Google

Food was OK. Restaurant was very busy but service was very good and food was promptly served.

site_logo

Jimmy Prouty . 2024-11-27

MORE AT Google

We were quickly given a seat and our food was delivered quickly. It looked and tasted delicious. Staff were very polite, the atmosphere felt great and everything looked clean. No complaints

site_logo

Ben Hunter . 2024-11-27

MORE AT Google

Mary and Isobel gave amazing service!! Made sure we we're happy and got everything on time and drinks were really good! Would recommend!

site_logo

Jet Cruz . 2024-11-26

MORE AT Google

I had an exceptional dining experience, with delectable cuisine and attentive service provided by Isobel and Mary. The overall ambiance and quality of the food made it a memorable occasion. I highly recommend this establishment for a memorable dining experience.

site_logo

Angel Tanner . 2024-11-25

MORE AT Google

We had a lovely meal at this Wagamamas. We came on a Saturday and it wasn’t too busy. My boyfriend has a peanut allergy and it was dealt with very professionally by the manager. The food was amazing, I recommend the shredded duck soba noodles and the basque cheesecake. Can’t go wrong with a Wagas 🕺🏻

site_logo

Kate . 2024-11-23

MORE AT Google

Very good selection of food, the service is very nice. The ambience is not as great as in a hall. Price performance is completely okay.

site_logo

Angelika Arnold . 2024-11-04

MORE AT Google

Over priced poor quality food, portions do not reflect the prices they charge. Waitrose do a much better katso children curry and sobo noodles which you can buy in supermarkets at less than half the price you pay there. Will not recommend to anyone and certainly will not be returning 🙂

site_logo

Debra Curtis . 2024-11-02

MORE AT Google

Our table service staff today, Rebecca and Barnaby were brilliant. The food is always amazing. Really enjoy it

site_logo

Josh Palmer . 2024-10-27

MORE AT Google

Lovely visit, teriyaki soba was fantastic and Rebecca was a lovely waitress

site_logo

Dom Young . 2024-10-26

MORE AT Google

Wagamamma has always been my favourite restaurant, up until very recently. They have changed the recipes for many of the dishes and they are awful. My favourite dish is the kare burosu ramen in broth, it used to have udon noodles and now they have changed the noodles which are horrible and difficult to actually pick up! They have also removed half the ingredients and broth, so it was essentially a bowl of horrible slippery flat noodles and nothing much else. They have also changed their pad thai and many others for the worse. I'm gutted as they've lost a very loyal customer, who probably ordered weekly and spent a lot of money.

site_logo

Toby James . 2024-10-25

MORE AT Google

With kind, attentive service, we arrived at the most delicious dishes. The exciting Asian flavors made the delicious snacks even more varied.

site_logo

Tamásné Csorba . 2024-10-24

MORE AT Google

Wagamama is consistently good. I was greeted quickly at the door and drinks arrived a couple of minutes after ordering. The food arrived quickly, well presented and tasted great. The little basket of sauces was not on my table so I grabbed one from another table. No problem, it was 9pm and staff were all working hard cleaning. Staff were all lovely and very efficient. From arriving to leaving was around 30 minutes, perfect! Hot honey chicken +yuzu sauce: new dish, sticky, crispy chicken tasted great with nice texture. Yuzu (citrus) sauce went well with the chicken. Chicken teriyaki soba: always good but can be a little bland so I add soy and chilli sauce. Wagamama feels like a healthier option that other options in most big towns/cities, not that I care about calories. I just want good food quickly when dining alone.

site_logo

Matthew . 2024-10-23

MORE AT Google

Food,team and service are always nice!

site_logo

Diana Serpenskaite . 2024-10-19

MORE AT Google

we had an amazing time at wagamamas! we were served by the lovely alex who was friendly and accommodating to our needs, she was wonderful 😊 she made sure our drinks were always full and that the food was satisfactory (which it was!) and was very lovely and chatty. my boyfriend and i eat at wagamama’s often and have always been satisfied as the food is always excellent, as is the service - but we must give alex one last mention, she is fab 😊🫶🏽

site_logo

sophie . 2024-10-10

MORE AT Google

Everything was perfect, service was so speedy and the food tasted amazing as usual. Alexandra served us, she was so friendly and helpful with our orders, making sure we had everything we wanted throughout our night, a very genuine person. Would absolutely recommend

site_logo

Alex Legg . 2024-10-10

MORE AT Google

A large Wagamamas close to the pier on Bournemouth sea front. The usual, reliable menu and service. We were late (9pm) on a Thursday night and the weren’t many other diners so the atmosphere was a bit flat. The waitress recommended that my dining companion changed his order as ‘we’ve had so many complaints about that dish we’re taking it off the menu’ which was a bit odd. He changed his order!

site_logo

Andy Reynolds . 2024-09-29

MORE AT Google

Overall a great experience! Food was great, staff was friendly and helpful, and tables were clean and tidy. I recommend the squid starter 👌

site_logo

David Kleinovas . 2024-09-27

MORE AT Google

If you struggle sitting on a hard wooden bench I would recommend either bringing a cushion from home or one of those fold-away camping chairs. Getting a booth may also be a good shout unless you enjoy that genuine refectory style of eating which was prominent in the mid 1970's.

site_logo

miles spencer-shaw . 2024-09-21

MORE AT Google

Great experience at Wagamama’s Bournemouth , always good service ( attentive but not overbearing ) great food as per usual , would recommend the Tama Squid and Bang Bang cauliflower along with Firecracker Prawn ( also tofu and chicken option I believe ) will being going back soon to try some of the other new dishes . Thank you Wagamama for a great experience A*****

site_logo

Andy C . 2024-09-18

MORE AT TripAdvisor

Boyko and Marco is very friendly, kind and good with customer service.

site_logo

Melanie GUBI . 2024-09-01

MORE AT Google

Yet another happy wagaxperience!

site_logo

Olivia Broome . 2024-08-30

MORE AT Google

Outstanding restaurant with the kindest staff. 10/10.

site_logo

Tom Smallman . 2024-08-30

MORE AT Google

Food and service was great and so was Savannah.

site_logo

Gabriel Pascoal . 2024-08-26

MORE AT Google

Delicious dishes. Nice service.

site_logo

Alex Happybee . 2024-08-20

MORE AT Google

Lovely food as usual. Never had a bad wagamama. Love the duck donburi bowl. So tasty. Love the fresh juices too!

site_logo

Emily J . 2024-08-14

MORE AT Google

One of the best Wagamama Branches I have ever visited. We have been here several times and their services are always amazing. From food to customer service. Very clean too. Thanks.

site_logo

London Full Body Massage . 2024-08-13

MORE AT Google

I received my food via deliveroo, I ordered a chicken and shrimp pad tai, and it was horrible, the chicken looked like it was rotting, the noodles were overcooked, the presentation looked like dog vomit, I had to throw the food in the trash and lose my money

site_logo

Adriana Gil . 2024-08-12

MORE AT Google

Fantastic meal with wonderful service !!

site_logo

jacques Van Jaarsveld . 2024-08-11

MORE AT Google

We are here yesterday for my daughters birthday. The food was very delicious, staff are very nice. Ambience is great too

site_logo

Monette Reynoso . 2024-08-02

MORE AT Google

We where ordering the same order for four years that is fire cracker and this year we were surprised that it is not nice like now the chicken is not nice and it is strong and it doesn’t have taste so I hope u change it like before thank you

site_logo

Sarah Alawlaqi . 2024-08-01

MORE AT Google

the service here is amazing, the food is extremely nice one of my favourite restaurants

site_logo

Isla . 2024-07-29

MORE AT Google

Starters, sides and mains all brought out at the same time. No finesse when it comes to dining out. Eat and get out.

site_logo

L P . 2024-07-28

MORE AT Google

This place is my fav,allways good food and fast service. This place especially has wow as interior design Thank you for the food and time there

site_logo

Ana Serban . 2024-07-12

MORE AT Google

So Amazing my kid loved it too. Quality is there 👌

site_logo

ravi sandhu . 2024-07-09

MORE AT Google

Andrezza, did serve us yesterday I have to say wow wow wow, really top service best customer service I’ve seen in years, she definitely went an extra mile to help us, or kids loved her and said from now on it’s their favourite restaurant because of Andrezza. Keep going you’re the star of the place for sure!!!

site_logo

Brian Casagrande . 2024-06-30

MORE AT Google

Had dinner here tonight with my 2 friends, my son and my friends son. Food and service great. I would like to say a massive thank you to the staff who were so accommodating and lovely to us whilst my 2 year old son had a few tantrums. He has just finished isolating at home for a week after being very poorly and was very tired so cried and kicked off (a lot I know). I was visibly stressed and the young man with short dark hair attempted to play with my son and cheer him up, you have no idea the effect this had on me. As a server myself I know it can be stressful to have a toddler crying in the restaurant and I appreciate the kindness you showed to us tonight more than you know. This includes our server for our table, she was lovely and kind with myself and my son too. I however would not like to thank the young lady who brought our drinks over though as she pulled faces at myself and my son whilst he cried and this made me feel awful and embarrassed and like a burden. I almost left, I would have if the young man had not made us feel 100x better by trying to cheer him up. You should be really proud to have a staff member like him, and I hope he is as valued as he should be. He made us feel welcome and at home whilst we tried to enjoy an evening out with 2 toddlers. For reference, we arrived about 5:15pm and were sat on table 131. Again thank you so much xx

site_logo

Carly W . 2024-06-28

MORE AT TripAdvisor

Good food, friendly staff and spotlessly clean restaurant. Lovely ice-cold Asahi beer on tap. Drinks reasonably priced. Recommended

site_logo

love_food_789 . 2024-06-24

MORE AT TripAdvisor

Delicious Japanese inspired food

site_logo

Rob Sullivan . 2024-06-20

MORE AT Google

Nice experience, however there was no way to book in advance and had to wait to be seated since went with a large group - add a booking system !

site_logo

Tom O . 2024-06-20

MORE AT TripAdvisor

Always warm welcome to this restaurant, place to return for sure.

site_logo

Tomasz Z. . 2024-06-16

MORE AT Google

Amazing service, amazing food and just amazing everything, definitely a new local spot for me

site_logo

Logan Page . 2024-06-14

MORE AT Google

Always love going to Wagamamas and today was no exception. Tom, my server was lovely, and attentive. Food was yummy as always

site_logo

Sarah E . 2024-06-14

MORE AT TripAdvisor

Very nice service, food was great and atmosphere was fantastic.

site_logo

Louise Fisher . 2024-06-12

MORE AT Google

Matilda and Andrezza were very attentive and friendly, highly recommend this Wagamama

site_logo

Merlin Melanaphy . 2024-06-12

MORE AT Google

Nice, polite young servers. Attentive service, sublime food!👌🏻

site_logo

Éva Vukics . 2024-06-12

MORE AT Google

My favorite restaurant. Explosion of flavours in every dish

site_logo

Virginie Malan . 2024-06-04

MORE AT Google

We went to Wagamama for dinner with our friends during the week and one of us had allergies - we cannot thank Reece enough for all the attention he gave us, from going through the allergen menu with us, to making sure we had everything we wanted, he is a credit to the Wagamama team!

site_logo

Amelia M . 2024-06-03

MORE AT TripAdvisor

Fantastic place with delicious food and perfect service🌞🌻

site_logo

Monika Burak . 2024-06-02

MORE AT Google

Andrea and Bart was so great the service was best I've seen at wagamummas bournemouth on top

site_logo

DarkSlothElite . 2024-05-29

MORE AT Google

Food came out super quickly and super hot, the new menu items are really flavoursome and worth trying! Luvena was our waitress and went out of her way to make sure we had a great dinner. Even when I queried how spicy one of the meals is, she suggested an adaption for it and it was delicious!

site_logo

Alexandra Inman . 2024-05-29

MORE AT Google

Just the noodle not so authentic, but overall experience is good. Bathroom is well maintained. Way better than most restaurants in this country. Staff is polite.

site_logo

BBY OBBY . 2024-05-27

MORE AT Google

The vibe of the restaurant is great don’t get me wrong, wonderful service, food came quick and friendly staff. However, 3 out of 4 dishes had clumpy noodles which looked slightly undercooked but overall a satisfactory experience.

site_logo

nowayitsfilip . 2024-05-26

MORE AT Google

Really lovely staff - they explained the menu and made us feel welcome. Food was delivered really quickly to the table. Easy to pay the bill by scanning the QR code on the table. Would recommend!

site_logo

Phillip Munn . 2024-05-22

MORE AT Google

It was rather late when we went in search of a Wagamama in Bournemouth. We had arrived in Alum Chine not familiar with places to eat in the area. It was closing time for most retailers and since it was raining we were able to locate parking and walk about a minute to Wagamama. It was very busy. Our drinks were late arriving due to a fault with the machine so they offered sodas which we declined in favour of water. Our food was mixed as it had this hot/cold vibe to it as if one part of meal was sitting one side then they decided to toss it in hot noodles when the order came in. The staff attentiveness made up for this so pushed the score up to five. After my many rounds with the Wagamama branches I have now learnt never ever go during rush hour.

site_logo

Vanesa White . 2024-05-02

MORE AT Google

Missing ingredients in my order. Very small portion too. Surely i was the unlucky costumer of the day

site_logo

Ruben Fox . 2024-04-30

MORE AT Google

Wagamama's Bournemouth Thursday 25th April 2024 Lovely meal out with my wife. Excellent service today from Alex. As we were leaving the Wagas team noticed me being nosy.....they were tryi g out some new dishes.....The new dishes were Excellent but the best part was seeing the team enthuse about the new dishes.....thanks for allowing us to try too !! Thanks Julian & Amanda

site_logo

Julian C . 2024-04-26

MORE AT Google

We managed to get a booth in the corner and it was instantly a better experience than usual. Non-alcoholic cocktails are delicious 😋. I don't like that the food comes out at different times. Mine got a bit cold before my friend's food came out. Portions are great of you're very hungry. Overall, a good chain, but nothing special.

site_logo

Alina von Zunda . 2024-04-16

MORE AT Google

Been there a few times and found that the food is a bit inconsistent.

site_logo

Felipe . 2024-04-11

MORE AT Google

The restaurant is quintessentially Wagamama, I hadn't been for years and the restaurant has been extended since then. There is now more space and the old long benches have been broken up with the newer shorter benches to give you some privacy if you are eating with a smaller group. There are some smaller tables to the side but they were all booked when we went midweek lunch time. Service was quick but annoyingly several people (5-6, lost count) did different parts and no one seemed to know what the others were doing so our meal was a little interrupted with unnecessary confusion. None of the food arrived at the same time and although the food overall was full of flavour, I thought my noodles were greasy and the salmon was definitely overcooked. Menu is simple but varied and available for download online. Pre-book and -order possible (and esp booking recommended), takeout is also available. For anyone noise-sensitive/hard of hearing, the space was at 75% capacity and it was difficult to hold a conversation as the single, large room doesn't appear to be noise buffered at all. Accessible as all on the ground floor, a single bathroom with solo cubicles for all sexes.

site_logo

M Dawn . 2024-04-08

MORE AT Google

So far the best wagamama I have been to!

site_logo

Lukas Menousek . 2024-04-06

MORE AT Google

Great atmostphere, welcoming staff, delicous food , my ramen was delichious. Service was friendly, I'll definitely return!

site_logo

Tech MavenX . 2024-04-06

MORE AT Google

Really good food, as expected of wagamama.

site_logo

Lee Spence . 2024-04-02

MORE AT Google

Had a lovely meal very tasty meal with chicken and noodles in a bowl with a miso soup. The staff were very attentive and very professional in assessing allergies. Had a nice evening. Only thing that was paying by mobile having to work out the complex algorithms to split the bills , ok if you're young 😂

site_logo

David Tongs . 2024-03-26

MORE AT Google

Similary restaurants in South West

restaurant_img
4.5

1040 Opinions

location-iconCharminster Road
Japanese
outdoor_seating_91964takeaway_91964delivery_91964

Food was ok but for the price the quantity was terrible and the quality disappointing. We ordered the prawn skewer starter which was just under £7. We got four small prawns (two skewers with two small prawns on each). Avoid.

restaurant_img
4.8

266 Opinions

location-iconNoble House 8-10 Yelverton Road
Japanese
outdoor_seating_206875takeaway_206875delivery_206875

Been going there for quite a while now and I can tell you that it’s the best Korean food ever and the staff is amazing! I highly recommend it.