GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.5

Based on 714 opinions finded in 2 websites

site_photo4

Nº 63 in 354 in Test Valley

Nº 2 of 2 Thai in Test Valley

CUSTOMERS TALK ABOUT DISHES WITH..prawnsoupmeatduckcookedprawnschickenfishricespicycoconutbeautifulfriedporkcurry

comment_iconOpinions

Excellent food in a lovely atmosphere with delightful staff.

site_logo

Syd Ison . 2025-05-06

MORE AT Google

Another excellent meal at the Suan Thai. Great service and a relly good atmosphere. Chicken Satay starter was delicious and the Pad Prik just spicy enough. Can't wait to go back!!

site_logo

B & S Rinaldi . 2025-04-04

MORE AT Google

As regular visitors we always enjoy a wonderful meal with exceptional flavours and the food cannot be faulted.

site_logo

ANDREW HORN . 2025-04-03

MORE AT Google

Another fabulous meal here. Five stars new waitress dropped a plate of food and the manager sorted everything very quickly. Replacement dish arrived in minutes. Can't fault it. Will come again and again

site_logo

Guy Blackburn . 2025-04-02

MORE AT Google

My partner and I decided to eat in at Suan Thai just a couple of weeks ago. We'd like to share our experience in the hope that we can save a few people the hassle of being ripped off by this restaurant. To start with, the food was nothing special like people keep saying. We found it extortionate and totally not worth it, in my opinion. Before our food order, we were asked if we wanted some complimentary prawn crackers. A bowl of six measly prawn crackers arrived, only the white ones were nice and edible. The brown coloured ones were chewy and peppery. As it goes, these were not actually complimentary they were in actual fact just under a fiver. This is where we started to get caught out by Suan Thai. Drinks were overpriced, £8 for a bottle of beer. The service was slow and chaotic, which added to our disappointment. When it came to the bill, a cheeky so-called "discretionary" 10% gratuity was added onto the receipt which we find scandalous. We only noticed when we left the restaurant. Please be aware of this if you decide to eat here, because you will not be asked if you want to pay them a 10% tip, it will indeed just be added onto the total bill without your concent. For 2 people, our bill was just over £100. All we had was 3 beers, 3 malibus, 2 starters, 2 mains and like I previously mentioned, the food was nothing special. In fact, my local Chinese takeaway on the high street is a lot nicer and better value. I will not be eating in this sly, sneaky, overpriced, overrated kip of a place again.

site_logo

Millie Fae McGregor . 2025-03-30

MORE AT Google

Fantastic Thai food and friendly service.

site_logo

Ian Nichols . 2025-03-30

MORE AT Google

I have been to Suan Thai restaurant twice now, and both times have been a wonderful experience. The food is incredible. Absolute perfection. My friend and I want to return many times to try everything on the menu as we believe it will all be cooked with the attention, love and care as the dishes we’ve had so far. The service is excellent and the ambience is low lighting special night out kind of vibe. I love it here.

site_logo

Vicky P . 2025-03-02

MORE AT TripAdvisor

The food here is consistently excellent, really delicious traditional Thai meals - massaman, panang and beef salad were all excellent at our latest visit. Highly recommended!

site_logo

Pete McAllister . 2025-03-02

MORE AT Google

Really friendly team and excellent food, thanks again for a great meal

site_logo

Alex Pegley . 2025-02-15

MORE AT Google

My fiancé took me for dinner at Suan Thai restaurant last night. It was a beautiful experience from start to finish. The food was fresh and delicious and the staff were friendly and attentive. Would highly recommend and will be back again soon.

site_logo

Hattie G . 2025-02-15

MORE AT TripAdvisor

My fiancé took me to Suan Thai restaurant for a Valentines dinner last night. The food was fresh and delicious and the staff were friendly, efficient and attentive. The owner had placed heart shaped helium balloons all around the restaurant which I thought was a lovely extra touch. It was our first time here but we will definitely be back ❤️

site_logo

Hattie Garner . 2025-02-15

MORE AT Google

Really pleased we went - very enjoyable food, outstanding service and the food is not too salty/sweet/oily. Fresh and varied. Will go again

site_logo

Independent_Joe . 2025-02-10

MORE AT TripAdvisor

Always great food, super friendly staff and a lovely atmosphere, my wife’s favourite restaurant in Romsey & the best Pad Thai outside Thailand

site_logo

Bruce M . 2025-02-01

MORE AT TripAdvisor

We thoroughly enjoyed our meal last night. The food was lovely - I had the dim sum and Thai green chicken curry, which was the best I’ve ever had. Service was great. They were very busy taking phone orders for takeaway food, which is a good sign and the ambiance was very nice. We will definitely be going back and I would highly recommend this lovely Thai restaurant 🙂

site_logo

Janey Gascoyne . 2025-01-05

MORE AT Google

2nd visit! Food is lovely and full of flavour.

site_logo

Aaron Skeels . 2024-12-29

MORE AT Google

It’s definitely my favourite restaurant in Romsey. The food is marvellous and so tasty! Staff are so friendly as well🥰

site_logo

Paola Pizarro . 2024-12-14

MORE AT Google

We love this restaurant, the owner is a fantastic guy as his all husband staff.. Brilliant place to eat

site_logo

John Gorman . 2024-12-09

MORE AT Google

Met up with a friend here, on her recommendation and that of a neighbour. Last visited a very long time ago, and there have been several changes of management since that time. We remembered it as being good, but not THAT good! In order to sample as many different dishes as possible we shared three starters and three main courses. Not one dish disappointed. Delicious food, and the staff were at great pains to check out the allergies of one of our group. Clearly very popular, as by 8pm on a midweek evening it was full. The chicken Pad Thai and the tempura vegetables were particularly impressive, but that doesn’t really detract from the quality of the other dishes that we also really enjoyed. Drinks weren’t particularly cheap, but on reflection, where are they? One note of caution…if you want to appreciate the food here, and don’t want it in a takeaway format…. BOOK!

site_logo

LaJarrie . 2024-12-05

MORE AT TripAdvisor

We have just had an amazing takeaway from Suan Thai, we had the mixed platter for two, a Beef Red Thai curry and a Prawn Penang. Everything was exquisite, the beef was meltingly soft, the prawns were juicy and flavourful and the two curries went brilliantly together. The chicken satay in the starter was perfect, and they even had a couple of extra battered vegetables that we weren't expecting, all in all there was nothing I would change about it. Absolutely delicious!

site_logo

Catherine Rousell . 2024-11-29

MORE AT Google

Brilliant Thai food, in busy restaurant . Duck meals excellent

site_logo

tony North . 2024-10-20

MORE AT Google

Excellent food, great service. Very reasonably priced for the quality and portions. Spacious and clean restrooms. Would recommend

site_logo

Paul y . 2024-09-23

MORE AT TripAdvisor

First time here - food was amazing

site_logo

Harry Taylor . 2024-09-12

MORE AT Google

Absolutely delicious food, very gracious and friendly host, the place was well decorated with lovely moody lighting. Brilliant restaurant, wouldn’t change a thing.

site_logo

Ella P . 2024-09-08

MORE AT Google

Surpassed expectation, really excellent food. We were greeted warmly, immediately sat at a table not too close to others, drinks and crackers offered promptly leaving us time to choose. We had the platter starter the highlight of which was the prawn toast - the only bit that wasn’t so good was carrot tempura which was a big soggy and with a tiny sliver of carrot was basically batter - followed by pad Thai and a curry with sticky rice. Both were delicious, by far the best Thai food we’ve had in the area including Salisbury. Service charge was automatically added to the bill. I personally prefer to leave a cash tip of my choice and would have left slightly more that way in fact, but I didn’t want to cause a fuss and noticed the prawn crackers weren’t free either so left it. I would definitely return. Free parking right by the restaurant an added bonus.

site_logo

Sarah L . 2024-09-08

MORE AT TripAdvisor

Lovely food and restaurant. As a Vegetarian and my partner is Vegan, we especially enjoyed the Vegan crackers which was nice to have and delicious. Curry and noodle dice were great. Maybe a few more curry options for Vegetarians / Vegans would be nice though.

site_logo

Jamie W . 2024-09-08

MORE AT Google

Really lovely restaurant: great food, atmosphere and service!

site_logo

Phil Bishop . 2024-09-06

MORE AT Google

Very impressed with this independently run Thai restaurant. Not only was the food one of the best Thai’s I’ve tasted, the service was exceptional whereby the owner ran a very tight ship & not afraid to get his hands dirty. Would defo recommend to anyone who visits Romsey & enjoys Thai food - delicious.

site_logo

laurajane125 . 2024-08-19

MORE AT TripAdvisor

We came here three years ago whilst staying in the New Forest and promised to come back if we returned to the area. We even chose all the same dishes as before and we can honestly say it is still superb and the best Thai food we have ever had. The decor is excellent and the staff are super friendly, attentive and helpful. Give it a try, I can guarantee you will be glad you did.

site_logo

Martin Williamson . 2024-08-17

MORE AT TripAdvisor

Delicious food. Guy is spot on with his staff and his wife is a wonderful authentic Thai chef.

site_logo

Beverley Uphill . 2024-08-17

MORE AT Google

Have been here for dinner as well as ordering a take away and the food, atmosphere and customer service have always been incredible.

site_logo

Pebbles . 2024-08-16

MORE AT TripAdvisor

Had a wonderful takeaway from here at the weekend. Was ready quickly and was so so tasty!

site_logo

Bianca Glasshead . 2024-08-07

MORE AT Google

Welcome was great, service to match. Food was amazingly delicious and fresh. Hot and spicy dishes can’t recommend this place enough.

site_logo

The Dolby Engineering Team . 2024-07-28

MORE AT TripAdvisor

A really nice restaurant with friendly staff & great service . The menu is varied and we enjoyed both the curry and stir fry - delicious flavours.

site_logo

Ruth J . 2024-07-28

MORE AT TripAdvisor

Always have such a delicious authentic meal from suan Thai and the service comes with a smile, very helpful and polite.

site_logo

Josh White . 2024-07-27

MORE AT Google

Had a fabulous takeaway from Suan Thai. The Tom Yum soup was the best I've tasted in the area and I haven't had a laab as nice since I last visited Koh Samui.

site_logo

Ian Fisher . 2024-07-24

MORE AT Google

Everytime I’ve come here I’ve had 10/10 food. The chicken Penang is my favourite dish. Always have such lovely service from the staff. Always a lovely evening.

site_logo

Meg P . 2024-07-21

MORE AT Google

Great green curry. Sticky rice a bit too sticky.

site_logo

Michael Byfield . 2024-06-22

MORE AT Google

Can I please just make a response to the most recent review from " McKenzie". I would strongly suggest that anyone reading this, should disregard the very negative and inaccurate review, posted from McKenzie. I have frequently used the Suan Thai restaurant for dine-ins and takeaways, as their food and service, is constantly of the highest standards. There was, in fact, recently an issue at the water station in fording bridge, where a sewer pipe leaked into the fresh water system. As one would expect, there was no report or statement from the water board to state this, as it potentially could have been a serious concern. Hence, why anyone living in the local surrounding area, may have noticed the high levels of chlorine, in the taste of their mains water. I therefore think it was both very responsible and considerate of the Suan Thai management, to consider their customers safety and well being. In all honesty..... Not once have I ever had anything but great food and service from this restaurant.... And in turn, I would very highly recommend trying it, if you haven't already.

site_logo

Adam Trotman . 2024-06-20

MORE AT Google

Food and wine for our party of 4 was good as usual BUT my issue is that the owner said he wouldn't allow us a jug of tap water as there was "a water contamination issue" in the area. I pointed out we were local and there was no issue and he said it was in Stockbridge so we would have to buy bottled water. Made no sense. I checked the SW website - no issues. He spent several minutes telling more lies just to make us buy water. I later noticed that he had a huge stockpile of bottled water in the back corridor- was he trying to sell us water with lies?

site_logo

Fenella McKenzie . 2024-06-16

MORE AT Google

Food was lovely and very polite staff, but when I asked for some tap water for the table the waitress said they do not offer tap water to customers and only bottled (this was on 12th June). It is by law that all restaurants that serve alcohol are legally required to give customers free tap water according to the Licensing Act 2003. *Update* Thank you for feedback on the reason why we were refused tap water. Might be best to inform customers of this when ordering as all we were told by the waitress is you do not offer tap water.

site_logo

Alison . 2024-06-14

MORE AT Google

Our first visit here last night and was a delicious meal. Started with the Thai chicken wings which were in an amazing sauce and then had the chicken pad Thai which was delicious in a slightly sweet sauce. Also great they sell Chang beer.

site_logo

Cam Melling . 2024-05-17

MORE AT Google

Very nice Thai food and very pleasant staff. Having eaten in Thailand, nowadays I'm too often disappointed by Thai restaurants in the UK. Suan Thai did not disappoint; to me, the food felt "authentic" to what I've tasted (and learnt to cook myself) in Thailand. Thank you Suan Thai. I look forward to my next visit.

site_logo

Andrew Mallion . 2024-04-11

MORE AT Google

Ate here last night ,really good food ,thoroughly enjoyed the whole experience...thank you

site_logo

Del Scorey . 2024-04-07

MORE AT Google

Excellent food, great service 👌

site_logo

Nasib K . 2024-04-06

MORE AT Google

Very disappointed with the food from here. All the curries were just watery slop with boiled meat and veg in. Perhaps I ordered wrongly but there was very little to distinguish them apart from that one was incredibly spicy. Appetisers were fine but nothing to write home about. Thai fish cakes were dry and mushy. Perhaps I just don't like Thai food... I really don't understand why anyone would order this over a Chinese as you get far more for your money and much more variation... Unfortunately I will not be going back.

site_logo

Henry Rowden . 2024-04-05

MORE AT Google

My first time here. We were invited by my in-laws for dinner and we all loved the food. We thoroughly enjoyed the ambience despite it being packed on a midweek evening. Although what was posted in Google map as their menu is not current, we still loved the offering. They no longer serve pork as well.

site_logo

Djes Jaculina - Fielder . 2024-04-03

MORE AT Google

Always good. I visit Suan Thai regularly to eat in and take away. Always exceptional. Nothing is too much trouble, food is always great. Would not hesitate to recommend. One of the best places to go in Romsey

site_logo

Colin Buchan . 2024-04-02

MORE AT Google

Very good restaurant in Romsey. Very nice and friendly staff and really tasteful good food. Would highly recommend a visit

site_logo

Seaside42890689069 . 2024-03-27

MORE AT TripAdvisor

Our family had a fantastic meal this evening for 4. Excellent service and delicious authentic food in a beautiful restaurant. Will definitely return. Thankyou :)

site_logo

Matt Fielder . 2024-03-08

MORE AT Google

We visited this evening as a family of 4. The service and the food was excellent. We Would strongly recommend this restaurant for a lovely meal out. All the starters, main courses and desserts were delicious. Thankyou and see you again soon :)

site_logo

Matt F . 2024-03-07

MORE AT TripAdvisor

Excellent Thai food , Staff are all lovely, great atmosphere 👌

site_logo

Michelle Skinner . 2024-02-17

MORE AT Google

Wonderful food. Best Thai around. Been a few times and we are always impressed.

site_logo

Ash Smith . 2024-02-17

MORE AT Google

Food is top, atmosphere has a bit of a canteado feel. Yet, great time management when ordering take away!

site_logo

Ulrike Lucas . 2024-02-17

MORE AT Google

Wonderful service last night with fantastic tasty food. We will be back.

site_logo

Steve Kent . 2024-02-11

MORE AT Google

Lovely food, and pleasant attentive staff.

site_logo

David Collier . 2024-02-11

MORE AT Google

Great food, well presented. Excellent service. Can't wait to go again. Recommended to friends who also enjoyed their visit.

site_logo

Kevin F . 2024-01-29

MORE AT TripAdvisor

This was the first time we've visited Suan Thai in a while and it did not disappoint. The service was excellent, we were well looked after all evening. There's a good menu with lots of choice and the food was cooked perfectly. Well worth a visit.

site_logo

barryr489 . 2024-01-15

MORE AT TripAdvisor

This restaurant is such a hidden gem. Lovely cosy atmosphere and friendly welcoming staff. We had such tasty home cooked thai food all freshly prepared and it was worth every penny. Recommend the special pad thai rice and any of the sea bass dishes also the mixed platter starter . Its all homemade for a great tasting selection. You wont leave here hungry or disappointed. Enjoy .

site_logo

paulbX6967ZQ . 2024-01-09

MORE AT TripAdvisor

Lovely little hidden away thai restaurant. Beautifully cooked fresh ingredients. So tasty and authentic. You wont be disappointed !

site_logo

paul brammer . 2024-01-09

MORE AT Google

Fantastic food. We ordered several meals for takeaway which were equally as nice. Great service, very friendly. Cannot fault this restaurant.

site_logo

Elizabeth Haines . 2023-12-20

MORE AT Google

Excellent food coupled with excellent friendly service made this a great night out for us. I really appreciate it when given advice on what and how much to order, too many times I’ve ordered food that was unnecessary but to be told beforehand is a blessing. All of the staff were very polite and the owner was really helpful. The lovely food was complemented by some lovely house red and white wines. A really great night was had by all 6 of us and we can’t wait to visit again.

site_logo

Alan N . 2023-12-19

MORE AT TripAdvisor

First time we ordered a take away and the food was just delicious! Very fresh; super tasty, very good portions and all of us loved the food. We will definitely order again and will go to eat to the restaurant. Best Thai food we have had for long time.

site_logo

Paloma Aguado . 2023-12-16

MORE AT Google

First visit for many a year. Very impressed, as despite being very busy the food and service were excellent. I can see why it is s popular. .

site_logo

Tony Scott . 2023-12-02

MORE AT Google

I quite often get takeaway from Suan Thai and the food is fantastic. A group of 10 of us decided to eat in and the service was great, food was as fantastic as always. Everyone thoroughly enjoyed their meals and I have no doubt I'll be back soon. I had the prawn toasts and beef massaman and both were absolutely divine.

site_logo

207ericaj . 2023-12-02

MORE AT TripAdvisor

Table of 10, but great service and fantastic food as always. Definitely recommend.

site_logo

Erica Jenner . 2023-12-02

MORE AT Google

Dropped in on a Tuesday evening with no reservation just as they were opening. Couldnt have been better, owner was welcoming, hospitable and polite, restaurant was spotlessly clean, with delicious food, nice and fresh and good quality. Absolutely going back, and soon!

site_logo

Mandy S . 2023-11-22

MORE AT TripAdvisor

Visited on a Wednesday night and got a table without booking. Service was okay, and heard male server that they were short of staff. Food (Chicken Pad King, Steamed Rice and Prawn Crackers) was okay, not as flavoursome as I thought it would be. Lighting was dim. A service charge was added without having choice to offer/give tip. My whole meal for one person with a bottle of sparkling water was £30.00

site_logo

Ian H . 2023-11-20

MORE AT TripAdvisor

We turned up late towards closing time for my birthday and guy couldn't have been more accommodating. Excellent food and service and the food was so fresh and delicious.

site_logo

romsonian . 2023-10-27

MORE AT TripAdvisor

Restaurant is lovely inside, nice staff, all was.going well till the food came out. It was well cooked and lovely presentation but the food had no heat, no flavour, was gutted. Eaten may Thai dishes from authentic places, sadly I don't recommend. Gutted as it's on my door step

site_logo

martin b . 2023-10-24

MORE AT TripAdvisor

Restoran is located inside Cinamon lake side Hotel. Food, service and atmosphere is really great. Definitely worth visiting.

site_logo

Milos Mirkovic . 2023-10-16

MORE AT Google

Being vegan, chose yellow Thai curry. INCREDIBLE !!! Highly recommend. Will be back soon. Gets busy (understandably) so,order in advance

site_logo

Ess Tee . 2023-10-07

MORE AT Google

Being vegan, chose yellow Thai curry. INCREDIBLE !!! Highly recommend. Will be back soon. Gets busy (understandably) so,order in advance

site_logo

Galaxy T . 2023-10-07

MORE AT TripAdvisor

Review of Take-Away experience - not sit down. Suan Thai had been our regular Thai eat-in and take-away for some years. Reasonable food at a reasonable price - but we lost touch during the restaurant refit and found another thai option a few miles further out. Decided to go "home" to Suan Thai for a take-away last night. Happy to wait the scheduled 80 minutes for our meal. Arrived 10 minutes early (just in case) but food took 30 minutes to arrive. Not a big deal, it happens. Pricing has increased significantly with a take-away that cost £27 before the refit now costing £38. Prawn starter increased by 40%, rice by 90%. In fact the Kao Kai as a take-away is 25p more expensive than the eat-in price. Food was reasonably tasty but my massaman curry was very watery compared to my previous experience and the chicken"strips" were stringy, lower quality meat. The duck special also had moved from thicker honey sauce to a much more watery consistency. Cost saving measures which no doubt helped to contain the price increases to just +43%. I do understand base costs have increased but sadly Suan Thai has priced itself out of my take-away market whilst degrading the eating experience. I might go back for eat-in..........but will probably support the other option for both.

site_logo

SouthamptonMark . 2023-09-24

MORE AT TripAdvisor

Lovely food with lovely staff. Wine selection was very good and thoroughly enjoyed the meal. Don't be put off with the location as inside it is very pleasant.

site_logo

DrBJP . 2023-09-20

MORE AT TripAdvisor

On holiday at West Wellow first week September and eat here on our last night. Recommend you book as weekends are especially busy apparently. Not surprising as food incredible and staff /service first class. Nothing too much trouble for them. Rang at fairly short notice, but they jiggled things to find us a table space. My husband, not a great fan of Thai food, is completely converted by our experience here.

site_logo

Irene W . 2023-09-19

MORE AT TripAdvisor

Great restaurant good food would recommend

site_logo

Southern Drainage Solutions . 2023-09-17

MORE AT Google

Went here as a table of four, chicken was very low quality with telltale white residue from low quality chicken on the satay, mediocre flavour from all the main dishes and very overpriced for what it was. I understand cost of living etc but the food quality simply doesn’t match the price paid. Service was good, atmosphere was good, but the quality of food was simply lacking. We won’t be returning.

site_logo

Tim Hoad . 2023-09-16

MORE AT Google

The food was delicious. Service was fast, and the restaurant was very clean and comfortable. I look forward to going back.

site_logo

HUBERT . 2023-08-31

MORE AT Google

Since moving to Romsey this is the take away we consistently go for! The food is superb & the owner & staff are just lovely! Favourite place around

site_logo

Megan H . 2023-08-29

MORE AT Google

Lovely restaurant good service food is amazing

site_logo

Susan Hodgson . 2023-08-01

MORE AT Google

Delicious food and excellent service. We were the first customers in the restaurant, so obviously there was no atmosphere, but as it started to fill with customers the atmosphere improved.

site_logo

Philip Lee . 2023-07-12

MORE AT Google

Food is delicious and the service was very quick.

site_logo

James Messenger . 2023-04-07

MORE AT Google

Fantastic meal , service excellent, recommend 💯

site_logo

Eunice Randall . 2023-04-06

MORE AT Google

Suan Thai is my favourite of all the eating out options in the area! The food is consistently outstanding, service is always fast, attentive and friendly. It’s our first choice of restaurant whenever I meet up with a group of friends. Thank you 👍🏻.

site_logo

Jeff Collins . 2023-03-18

MORE AT Google

£3.50 for a can of coke. Very bland. Asked for chilli oil or flakes. They had none, but brought me a whole little bowl of fresh red chilli. So bland or face melting were the options. I had a starter and pad Thai main. I left hungry and went home and cooked myself a burger.

site_logo

Benjamin Jude . 2023-03-09

MORE AT Google

Excellent food at this restaurant, I absolutely loved the food, and the people that worked there were very kind, the food had so much flavor. I had the Panang curry an bed it was superb I loved my time here and I think you would too. Definitely come again.

site_logo

Tom “Thomas” . 2022-12-02

MORE AT Google

Suan Thai is my favourite place to eat, and regularly go with family and friends. The food is amazing, the staff are so welcoming and friendly. Had another fab night on Saturday with friends, highly recommend, guaranteed a lovely evening!

site_logo

Heather . 2022-12-01

MORE AT Google

The food here is always amazing! Authentic, tasty and fresh! I’d recommend to anyone.

site_logo

Katie Kilford . 2022-11-28

MORE AT Google

Edited based on the owner's reply: Terrible food and super expensive for the quality. All the proteins were way over cooked, dry and bad quality. Wouldn’t mind paying the price if the food was good, but literally everything was bad. The owner claimed we did not order a single chicken dish, but actually we ordered TWO. We ordered CHICKEN tom yum soup and CHICKEN wings to start. Soup mainly tasted of MSG with super dry chicken and the cheapest mushrooms you get not to mentioned gross and will never be used in a broth in Southeast Asia (I understand if they charge that price with oyster mushrooms). Wings were super dry, tough, and only 3 small wings in total... The duck curry was mainly veg for £17, duck was grainy and definitely overcooked. The curry paste was definitely store bought paste. The sea bass did not smell fresh, overcooked, £22 for a small piece of sea bass of bad quality is a joke. Also weirdly they used thickly sliced red onions in the mango salad with the fish when the dish should be with shallots, but I guess that's a way to scam customers. We ordered sticky rice which was £4 per portion, but so was the jasmine rice which the owner claimed to be cheaper but it was the same price at £4 so he is a liar… £80 for 2, 2 starters, 2 mains and 2 rice, 1 beer, 1 lemonade and 1 bottle of WATER for extremely bad quality food. We did not ask the food to be remade because we were hungry and the dishes will still be disgusting anyway so we did not need more of them. Be careful of tipping (we tipped hadn’t realised they already charged gratuity) The restaurant was extremely cold, even after an hour of being in the restaurant, with other customers' presence...

site_logo

N Y . 2022-11-24

MORE AT Google

Really excellent Thai restaurant. Service was attentive, food was fresh and full of flavour, menu was varied enought for all. Would love to return.

site_logo

Christopher P . 2022-11-16

MORE AT Google

2022 this lace goes from strength to strength and I love it. The Pad Thai is perfect and I can never resist! 2019 Love this place as the staff are attentive and it feels authentic. We are blessed with two Thai restaurants to choose from in Romsey but personally I like this place the most. You get a really friendly welcome, prawn crackers complimentary on the table and a good, varied menu to choose from. Recently returned from Thailand and I can confirm that the food is close, not as spicy as it could be but I do like my food hot. Good wine selection and a few Thai beers that I am told are good too. Really nice dining experience at sensible prices. Returned here in December 2021 and I'm, sorry to say it was not the best experience. Great food, that's no difference, but the service was difficult. Maybe they were short staffed but it was a long wait to get served before our main order and an age before our sweet. In fact we ended up having to flag staff to serve us. But hey perhaps they were short staffed. My most disliked thing is the staff saying the cost of the meal out loud. This was a gift and to have the price, which was high, said to the entire table not appropriate. My guests do not need to know how much the charge is, I can read and know that's enough. But they said the cost to the table about three times, and it embarrassed my guess who started to want to pay, which was not the point of a gift. Also I may be a woman but I can pay a bill, and book a table, they kept deferring to the only man. Taking no notice of my saying I had booked and only hearing the man, then the bill being passed to the man and not to me who had booked the table. Small issues but a bit like buying a present and the person getting the gift being shown the receipt, nobody would do that. So great food but not great service, a bit chaotic, I can firgive that as it is so beautiful - but I wouldn't book here if I didn't want the entire table to know what I was spending!

site_logo

C G Ellison . 2022-11-04

MORE AT Google

All the times Ive been here I have not been disappointed. The staff are nice and friendly and the food is awsome. 5☆

site_logo

Adam Stephens . 2022-10-28

MORE AT Google

Haven't been in a while was meant to write this back then but was hoping the old chefs would have been working if they are now I'd go back but from my experience since owners changed the food is so not the same I miss the old food use to be where me and my husband went for any birthday or anniversary and it was amazing, I would go back if I knew the food was like it was back then, but from that one really disappointing dinner on my wedding anniversary I have not been back.

site_logo

Tanya Jenkins . 2022-10-20

MORE AT Google

Amazing thai food, one of the best I've had so far! Great red curry and the sides are great!

site_logo

Daniel A . 2022-10-19

MORE AT Google

The food was very nice but spoilt by being served on cold plates. Portion size was quite small compared to other Thai restaurants. Poor management explanation/excuses. Restaurant was very busy but feel there should have been more staff. Drink prices very expensive compared to food prices. I wouldn't eat here again.

site_logo

H Morgan . 2022-10-09

MORE AT Google

Great food - excellent service. Highly recommended

site_logo

Chris Tahmasaby . 2022-09-02

MORE AT Google

Just arrived home from Suan Thai and compelled to write this review for all that are considering dining at this restaurant. Firstly, the quality of the food is exceptional - in my honest opinion. The front of house staff appear to be running the restaurant area like a well oiled machine. We didn't catch the (young lady) waitress name but she couldn't do enough in guiding us through the menu. She even went to consult with the Chef in order to acquire further advise on a dish we were seeking. Incredible given that they were busy. Anyway, I'll leave it with you all to make your own mind up, although I've made mine and that's a new and loyal customer. Thankyou

site_logo

intelligent air . 2022-08-13

MORE AT Google

Very attentive and great quality. Thank you

site_logo

Tony Harvey . 2022-08-02

MORE AT Google

Lovely food and helpful staff. We had dinner before a theatre show. we got stuck in traffic on our way so had phoned through our order and it was ready within minutes of us arriving.

site_logo

Adrian Reynolds . 2022-07-08

MORE AT Google

Really like this restaurant, the food is always delicious and the staff are friendly. We have visited here many times and have never been disappointed.

site_logo

Kitty Cat . 2022-06-20

MORE AT Google

Similary restaurants in South East

restaurant_img
4.5

1068 Opinions

location-iconThe George Yard
Thai
outdoor_seating_133355takeaway_133355delivery_133355

Good food, need some improvements. The chef uses desiccated coconut for coconut rice, You can charge a bit extra but should use fresh coconut . And need a little bit concentration on food presentation. Waiter doesn’t have knowledge on food hence can’t explain to customers when asked. Price is reasonably good. Will recommend