GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.0

Based on 429 opinions finded in 3 websites

site_photo4

Nº 302 in 516 in Renfrewshire

Nº 16 of 27 Chinese in Renfrewshire

CUSTOMERS TALK ABOUT DISHES WITH..noodlesricebreastcurryonionssoupmeatchickenchilliprawnfriedribssnackprawnscooked

comment_iconOpinions

Always enjoy my food from here and delivery is quick too.

site_logo

Donna Stirrat . 2024-09-12

MORE AT Google

Always enjoy my food from here and delivery is quick too.

site_logo

Donna Stirrat . 2024-09-12

MORE AT Google

asked lady for chowmein and chicken balls, got spring rolls and chicken balls instead. Although she called out the correct order, obviously mixed up in kitchen.

site_logo

the m . 2024-09-06

MORE AT TripAdvisor

We love this Chinese takeaway. The food is fresh and tastes great. Delivery is always prompt. We have received free items a few times which is always a nice touch. Highly recommended.

site_logo

Nadia Gee . 2024-07-28

MORE AT Google

We love this Chinese takeaway. The food is fresh and tastes great. Delivery is always prompt. We have received free items a few times which is always a nice touch. Highly recommended.

site_logo

Nadia Gee . 2024-07-28

MORE AT Google

Take away is our go to and placed order online tonight but unfortunately card payment wouldnt work called Topwok no problem “does bank transfer work?” that is going above and beyond for the customers well done guys 😃😊 as someone who works in hospitality that truly is great service

site_logo

Marle Thomson . 2024-07-19

MORE AT Google

I was really going off the same Chinese food all the time until I found this amazing place The food is 10 out of 10 the staff are very friendly the go that extra mile for their customers try it you will keep going back Brilliant wee take away ❤️❤️

site_logo

Stephen McGuire . 2024-05-24

MORE AT Google

Food always amazing. Would not go anywhere else

site_logo

Marilyn Walker . 2024-05-12

MORE AT Google

Good size portions and tasty , salt and chilli 👍

site_logo

Ian MacKechnie . 2024-05-10

MORE AT Google

Bangin Chinese food and amazing value for money compared to other chinese takeaways in paisley now! Not had a bad meal ever and tried a good few things on the menu

site_logo

Gaz Robertson . 2024-02-26

MORE AT Google

Really good tasting food and quick service.

site_logo

Freddie Lauritzen . 2024-02-07

MORE AT Google

Best chinese food in Paisley and Surrounding areas.

site_logo

ryan galloway . 2024-01-18

MORE AT Google

This place recommended and ordered take away. When received noodles raw. I called to advise and was told they were fried. As i work in catering im sure i know difference between raw and fried. A shame but honesestly wont return

site_logo

Linda Asawalam . 2023-12-11

MORE AT Google

Good food at a reasonable price.

site_logo

Alex Shaw . 2023-12-06

MORE AT Google

Booked a meal for 6 at 5.45pm for collection at 6.30pm. Food wasn't ready until 6.50pm. So, no excuse that the food with the exception of the soups was all luke warm and had to be microwaved hot. Which was difficult for so much food. The chips were barely warm. All the food tasted very good, the chicken in the soups was as much as in the main courses! The pork ribs weren't even a mouth full of meat, the rest being bone and sauce. The lemon sauce can only be described as Lemon Squash, and cornflour. All the main courses were very high content of carbs, and tiny protein. For £48 was a lot of mediocre food, and not up to expectation.

site_logo

Ian S . 2022-09-26

MORE AT TripAdvisor

Quick delivery, all food was cooked lovely and very tasty

site_logo

John Williamson . 2021-12-12

MORE AT Google

Great food an customer friendly

site_logo

Gordon Friel . 2021-11-29

MORE AT Google

I live 100yrds from a local takeaway. Hands up Topwok is 10/10 for its food/delivery etc . I recommend 100% this premises. 👌

site_logo

anthony love . 2021-10-20

MORE AT Google

Never had a bad meal and always good service . Just pity they don't accept cards

site_logo

Ian Fargher . 2021-05-30

MORE AT Google

Timing for collection way off (extra 15 minutes to time told) so called salt and chilli chips no salt or chilli just a red tasteless sauce . Special fried rice no gravy no prawns very little char sui loads of rice and no taste what so ever. 1st time trying and it'll be the last not impressed at all and pretty expensive for the experience

site_logo

colin lupton . 2021-05-15

MORE AT Google

Food is always great! Some minor customer service issues but these are outweighed by the food. Salt and chilli chicken wings and satay both outstanding. Also crispy chicken satay...new discovery which is very delicious

site_logo

BeeBee20152015 . 2021-02-26

MORE AT TripAdvisor

Awesome first time trying this Chinese out and will certainly be back 👍I rate it up there with the Richmond oriental and Asian fusion in East Kilbride where I used to stay. Our order was crispy chicken in a chilli sauce and sweet n sour Cantonese style also peking ribs and salt n chilli chips whitch were amazing 👏 😋 and they also threw in some spring rolls for free nice touch. Thanks Topwok we will be back 👌👍

site_logo

Steven Hendry . 2021-02-07

MORE AT Google

Utter horrible places prawns where off got replace with worst meal ever binned gave it a second chance and tryed to double charge me now fb messaging me with harassment screen and proper authority imfored avoid at all cost food and hygiene imfored

site_logo

Andrew Reid . 2021-01-30

MORE AT Google

Had several takeaways and yet to be disappointed drivers very friendly and girl who takes the phone orders very nice food great portions very large lasts two days very impressed with the service

site_logo

johnmckinnon1965 . 2021-01-11

MORE AT TripAdvisor

Great menu, Loads to choose from, Delicious, This is ma fav now!

site_logo

KEVIN BYARS . 2020-09-23

MORE AT Google

Food and service were excellent

site_logo

Normaanne Macdonald . 2020-07-12

MORE AT Google

Food super hot and tasty , prawn toast very crispsy and fresh , prawn dunplings superb!!! Very nice staff as well !

site_logo

Agix6 xo . 2020-06-27

MORE AT Google

Tried chilli chips , it's very good

site_logo

Naren Bhardwaj . 2020-03-06

MORE AT Google

The be see Chinese takeaway so far

site_logo

Marie Essenam . 2019-12-02

MORE AT Google

Lovely first time using topwok will be back

site_logo

Cathy Docherty . 2019-11-02

MORE AT Google

First time getting food here, looked at the reviews which were good. Tried a snack box of salt & chilli chicken which was utterly tasteless. Got another customer to try who was a regular there who agreed. Went back in and staff didn't take the criticism well and done nothing about it. Other half got sweet and sour sauce with her dinner which was very watery.

site_logo

Perfect Touch . 2019-08-19

MORE AT Google

Great service great food a lot for me eneyway will have other half tonight thank your chefs

site_logo

Peter Stewart . 2019-07-11

MORE AT Google

The food is acceptable but lacking in flavor. Prices are reasonable but service a bit slow.

site_logo

Harwood . 2019-06-12

MORE AT Google

Ordered the special meal (selection of 4 dishes) + Mega box which contained spare ribs & chicken wings which were nice, chicken balls (1 was missing) & fried rice & chips. Rice seemed to be just boiled rice with some soy added & chips were what you would expect-limp.Both the Chow Mein & Satay were OK but the Red Thai curry did not taste as if it contained any coconut milk & the Chop Suey sauce was bland. Portion size was very good-there was enough to feed 4, delivery time was as promised and it was piping hot.Each meal contained a good selection of vegetables. It wasn't terrible, the Special Meal was good value for the price paid, but neither was it great.This was our first visit & I can't see us going back.

site_logo

Janet G . 2019-06-01

MORE AT TripAdvisor

We had Salt and Chilli Chicken Wings to start, the best I,ve tasted.Breast of Chicken Curry and Mixed Vegetable Curry and Chips they were really nice and tasty.Would highly recommend as was only 12.80 and 1.60 delivery.

site_logo

Carol D . 2019-05-16

MORE AT TripAdvisor

amazing prawn dumplings. would highly recomend

site_logo

Geo Cole . 2019-05-09

MORE AT Google

It was ok portions were not bad either but a bit salty I thought as drank a lot after eating my tea and it was just to quench my thirst

site_logo

stew macp . 2019-04-10

MORE AT Google

Good take way food friendly staff

site_logo

Ernie Cheyne . 2019-02-27

MORE AT Google

Had a great meal delivered from TopWalk tonight it was hot when it arrived and the chicken balls were lovely and crisp we really enjoyed it... Thank you.

site_logo

Jean Williamson . 2019-02-20

MORE AT Google

Paisley has a lot of good bars, cafés and food outlets. Top Wok is very popular and the prices are very competitive. I am a vegetarian and the have quite a good choice. Fried rice is not too pricey.

site_logo

Ian B . 2019-02-12

MORE AT TripAdvisor

Did not enjoy food. Satay was disgusting too salty, chicken was dry, even prawn crackers were inedible. Requested light on chilli in an already low spiced, meal didn't happen, no taste to meal apart from spice.

site_logo

Katrina Crawford . 2018-12-29

MORE AT Google

Lots to choose from their menu. Friendly staff. Tasty food and good portions.

site_logo

Kirstie Wadwell . 2018-10-09

MORE AT Google

Love their Thai red curry which may not be authentically Chinese is excellent here better than any That restaurant I've been. The woman here is very nice , friendly and helpful. The food in my experience is always hot well cooked and tasty. The wait is never too long however they do deliver

site_logo

Alan Wallace . 2018-05-20

MORE AT Google

Never had bad food from here. This is my regular chinese takeaway. Used takeaway with friends and family and eceryone loves the place!! Easy 5 🌟

site_logo

gordon s . 2018-04-27

MORE AT TripAdvisor

Recent order... Don't do set meals. 1/2 orders flooded w rice. Could not taste bb sauce or even curry. Must make remends!!!

site_logo

iridis alpha . 2018-04-25

MORE AT Google

Great wee take away. Food always nice

site_logo

Skylar the African grey pauline Guthrie . 2018-04-05

MORE AT Google

I've never had a bad meal from here everything is really tasty, always hot, quick service and friendly staff.

site_logo

loveagoodmunch2018 . 2018-03-18

MORE AT TripAdvisor

Really great sirloin steak.chips and chicken curry plenty to share for two people. 😆😆😆😆

site_logo

Anne-marie Young . 2018-03-07

MORE AT Google

Depends on who is on wither you get what you actually ordered. So far for me end product can be variable. Sometimes you get badly cooked fried rice, sometimes you get badly cooked chips. Service at the counter can be slow to the point where I have almost phoned the shop just to get someone at the counter to serve. Overall ok but not all of the time. Prices have gone up

site_logo

Bill Milligan . 2017-12-16

MORE AT Google

I've been ordering from here for years now.The foods tasty,always hot and the prices are good.The young lady who takes my order is friendly and helpful.Its the only place I go to when wanting a chinese.The delivery times are second to none.I live in the seedhill area and one time it took eleven minutes from placing my order to the the delivery guy pressing my door buzzer.And he's always got a smile.

site_logo

Ronnie Ferguson . 2017-12-08

MORE AT Google

Visited for a takeaway and was very disappointed. Food was salty and chicken dishes were lacking in meat. Not a place I will visit again.

site_logo

AlanRad58 . 2017-08-30

MORE AT TripAdvisor

only place we will always get our deliveries from food moreish pleasant delivery drivers well recommended ........

site_logo

80schick . 2017-07-12

MORE AT TripAdvisor

If I could put no stars I would! This has now been the 3rd time in a row that my order has been incorrect. I am just off the phone to them and they have point blank refused to send out a replacement for their error! Totally unacceptable customer service! If you order here I wish you all the luck because you will definitely need it! Worst Chinese takeaway in paisley.

site_logo

maxwell933 . 2017-07-01

MORE AT TripAdvisor

Utilizada para ordenar y disfrutamos de su buen regularmente. Sin embargo recientemente varias veces la buena ha llegado y derramada por todo el lugar, frío, y francamente comestible. Cambiaron sus comidas en bañeras de plástico con comida y arroz en la misma bañera! No todo el mundo le gusta esto. Además de un flagrante intento de dar una porción más pequeña! Chow mein de sosa, curry seco y qué desastre de derrame. La mitad del tiempo los pedidos están equivocados. Qué vengan en estimaciones.

site_logo

Yvonne L . 2017-04-28

MORE AT TripAdvisor

Booked a meal for home delivery through the Just Eat website and sat back waiting. After 5 minutes received a call from Just Eat saying the restaurant had cancelled the order due to being "too busy". Why do they take the bookings when they are unable to cope? Greed I suppose. This was only my second booking with Just Eat so I'm not commenting on their service.

site_logo

FarmerOrr . 2017-01-03

MORE AT TripAdvisor

expensive price on the average food (low quality) service was bad. won't be back i would rather have a salad from mcdonalds

site_logo

Chris M . 2016-12-14

MORE AT TripAdvisor

Great deals for mon-thurs, also good all week set menus. Food always delicious......would recommend!

site_logo

n f . 2016-08-14

MORE AT TripAdvisor

Love this place! By far the best Chinese in Paisley!

site_logo

downie . 2016-06-26

MORE AT Just Eat

Really tasty stuff. Thank you. :)

site_logo

Aimee . 2016-05-17

MORE AT Just Eat

Really tasty stuff. Thank you. :)

site_logo

Aimee . 2016-05-17

MORE AT Just Eat

Perfect as always! Took a long time to find a decent Chinese in Paisley but this is by far the best! 😍

site_logo

Cheryl . 2016-05-13

MORE AT Just Eat

Food lovely as always, arrived on time and piping hot. Won't use any other takeaway.

site_logo

Lesley . 2016-05-09

MORE AT Just Eat

Food lovely as always, arrived on time and piping hot. Won't use any other takeaway.

site_logo

Lesley . 2016-05-08

MORE AT Just Eat

Food was good but bit cold had to heat up but it was a cold night

site_logo

russell . 2016-05-07

MORE AT Just Eat

Waited almost an extra hour after expected delivery time person on phone no help what so ever won't order from here again

site_logo

marc . 2016-05-04

MORE AT Just Eat

Disgusting, 1 hour waiting for this & everything was soggy, cold... Never again :(

site_logo

Mitchell . 2016-05-04

MORE AT Just Eat

Waited almost an extra hour after expected delivery time person on phone no help what so ever won't order from here again

site_logo

marc . 2016-05-03

MORE AT Just Eat

Disgusting, 1 hour waiting for this & everything was soggy, cold... Never again :(

site_logo

Mitchell . 2016-05-03

MORE AT Just Eat

Food, as always, was lovely. Delivery was a bit longer than usual so had to phone, very polite on the phone & the driver apologised. Doesn't put me off ordering again though as the food is lovely.

site_logo

Lesley . 2016-05-03

MORE AT Just Eat

Love this place! By far the best Chinese in Paisley!

site_logo

downie . 2016-05-01

MORE AT Just Eat

Food, as always, was lovely. Delivery was a bit longer than usual so had to phone, very polite on the phone & the driver apologised. Doesn't put me off ordering again though as the food is lovely.

site_logo

Lesley . 2016-05-01

MORE AT Just Eat

Massive portions wow! Tasty too :)

site_logo

Pauline . 2016-04-29

MORE AT Just Eat

Massive portions wow! Tasty too :)

site_logo

Pauline . 2016-04-29

MORE AT Just Eat

Order from here often and I have never had one bad meal, always hot, from town Center to Foxbar, driver is always pleasant. Delivery times vary but that's not a real bother to me but may bother others. Good choice of meals and portions are plentiful. Would recommend.

site_logo

Patrick . 2016-04-29

MORE AT Just Eat

Order from here often and I have never had one bad meal, always hot, from town Center to Foxbar, driver is always pleasant. Delivery times vary but that's not a real bother to me but may bother others. Good choice of meals and portions are plentiful. Would recommend.

site_logo

Patrick . 2016-04-29

MORE AT Just Eat

the food was delicious but took a little longer than expected to be delivered. would definitely order from here again. Tried the Siu Mai for the first time which is usually a mistake {trying something other than the usual} but will definitely be ordering this again.

site_logo

kimberley . 2016-04-29

MORE AT Just Eat

Used this place twice when visiting a friend and both times been grest food, fast delivery and always amazing value! Wish it was near me. Thanks.

site_logo

Mchugh . 2016-04-27

MORE AT Just Eat

Used this place twice when visiting a friend and both times been grest food, fast delivery and always amazing value! Wish it was near me. Thanks.

site_logo

Mchugh . 2016-04-27

MORE AT Just Eat

Yummy!! Salt & Chilli Squid is my fave :)

site_logo

Lynsey . 2016-04-25

MORE AT Just Eat

Yummy!! Salt & Chilli Squid is my fave :)

site_logo

Lynsey . 2016-04-24

MORE AT Just Eat

All good chips were terrible guys, sort that it and it's a good takeaway 😀

site_logo

Robbie . 2016-04-24

MORE AT Just Eat

the food was delicious but took a little longer than expected to be delivered. would definitely order from here again. Tried the Siu Mai for the first time which is usually a mistake {trying something other than the usual} but will definitely be ordering this again.

site_logo

kimberley . 2016-04-24

MORE AT Just Eat

All good chips were terrible guys, sort that it and it's a good takeaway 😀

site_logo

Robbie . 2016-04-24

MORE AT Just Eat

Perfect as always! Took a long time to find a decent Chinese in Paisley but this is by far the best! 😍

site_logo

Cheryl . 2016-04-23

MORE AT Just Eat

Food was hot, tasty and delivered in quick time

site_logo

margo . 2016-04-21

MORE AT Just Eat

Food was hot, tasty and delivered in quick time

site_logo

margo . 2016-04-21

MORE AT Just Eat

We ordered chilli garlic noodles and a snack box, the noodles were chilli not garlic, the snack box was cold with the ribs tasting off, the fried rice tasted bitter nowhere like normal Chinese food. Was really disappointed

site_logo

Shane . 2016-04-21

MORE AT Just Eat

Food was good but bit cold had to heat up but it was a cold night

site_logo

russell . 2016-04-20

MORE AT Just Eat

We ordered chilli garlic noodles and a snack box, the noodles were chilli not garlic, the snack box was cold with the ribs tasting off, the fried rice tasted bitter nowhere like normal Chinese food. Was really disappointed

site_logo

Shane . 2016-04-20

MORE AT Just Eat

was waiting for over a hour for delivery and food standard was poor

site_logo

thomas . 2016-04-19

MORE AT Just Eat

was waiting for over a hour for delivery and food standard was poor

site_logo

thomas . 2016-04-19

MORE AT Just Eat

Best salt n chilli chicken you'll find

site_logo

Gibson . 2016-04-18

MORE AT Just Eat

Took an hour and a half to deliver but food was great. Not best pleased with the service I'm afraid.

site_logo

Yvonne . 2016-04-09

MORE AT Just Eat

Took an hour and a half to deliver but food was great. Not best pleased with the service I'm afraid.

site_logo

Yvonne . 2016-04-09

MORE AT Just Eat

Delivery was very slow, not all that was ordered came with the delivery. When phoned about the inconvenience staff were impolite and arrogant. Took another two hours to come and when I phoned again I was told that it was too busy and by this point my food was cold as I had previously been told it would be a 10 minute wait. Rude comment was also made on delivery, would definately not recommend.

site_logo

Iona . 2016-04-07

MORE AT Just Eat

Food was delicious, meal deal was great for the money

site_logo

Danielle . 2016-04-07

MORE AT Just Eat

Delivery was very slow, not all that was ordered came with the delivery. When phoned about the inconvenience staff were impolite and arrogant. Took another two hours to come and when I phoned again I was told that it was too busy and by this point my food was cold as I had previously been told it would be a 10 minute wait. Rude comment was also made on delivery, would definately not recommend.

site_logo

Iona . 2016-04-07

MORE AT Just Eat

Food was delicious, meal deal was great for the money

site_logo

Danielle . 2016-04-06

MORE AT Just Eat

Delicious, fresh and hot food. Top Wok never disappoints!

site_logo

Susan . 2016-04-06

MORE AT Just Eat

Delicious, fresh and hot food. Top Wok never disappoints!

site_logo

Susan . 2016-04-05

MORE AT Just Eat

Similary restaurants in Glasgow and Surrounding

restaurant_img
4.0

110 Opinions

location-icon13A Bridgewater Shopping Centre
Chinese
outdoor_seating_124506takeaway_124506delivery_124506

Lovely staff that are friendly and helpful. Selection of food options. Always welcoming and offering good selection of food

restaurant_img
4.0

48 Opinions

location-icon238 Main Road
Chinese
outdoor_seating_318458takeaway_318458delivery_318458

Order took 1 hour 55 mins. Never again. Friday 25th Nov.

restaurant_img
4.0

120 Opinions

location-icon174 Paisley Road
Chinese
outdoor_seating_114258takeaway_114258delivery_114258

This place used to be good deleted my good review I had for them.Must of changed owners. What a disappointment and waste of £32. Food I ordered all tasted like reheats. I ordered chilli chicken, chicken chow mein, rice & Honey, chilli wings in a plastic container not a foil container looked like a reheat the colour of the chicken looked off🤢🤢 swimming in watered down sause YUK Even the prawn crackers taste damp & not fresh. never ordering from here again!

restaurant_img
4.0

120 Opinions

location-icon98 Glasgow road
Chinese
outdoor_seating_109010takeaway_109010delivery_109010

Best Chinese in paisley ! Will defo order from here from now on 👍

restaurant_img
4.2

396 Opinions

location-icon16 Thornhill
Chinese
outdoor_seating_116802takeaway_116802delivery_116802

Been coming to The Canton for almost 40 years both to sit in and for takeaway. Despite moving out of the Johnstone area I still frequently travel in order to get a takeaway from here as it’s the bet local Chinese restaurant around by a mile.